


| Basic Information | |
|---|---|
| Family ID | F038795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GLYQRGWENYLSLLTRYWQPYLDGRTTFDDAIAHMVSAL |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.61 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 89.70 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.485 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.939 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.848 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF02621 | VitK2_biosynth | 20.00 |
| PF13474 | SnoaL_3 | 4.24 |
| PF07969 | Amidohydro_3 | 4.24 |
| PF12390 | Se-cys_synth_N | 2.42 |
| PF03551 | PadR | 1.82 |
| PF13620 | CarboxypepD_reg | 1.82 |
| PF08818 | DUF1801 | 1.82 |
| PF00285 | Citrate_synt | 1.82 |
| PF01019 | G_glu_transpept | 1.21 |
| PF13594 | Obsolete Pfam Family | 1.21 |
| PF07843 | DUF1634 | 1.21 |
| PF01433 | Peptidase_M1 | 1.21 |
| PF01925 | TauE | 0.61 |
| PF02585 | PIG-L | 0.61 |
| PF00106 | adh_short | 0.61 |
| PF04255 | DUF433 | 0.61 |
| PF00582 | Usp | 0.61 |
| PF16757 | Fucosidase_C | 0.61 |
| PF07681 | DoxX | 0.61 |
| PF07609 | DUF1572 | 0.61 |
| PF04226 | Transgly_assoc | 0.61 |
| PF01609 | DDE_Tnp_1 | 0.61 |
| PF00754 | F5_F8_type_C | 0.61 |
| PF05726 | Pirin_C | 0.61 |
| PF13673 | Acetyltransf_10 | 0.61 |
| PF00990 | GGDEF | 0.61 |
| PF07676 | PD40 | 0.61 |
| PF14020 | DUF4236 | 0.61 |
| PF10282 | Lactonase | 0.61 |
| PF10017 | Methyltransf_33 | 0.61 |
| PF12840 | HTH_20 | 0.61 |
| PF12704 | MacB_PCD | 0.61 |
| PF08241 | Methyltransf_11 | 0.61 |
| PF01432 | Peptidase_M3 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 20.00 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 1.82 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.82 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.82 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.82 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.82 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.82 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 1.21 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.21 |
| COG4272 | Uncharacterized membrane protein | Function unknown [S] | 1.21 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.61 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.61 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.61 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.61 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.61 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.61 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.61 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.61 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.61 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.61 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.61 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.73 % |
| Unclassified | root | N/A | 7.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1021783 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10128248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100808681 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004091|Ga0062387_100540456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300004092|Ga0062389_102672342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 665 | Open in IMG/M |
| 3300005172|Ga0066683_10246236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300005332|Ga0066388_101933381 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300005343|Ga0070687_101120916 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005447|Ga0066689_10655632 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005518|Ga0070699_101957004 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005526|Ga0073909_10657469 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005537|Ga0070730_10323714 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005538|Ga0070731_10026202 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
| 3300005541|Ga0070733_11047308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer → Microbulbifer variabilis | 547 | Open in IMG/M |
