


| Basic Information | |
|---|---|
| Family ID | F038772 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 40 residues |
| Representative Sequence | YTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.44 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (46.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.697 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF12840 | HTH_20 | 4.24 |
| PF03551 | PadR | 3.03 |
| PF07690 | MFS_1 | 3.03 |
| PF03795 | YCII | 2.42 |
| PF12706 | Lactamase_B_2 | 2.42 |
| PF05988 | DUF899 | 2.42 |
| PF00756 | Esterase | 1.82 |
| PF00491 | Arginase | 1.82 |
| PF00440 | TetR_N | 1.82 |
| PF09656 | PGPGW | 1.82 |
| PF12697 | Abhydrolase_6 | 1.82 |
| PF13561 | adh_short_C2 | 1.21 |
| PF12802 | MarR_2 | 1.21 |
| PF01243 | Putative_PNPOx | 1.21 |
| PF03992 | ABM | 1.21 |
| PF00082 | Peptidase_S8 | 1.21 |
| PF13649 | Methyltransf_25 | 1.21 |
| PF01872 | RibD_C | 1.21 |
| PF02518 | HATPase_c | 1.21 |
| PF13191 | AAA_16 | 0.61 |
| PF00730 | HhH-GPD | 0.61 |
| PF00702 | Hydrolase | 0.61 |
| PF12399 | BCA_ABC_TP_C | 0.61 |
| PF00903 | Glyoxalase | 0.61 |
| PF01042 | Ribonuc_L-PSP | 0.61 |
| PF04542 | Sigma70_r2 | 0.61 |
| PF13302 | Acetyltransf_3 | 0.61 |
| PF01494 | FAD_binding_3 | 0.61 |
| PF07978 | NIPSNAP | 0.61 |
| PF02371 | Transposase_20 | 0.61 |
| PF13466 | STAS_2 | 0.61 |
| PF02826 | 2-Hacid_dh_C | 0.61 |
| PF00589 | Phage_integrase | 0.61 |
| PF00248 | Aldo_ket_red | 0.61 |
| PF00664 | ABC_membrane | 0.61 |
| PF01638 | HxlR | 0.61 |
| PF09922 | DUF2154 | 0.61 |
| PF13560 | HTH_31 | 0.61 |
| PF13413 | HTH_25 | 0.61 |
| PF09994 | DUF2235 | 0.61 |
| PF00698 | Acyl_transf_1 | 0.61 |
| PF13404 | HTH_AsnC-type | 0.61 |
| PF07730 | HisKA_3 | 0.61 |
| PF08240 | ADH_N | 0.61 |
| PF01047 | MarR | 0.61 |
| PF00126 | HTH_1 | 0.61 |
| PF00300 | His_Phos_1 | 0.61 |
| PF00415 | RCC1 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.64 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.03 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 3.03 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.42 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.82 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.21 |
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 1.21 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.21 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.21 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.61 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.61 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.61 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.61 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.61 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.61 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.61 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.61 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.61 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.61 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.61 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.61 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.61 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.61 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.61 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.61 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.91 % |
| Unclassified | root | N/A | 29.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_105371048 | Not Available | 650 | Open in IMG/M |
| 3300005578|Ga0068854_100766623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300005602|Ga0070762_11016361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 569 | Open in IMG/M |
| 3300005764|Ga0066903_103289863 | Not Available | 873 | Open in IMG/M |
| 3300005764|Ga0066903_103940318 | Not Available | 796 | Open in IMG/M |
| 3300006034|Ga0066656_11034711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300006175|Ga0070712_101888353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 523 | Open in IMG/M |
| 3300006358|Ga0068871_101088821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300006854|Ga0075425_100055488 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
| 3300007265|Ga0099794_10554930 | Not Available | 607 | Open in IMG/M |
| 3300009147|Ga0114129_10604246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1421 | Open in IMG/M |
| 3300009792|Ga0126374_10134052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1472 | Open in IMG/M |
| 3300010048|Ga0126373_10968678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
| 3300010048|Ga0126373_12923708 | Not Available | 533 | Open in IMG/M |
| 3300010358|Ga0126370_11098069 | Not Available | 733 | Open in IMG/M |
| 3300010359|Ga0126376_12686013 | Not Available | 547 | Open in IMG/M |
| 3300010360|Ga0126372_10860674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 905 | Open in IMG/M |
| 3300010360|Ga0126372_12350330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 583 | Open in IMG/M |
| 3300010361|Ga0126378_10057999 | All Organisms → cellular organisms → Bacteria | 3647 | Open in IMG/M |