| 3300005552|Ga0066701_10264623 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005553|Ga0066695_10203515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300005569|Ga0066705_10674981 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005575|Ga0066702_10300807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300005586|Ga0066691_10287004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300005602|Ga0070762_11110201 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005718|Ga0068866_10200956 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005764|Ga0066903_103036455 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005842|Ga0068858_100051650 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
| 3300005843|Ga0068860_101629627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300006059|Ga0075017_100847650 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006086|Ga0075019_10073401 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300006162|Ga0075030_101290386 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006174|Ga0075014_100696443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300006176|Ga0070765_100917659 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300006176|Ga0070765_102217004 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006794|Ga0066658_10015617 | All Organisms → cellular organisms → Bacteria | 2883 | Open in IMG/M |
| 3300006794|Ga0066658_10820950 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006797|Ga0066659_10811897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300006893|Ga0073928_10124097 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300007265|Ga0099794_10753033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300007788|Ga0099795_10499823 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009038|Ga0099829_10493679 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300009038|Ga0099829_10578294 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300009038|Ga0099829_10706535 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009038|Ga0099829_10757508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 807 | Open in IMG/M |
| 3300009088|Ga0099830_10741349 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300009088|Ga0099830_10891831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 735 | Open in IMG/M |
| 3300009089|Ga0099828_10501198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300009089|Ga0099828_11299702 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009143|Ga0099792_10280236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300009143|Ga0099792_10574438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300009143|Ga0099792_11189364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300009545|Ga0105237_10395706 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009553|Ga0105249_13424946 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010043|Ga0126380_11017330 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010046|Ga0126384_10137275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1865 | Open in IMG/M |
| 3300010047|Ga0126382_11785559 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010303|Ga0134082_10104944 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300010343|Ga0074044_10869073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010358|Ga0126370_10786557 | Not Available | 847 | Open in IMG/M |
| 3300010360|Ga0126372_10403483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300010361|Ga0126378_10250200 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300010361|Ga0126378_10638718 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300010366|Ga0126379_12424512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300010375|Ga0105239_12060818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300010397|Ga0134124_11581357 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010880|Ga0126350_10025570 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300011269|Ga0137392_10294452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1341 | Open in IMG/M |
| 3300011271|Ga0137393_10993381 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012096|Ga0137389_10730910 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012199|Ga0137383_10781878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300012202|Ga0137363_10268853 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300012205|Ga0137362_10556966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300012210|Ga0137378_10459245 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300012361|Ga0137360_10207136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300012363|Ga0137390_11836571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012582|Ga0137358_10414864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300012683|Ga0137398_11169381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012685|Ga0137397_10022852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4411 | Open in IMG/M |
| 3300012917|Ga0137395_11234268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012918|Ga0137396_11025938 | Not Available | 595 | Open in IMG/M |
| 3300012918|Ga0137396_11278092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012924|Ga0137413_10970753 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012924|Ga0137413_11291788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin325 | 585 | Open in IMG/M |
| 3300012925|Ga0137419_10356517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300012925|Ga0137419_11737563 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012927|Ga0137416_10057132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2767 | Open in IMG/M |
| 3300012927|Ga0137416_11215237 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012927|Ga0137416_11314158 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012927|Ga0137416_11697357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012944|Ga0137410_10638467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300013306|Ga0163162_11126243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium JOSHI_001 | 890 | Open in IMG/M |
| 3300015245|Ga0137409_10261342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1534 | Open in IMG/M |
| 3300015357|Ga0134072_10159156 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300015372|Ga0132256_101183187 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300016371|Ga0182034_10357193 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300017975|Ga0187782_10780874 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300017994|Ga0187822_10084119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300019883|Ga0193725_1137675 | Not Available | 538 | Open in IMG/M |
| 3300020170|Ga0179594_10090743 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300020579|Ga0210407_11026347 | Not Available | 628 | Open in IMG/M |
| 3300020579|Ga0210407_11147826 | Not Available | 587 | Open in IMG/M |
| 3300020582|Ga0210395_11042813 | Not Available | 605 | Open in IMG/M |
| 3300020583|Ga0210401_10199990 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300021046|Ga0215015_10310171 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300021170|Ga0210400_11282997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021178|Ga0210408_10273103 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300021401|Ga0210393_11403806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300021420|Ga0210394_10117909 | Not Available | 2298 | Open in IMG/M |
| 3300021420|Ga0210394_10601813 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300021420|Ga0210394_10991098 | Not Available | 728 | Open in IMG/M |
| 3300021432|Ga0210384_10036817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4523 | Open in IMG/M |
| 3300021433|Ga0210391_11538767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021474|Ga0210390_10500006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300021478|Ga0210402_10270776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1570 | Open in IMG/M |
| 3300021478|Ga0210402_10536613 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300022532|Ga0242655_10211592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300022722|Ga0242657_1013248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
| 3300024222|Ga0247691_1020569 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300024288|Ga0179589_10571259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300024330|Ga0137417_1458320 | All Organisms → cellular organisms → Bacteria | 6374 | Open in IMG/M |
| 3300024330|Ga0137417_1510361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3803 | Open in IMG/M |
| 3300025439|Ga0208323_1082469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300025899|Ga0207642_10118578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
| 3300025912|Ga0207707_10775796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300025915|Ga0207693_10063125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2902 | Open in IMG/M |
| 3300025918|Ga0207662_10559328 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300026301|Ga0209238_1072030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300026309|Ga0209055_1060015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1611 | Open in IMG/M |
| 3300026333|Ga0209158_1215248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300026334|Ga0209377_1323910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300026374|Ga0257146_1070423 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026550|Ga0209474_10049417 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300027671|Ga0209588_1192401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300027729|Ga0209248_10160298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300027738|Ga0208989_10204629 | Not Available | 652 | Open in IMG/M |
| 3300027862|Ga0209701_10062758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2365 | Open in IMG/M |
| 3300027862|Ga0209701_10196944 | Not Available | 1203 | Open in IMG/M |
| 3300027862|Ga0209701_10431031 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027889|Ga0209380_10403594 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300027903|Ga0209488_10698779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300027915|Ga0209069_10511944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300028047|Ga0209526_10430535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 871 | Open in IMG/M |
| 3300028146|Ga0247682_1008918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1728 | Open in IMG/M |
| 3300028775|Ga0302231_10218845 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300028789|Ga0302232_10410176 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300028808|Ga0302228_10270127 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300030053|Ga0302177_10322339 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300030056|Ga0302181_10503255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300030841|Ga0075384_10857139 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031128|Ga0170823_14578589 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031231|Ga0170824_121424243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031251|Ga0265327_10288737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300031545|Ga0318541_10825999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031718|Ga0307474_10766765 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031720|Ga0307469_10460650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300031753|Ga0307477_10323149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300031754|Ga0307475_10082311 | All Organisms → cellular organisms → Bacteria | 2485 | Open in IMG/M |
| 3300031754|Ga0307475_10267579 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300031764|Ga0318535_10566675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300031823|Ga0307478_11019855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300031912|Ga0306921_11412249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300031962|Ga0307479_10368705 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300031962|Ga0307479_11194964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
| 3300032090|Ga0318518_10158325 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300032174|Ga0307470_10365070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300032180|Ga0307471_100196239 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300032955|Ga0335076_10431563 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.21% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.61% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10217833 | 3300000651 | Forest Soil | REGLYRRGWENYLRILAQYWQPYLDGRVDFSDAVAHMVSAL* |
| AF_2010_repII_A001DRAFT_101282482 | 3300000793 | Forest Soil | MLRFHRGYDTYAFREGLYQRGWKSYLELLQRFWQPYLDGKASFDDAIARMVSSL* |
| JGIcombinedJ26739_1008086812 | 3300002245 | Forest Soil | YAMREGLYQRGWENYLALLNRYWQPYLEGRATFDDAIAHMASAL* |
| Ga0062387_1005404561 | 3300004091 | Bog Forest Soil | LREGLYQRGWNDYYKLLQKFWQPYLDGTASFDDAIARMVSSL* |
| Ga0062389_1026723422 | 3300004092 | Bog Forest Soil | IREGLYARGWDDYLPLLTRFWQPYLDGHASFDDAIARMVSSL* |
| Ga0066683_102462361 | 3300005172 | Soil | YAVREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL* |
| Ga0066388_1019333812 | 3300005332 | Tropical Forest Soil | LESYKPYAMREGLYRRGWERYLELLTTFWQPYLDNRETFDDAIARMVSAL* |
| Ga0070687_1011209161 | 3300005343 | Switchgrass Rhizosphere | EGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL* |
| Ga0066689_106556322 | 3300005447 | Soil | VREGLYKRGWENYLRVLTQYWQPYLDGKVTFEDSIAHMVSAL* |
| Ga0070699_1019570042 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLYQRGWENYLQLLTRYWQPYLESRVTFDDAIAHMVSAL* |
| Ga0073909_106574692 | 3300005526 | Surface Soil | PYALREGLYERGWKNYLDVLQRFWQPYLDGHATFSDAIARMVSSL* |
| Ga0070730_103237143 | 3300005537 | Surface Soil | TGYDTYAFREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL* |
| Ga0070731_100262024 | 3300005538 | Surface Soil | KRGWENYLRILTQFWQPYLDGRVEFSDAIAHMVSAL* |
| Ga0070733_110473081 | 3300005541 | Surface Soil | TPYAVRERLFQRGWDQYLKLLERFWQPYLDGNVTFDDAIAHMVSAL* |
| Ga0066701_102646232 | 3300005552 | Soil | REGLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL* |
| Ga0066695_102035151 | 3300005553 | Soil | VREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL* |
| Ga0066705_106749811 | 3300005569 | Soil | EGLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL* |
| Ga0066702_103008071 | 3300005575 | Soil | YQRGWKSYLELLQRFWQPYLDGKATFDDAIARMVSSL* |
| Ga0066691_102870041 | 3300005586 | Soil | GWEDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL* |
| Ga0070762_111102011 | 3300005602 | Soil | LYQRGWNDYYKLLQRFWQPYLNGQATFDDAVARMVSQL* |
| Ga0068866_102009561 | 3300005718 | Miscanthus Rhizosphere | YQRGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL* |
| Ga0066903_1030364552 | 3300005764 | Tropical Forest Soil | LYKRGWQDYLRVLTEFWQPYLDGKASFDDAIAHMVSAL* |
| Ga0068858_1000516505 | 3300005842 | Switchgrass Rhizosphere | AVREGLYKRGWENYLRVLTQYWQPYLDGRVEFSDAVAHMVSAL* |
| Ga0068860_1016296271 | 3300005843 | Switchgrass Rhizosphere | GWENYLRILTQYWQPYLDGRVDFSDAVAHMVSAL* |
| Ga0075017_1008476502 | 3300006059 | Watersheds | QRGWEDYLHLLTTFWQPYLDGRVTFEDAIAHMVSAL* |
| Ga0075019_100734012 | 3300006086 | Watersheds | GWSDYYKLLQKFWQPYLDGTATFDDAIARMVSAL* |
| Ga0075030_1012903862 | 3300006162 | Watersheds | YTRGWDAYLKLLTRFWQPYLDGKSSFDDAIARLVSAL* |
| Ga0075014_1006964432 | 3300006174 | Watersheds | YERGWKDYLELLTRFWQPYLDNKATFDDAIARMVSAL* |
| Ga0070765_1009176591 | 3300006176 | Soil | EGLYERGWDDYLKLLTRFWQPYLDGRSSFDDAIARMVSSL* |
| Ga0070765_1022170041 | 3300006176 | Soil | YAIREGLYERGWKDYLQLLSRFWQPYLDNKSTFDDAIARMVSAL* |
| Ga0066658_100156171 | 3300006794 | Soil | YQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMDSSL* |
| Ga0066658_108209501 | 3300006794 | Soil | GLYQRGWNDYFKLLQKFWQPYLDGSASFDDAIARMVSSL* |
| Ga0066659_108118972 | 3300006797 | Soil | LYKRGWENYLRVLIQYWQPYLDGSATYDDAIAHMVSAL* |
| Ga0073928_101240974 | 3300006893 | Iron-Sulfur Acid Spring | FRERLYQRGWDDYLKLLERFWQPYLDGTATFDDAIAHIVSAL* |
| Ga0099794_107530331 | 3300007265 | Vadose Zone Soil | GLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL* |
| Ga0099795_104998232 | 3300007788 | Vadose Zone Soil | GWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL* |
| Ga0099829_104936791 | 3300009038 | Vadose Zone Soil | LREGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAVARMVSSL* |
| Ga0099829_105782943 | 3300009038 | Vadose Zone Soil | PYAKREGLYQRGWENYLQLLTRYWQPYLDGQTTFDNAIAHMVSAL* |
| Ga0099829_107065351 | 3300009038 | Vadose Zone Soil | PYAKREGLYQRGWENYLQLLIRYWQPYLDGTVTFDNAIAHMVSAL* |
| Ga0099829_107575083 | 3300009038 | Vadose Zone Soil | PYAKREGLYQRGWENYLQLLTRYWQPYLDGQTTFDNAIAHIVSAL* |
| Ga0099830_107413492 | 3300009088 | Vadose Zone Soil | YAVREGLYQRGWNDYFKLLQKFWQPYLDGSASFDDAIARMVSSL* |
| Ga0099830_108918311 | 3300009088 | Vadose Zone Soil | REGLYKRGWDEYLKLLNRFWQPYLDNKVTFDDAIARMVSAQ* |
| Ga0099828_105011981 | 3300009089 | Vadose Zone Soil | LYTRGWSGYLLLLERFWQPYLDGKTDFDAAIARMVSSL* |
| Ga0099828_112997021 | 3300009089 | Vadose Zone Soil | EGLYTRGWSGYLLLLERFWQPYLDGKTDFDAAIARMVSSL* |
| Ga0099792_102802362 | 3300009143 | Vadose Zone Soil | YAKREGLYQRGWESYLQLLTLYWQPYLDGRVTFDNAIAHIVSAL* |
| Ga0099792_105744381 | 3300009143 | Vadose Zone Soil | TPYAKREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL* |
| Ga0099792_111893641 | 3300009143 | Vadose Zone Soil | ALREGLYQRGWNDYFKLLQRFWQPYLDGTATFDDAIARMVSSL* |
| Ga0105237_103957062 | 3300009545 | Corn Rhizosphere | YEPYAVRERLYQRGWDEYLKLLERFWQPYLDGNVTFDDAIAHMVSAL* |
| Ga0105249_134249461 | 3300009553 | Switchgrass Rhizosphere | RGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL* |
| Ga0126380_110173302 | 3300010043 | Tropical Forest Soil | YMPYAVRERLYQRGWDEYLKLLERFWQPYLDGQATFDDAIAHMVSAL* |
| Ga0126384_101372751 | 3300010046 | Tropical Forest Soil | RGWENYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL* |
| Ga0126382_117855591 | 3300010047 | Tropical Forest Soil | QIENYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL* |
| Ga0134082_101049441 | 3300010303 | Grasslands Soil | GLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL* |
| Ga0074044_108690731 | 3300010343 | Bog Forest Soil | EGLYERGWKDYLQLLTRFWQPYLDNKSTFDDSIARMVSAL* |
| Ga0126370_107865572 | 3300010358 | Tropical Forest Soil | LYQRGWDQYLKLLTRFWQPYLEGKSTFDDAIARMVSAL* |
| Ga0126372_104034831 | 3300010360 | Tropical Forest Soil | YAVREGLYKRGWQDYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL* |
| Ga0126378_102502003 | 3300010361 | Tropical Forest Soil | YQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL* |
| Ga0126378_106387182 | 3300010361 | Tropical Forest Soil | YAFREGLYQRGWKSYLELLQRFWQPYLDGKASFDDAIARMVSSL* |
| Ga0126379_124245122 | 3300010366 | Tropical Forest Soil | VREDLYKRGWENYLRILTQYWQPYLDGRVDFSDAVAHMVSAL* |
| Ga0105239_120608182 | 3300010375 | Corn Rhizosphere | NGEYTPYPVRERLYQRGWDEYLKLLERFWQPYLDGNVTFDDAIAHMVSAL* |
| Ga0134124_115813571 | 3300010397 | Terrestrial Soil | KRGWQNYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL* |
| Ga0126350_100255701 | 3300010880 | Boreal Forest Soil | YQRGWDGYFQLLTKYWQPYLNGTVPFDDAIARMVSSL* |
| Ga0137392_102944521 | 3300011269 | Vadose Zone Soil | YAKREGLYQRGWENYLSLLTHYWQPYLQGRTTFDDAIAHMVSAL* |
| Ga0137393_109933811 | 3300011271 | Vadose Zone Soil | GLYQRGWSDYFKLLQKFWQPYLDGTASFDDAIARMVSSL* |
| Ga0137389_107309102 | 3300012096 | Vadose Zone Soil | QRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL* |
| Ga0137383_107818781 | 3300012199 | Vadose Zone Soil | PYAVREGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL* |
| Ga0137363_102688531 | 3300012202 | Vadose Zone Soil | RGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL* |
| Ga0137362_105569661 | 3300012205 | Vadose Zone Soil | YKRGWENYLRILTEYWQPYLDGRVTFDDAIAHMVSAL* |
| Ga0137378_104592451 | 3300012210 | Vadose Zone Soil | EGLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL* |
| Ga0137360_102071361 | 3300012361 | Vadose Zone Soil | KREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL* |
| Ga0137390_118365711 | 3300012363 | Vadose Zone Soil | YALREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL* |
| Ga0137358_104148643 | 3300012582 | Vadose Zone Soil | YRRGWENYLQILTRYWQPYLEGRVTFDDAIAHMVSAL* |
| Ga0137398_111693811 | 3300012683 | Vadose Zone Soil | YAVREGLYQRGWSDYFKLLQKFWQPYLDGTASFDDAIARMVSSL* |
| Ga0137397_100228521 | 3300012685 | Vadose Zone Soil | GWNDFFKMLQRFWQPYLDGTATFDDAIARMVSSL* |
| Ga0137395_112342681 | 3300012917 | Vadose Zone Soil | AKREGLYQRGWENYLQILTRYWQPYLEGHVPFDDAIAHMVSAL* |
| Ga0137396_110259381 | 3300012918 | Vadose Zone Soil | YTRGWDAYLKLLTTFWQPYLDGKSTFDDAIARMVSAL* |
| Ga0137396_112780921 | 3300012918 | Vadose Zone Soil | EGLYQRGWENYLSLLTRYWQPYLNGRTTFDDAIAHMVSAL* |
| Ga0137413_109707531 | 3300012924 | Vadose Zone Soil | LYKRGWENYLRLLTEYWQPYLDGRVPFDDAIAHMVSAL* |
| Ga0137413_112917881 | 3300012924 | Vadose Zone Soil | YKRGWEDYLRVLTQYWQPYLDGNVSYDDAIAHMVSAL* |
| Ga0137419_103565173 | 3300012925 | Vadose Zone Soil | YQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL* |
| Ga0137419_117375631 | 3300012925 | Vadose Zone Soil | RGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL* |
| Ga0137416_100571322 | 3300012927 | Vadose Zone Soil | LYQRGWTDYFKLLQKFWQPYLDGGATFDDAIARMVSSL* |
| Ga0137416_112152371 | 3300012927 | Vadose Zone Soil | REGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAIARMVSSL* |
| Ga0137416_113141582 | 3300012927 | Vadose Zone Soil | EGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL* |
| Ga0137416_116973572 | 3300012927 | Vadose Zone Soil | AIRERLYERGWDGYLQLLTRFWQPYLDGKSTYDDAIARMVSSL* |
| Ga0137410_106384672 | 3300012944 | Vadose Zone Soil | YERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL* |
| Ga0163162_111262431 | 3300013306 | Switchgrass Rhizosphere | YKRGWENYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL* |
| Ga0137409_102613421 | 3300015245 | Vadose Zone Soil | KRGWENYLRVLTQYWQPYLDGSVTFDDAIAHMVSAL* |
| Ga0134072_101591561 | 3300015357 | Grasslands Soil | LREGLYQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMVSSL* |
| Ga0132256_1011831871 | 3300015372 | Arabidopsis Rhizosphere | KRGWENYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL* |
| Ga0182034_103571931 | 3300016371 | Soil | VPYAVREGLYKRGWENYLRILTEYWQPYLDGRVDFSDAIAHMVSAL |
| Ga0187782_107808741 | 3300017975 | Tropical Peatland | ERGWKEYYSLLEQFWQPYLDGRASYDDAIARMVSSL |
| Ga0187822_100841191 | 3300017994 | Freshwater Sediment | GLYKRGWENYLRILTQYWQPYLDGSVEFSDAIAHMVSAL |
| Ga0193725_11376751 | 3300019883 | Soil | ERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL |
| Ga0179594_100907431 | 3300020170 | Vadose Zone Soil | ALREGLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL |
| Ga0210407_110263472 | 3300020579 | Soil | GLYERGWKGYLDVLQRFWQPYLDGQATFSDAVARMVSSL |
| Ga0210407_111478262 | 3300020579 | Soil | GLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0210395_110428132 | 3300020582 | Soil | VREQLYKRGWDEYLKLLERFWQPYLDGNVSFDDAIAHMVSAL |
| Ga0210401_101999902 | 3300020583 | Soil | REGLYERGWKDYLQLLNRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0215015_103101712 | 3300021046 | Soil | VYKRQGYLLLLERFWQPYLDGKTDFDAAIARMVSSL |
| Ga0210400_112829971 | 3300021170 | Soil | EGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAIARMVSSL |
| Ga0210408_102731031 | 3300021178 | Soil | GLYQRGWNDYYKLLQKFWQPYLDGTATFDDAIARMVSSL |
| Ga0210393_114038062 | 3300021401 | Soil | GLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL |
| Ga0210394_101179095 | 3300021420 | Soil | EGLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0210394_106018132 | 3300021420 | Soil | YAIREGIYQRGWDGYLKLLTQFWQPYLDGNSTFDDAVARMVSAL |
| Ga0210394_109910982 | 3300021420 | Soil | VLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0210384_100368174 | 3300021432 | Soil | LPISPYAIREGLYQRGWENYFQMLTHYWQPYLEGRVTFDDAIAHMVSAL |
| Ga0210391_115387672 | 3300021433 | Soil | YERGWKDYLQLLTRFWQPYLDNQSTFDDAIARMVSAL |
| Ga0210390_105000061 | 3300021474 | Soil | AIREGLYQRGWNDYFQLLIRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0210402_102707761 | 3300021478 | Soil | PYAIREGLYERGWKDYLDLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0210402_105366131 | 3300021478 | Soil | LYQRDWDDYLKLLTRFWQPYLDGRVTFDDAIAHMVSAL |
| Ga0242655_102115922 | 3300022532 | Soil | ENLYKRGWESYLPILTRYWQPYLEGQVTFDDAIAHMVSAL |
| Ga0242657_10132484 | 3300022722 | Soil | YERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0247691_10205691 | 3300024222 | Soil | RLYQRGWDDYLKLLERFWEPYLENRVTFDDAIAHIVSAL |
| Ga0179589_105712591 | 3300024288 | Vadose Zone Soil | YAKREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL |
| Ga0137417_14583201 | 3300024330 | Vadose Zone Soil | KRDGWNDYFRLLRQFWQPYLERKPPFADAIARMVSSV |
| Ga0137417_15103616 | 3300024330 | Vadose Zone Soil | VREGLYQRGWSDYFKLLQKFWQPYLDGNASFDDAIARMVSSL |
| Ga0208323_10824692 | 3300025439 | Peatland | AMREGLYTHRWSNYLRVIQKYWQPYLDGSADFGDAIARMVSSL |
| Ga0207642_101185782 | 3300025899 | Miscanthus Rhizosphere | ERLYQRGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL |
| Ga0207707_107757963 | 3300025912 | Corn Rhizosphere | GLYQRGWENYLSLLTRYWQPYLDGRTTFDDAIAHMVSAL |
| Ga0207693_100631251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VREGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL |
| Ga0207662_105593281 | 3300025918 | Switchgrass Rhizosphere | EGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL |
| Ga0209238_10720301 | 3300026301 | Grasslands Soil | REGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL |
| Ga0209055_10600153 | 3300026309 | Soil | ALREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL |
| Ga0209158_11061291 | 3300026333 | Soil | KRGWAGYQRALEQFWQPYLDGKADFDDAIARIVSAL |
| Ga0209158_12152482 | 3300026333 | Soil | EGLYQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMVSSL |
| Ga0209377_13239101 | 3300026334 | Soil | GLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL |
| Ga0257146_10704231 | 3300026374 | Soil | AVREGLYKRGWEDYLRVLTQFWQPYLDGKESFDDAIAHMVSAL |
| Ga0209474_100494171 | 3300026550 | Soil | RGWKNYLELLQRFWQAYLDGKASFDDAIARMVSSL |
| Ga0209588_11924012 | 3300027671 | Vadose Zone Soil | EGLYQRGWENYLQILTRYWQPYQPYLEGHVTFDDAIAHMVSAL |
| Ga0209248_101602981 | 3300027729 | Bog Forest Soil | YQRGWDDYLKLLTRFWQPYLDGKVTFDDAIARMVSSL |
| Ga0208989_102046291 | 3300027738 | Forest Soil | REGLYRRGWKNYLDVLQRFWQPYLDGRATFSDAVARMVSSL |
| Ga0209701_100627583 | 3300027862 | Vadose Zone Soil | VREGLYKRGWDEYLKLLNRFWQPYLDNKVTFDDAIARMVSAQ |
| Ga0209701_101969442 | 3300027862 | Vadose Zone Soil | VREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL |
| Ga0209701_104310312 | 3300027862 | Vadose Zone Soil | ALREGLYQRGWNDYFKLLQKFWQPYLDGRATFDDAIARMVSSL |
| Ga0209380_104035942 | 3300027889 | Soil | YAVREQLFKRGWDEYLKLLERFWQPYLDGNVSFDDAIAHMVSAL |
| Ga0209488_106987791 | 3300027903 | Vadose Zone Soil | AVREGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL |
| Ga0209069_105119442 | 3300027915 | Watersheds | YTPYAQREGLYHRGWDSYFQLLSLYWQPYLDGKVTFDNAIAHMVSAL |
| Ga0209526_104305351 | 3300028047 | Forest Soil | VPYAIREGLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0247682_10089183 | 3300028146 | Soil | LYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL |
| Ga0302231_102188451 | 3300028775 | Palsa | GLYLRGWDDYLRVLNRFWQPYLDGTASFDDAIARMVSAL |
| Ga0302232_104101761 | 3300028789 | Palsa | VKQGLYQRGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL |
| Ga0302228_102701271 | 3300028808 | Palsa | YQRGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL |
| Ga0302177_103223393 | 3300030053 | Palsa | AVKEGLYLRGWDDYLRVLNRFWQPYLDGTASFDDAIARMVSAL |
| Ga0302181_105032552 | 3300030056 | Palsa | RGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL |
| Ga0075384_108571392 | 3300030841 | Soil | PYAVREGLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL |
| Ga0170823_145785892 | 3300031128 | Forest Soil | YKRGWENYLRLLTEYWQPYLDGRVSFDDAIAHMVSAL |
| Ga0170824_1214242431 | 3300031231 | Forest Soil | TPYAIREGLYERGWKDYLDLLTRFWQPYLDNKSTFDDAIARMVSAL |
| Ga0265327_102887372 | 3300031251 | Rhizosphere | NLSQRGWDDYLHLLTTFWQPYLDGRVTFEDAIAHMVSAL |
| Ga0318541_108259992 | 3300031545 | Soil | VREGLYKRGWENYLRILTEYWQPYLDGRVDFSDAIAHMVSAL |
| Ga0307474_107667652 | 3300031718 | Hardwood Forest Soil | NGEYTPYAVREQLYKRGWDTYLKLLDQFWQPYLDGKVSFDDAIAHMVSAL |
| Ga0307469_104606502 | 3300031720 | Hardwood Forest Soil | REGLYQRGWDRYLTLLTTFWQPYLDNQETFDDAIARMVSAL |
| Ga0307477_103231493 | 3300031753 | Hardwood Forest Soil | QRGWENYLQLLTRYWQPYLQGQVTFDDAIAHMVSAL |
| Ga0307475_100823111 | 3300031754 | Hardwood Forest Soil | QDAEYTPYAMREGLYQRGWENYLTLLTHYWQPYLEGRATFDDAIAHMVSAL |
| Ga0307475_102675792 | 3300031754 | Hardwood Forest Soil | KRGWENYLRILTEYWQPYLDGRVTFDDAIAHMVSAL |
| Ga0318535_105666751 | 3300031764 | Soil | MREGLYQRNWDRYLELLTTFWQPYLEGQASFDDAIARMVSGL |
| Ga0307478_110198551 | 3300031823 | Hardwood Forest Soil | VREGLYERGWKDYLQLLTHYWQPYLDNKTTFDDAIAHMVSNL |
| Ga0306921_114122492 | 3300031912 | Soil | LYQHGWSSYYKLLARFWQPYLDGHATFDDAIARMISAL |
| Ga0307479_103687052 | 3300031962 | Hardwood Forest Soil | GLYQRGWNDYFKLLQRFWQPYLDGRASFDDAIARMVSSL |
| Ga0307479_111949643 | 3300031962 | Hardwood Forest Soil | RLYQRGWDEYLKLLERFWQPYLDGKTTFDDAIAHIVSAL |
| Ga0318518_101583251 | 3300032090 | Soil | DMYAFREGLYQRGWKNYLELLQRFWQPYLDGKASFDDAIARMVSSL |
| Ga0307470_103650701 | 3300032174 | Hardwood Forest Soil | GLYQRGWENYFEILSRYWQPYLESRVTFDDAIAHMVSAL |
| Ga0307471_1001962391 | 3300032180 | Hardwood Forest Soil | AVREGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL |
| Ga0335076_100835053 | 3300032955 | Soil | ATTYTSGALQERLYSRGWQDYYRVLSDYWQPYLDGNVGFEDAIAHMVSAL |
| Ga0335076_104315631 | 3300032955 | Soil | LYQRNWDEYLKLLERFWQPYLDGNATFEDAIARMVSAL |
| ⦗Top⦘ |