| 3300010361|Ga0126378_10308150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300010362|Ga0126377_11449662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300010366|Ga0126379_11664281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300010366|Ga0126379_13163206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sinosporangium → Sinosporangium album | 551 | Open in IMG/M |
| 3300010376|Ga0126381_100602893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1562 | Open in IMG/M |
| 3300010376|Ga0126381_100717703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1431 | Open in IMG/M |
| 3300010376|Ga0126381_101539631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
| 3300010376|Ga0126381_102186530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300010376|Ga0126381_103115435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300010376|Ga0126381_103350462 | Not Available | 631 | Open in IMG/M |
| 3300010379|Ga0136449_100259554 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
| 3300010379|Ga0136449_100724780 | Not Available | 1662 | Open in IMG/M |
| 3300010379|Ga0136449_104334190 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010398|Ga0126383_12445923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 607 | Open in IMG/M |
| 3300010868|Ga0124844_1289424 | Not Available | 559 | Open in IMG/M |
| 3300011270|Ga0137391_10295677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1398 | Open in IMG/M |
| 3300011270|Ga0137391_11215379 | Not Available | 601 | Open in IMG/M |
| 3300012207|Ga0137381_11483813 | Not Available | 570 | Open in IMG/M |
| 3300012351|Ga0137386_10691710 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012514|Ga0157330_1081679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300012944|Ga0137410_11829434 | Not Available | 537 | Open in IMG/M |
| 3300012948|Ga0126375_11131608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300012971|Ga0126369_10848899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 997 | Open in IMG/M |
| 3300012971|Ga0126369_11723399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300016294|Ga0182041_10831439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
| 3300016357|Ga0182032_10034300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3138 | Open in IMG/M |
| 3300016371|Ga0182034_10097599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2095 | Open in IMG/M |
| 3300016387|Ga0182040_10061455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2392 | Open in IMG/M |
| 3300016404|Ga0182037_10435706 | Not Available | 1087 | Open in IMG/M |
| 3300016422|Ga0182039_11045531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
| 3300016422|Ga0182039_11449067 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300016445|Ga0182038_10013603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4684 | Open in IMG/M |
| 3300017932|Ga0187814_10001505 | All Organisms → cellular organisms → Bacteria | 8991 | Open in IMG/M |
| 3300017943|Ga0187819_10190663 | Not Available | 1212 | Open in IMG/M |
| 3300017966|Ga0187776_10314025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1023 | Open in IMG/M |
| 3300017974|Ga0187777_10794467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
| 3300018064|Ga0187773_10882325 | Not Available | 576 | Open in IMG/M |
| 3300020581|Ga0210399_11484329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 527 | Open in IMG/M |
| 3300020583|Ga0210401_10019196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6579 | Open in IMG/M |
| 3300021178|Ga0210408_10662429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300021401|Ga0210393_10591229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300021402|Ga0210385_10733404 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021404|Ga0210389_10152508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1793 | Open in IMG/M |
| 3300021404|Ga0210389_10708399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 788 | Open in IMG/M |
| 3300021406|Ga0210386_10784178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300021478|Ga0210402_11033179 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300021560|Ga0126371_10553993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1299 | Open in IMG/M |
| 3300021560|Ga0126371_11234354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
| 3300021560|Ga0126371_13027184 | Not Available | 569 | Open in IMG/M |
| 3300021860|Ga0213851_1076349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 594 | Open in IMG/M |
| 3300025898|Ga0207692_10547151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 739 | Open in IMG/M |
| 3300025915|Ga0207693_11206033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 570 | Open in IMG/M |
| 3300025915|Ga0207693_11259259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 555 | Open in IMG/M |
| 3300025927|Ga0207687_10682403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300026314|Ga0209268_1195303 | Not Available | 502 | Open in IMG/M |
| 3300027884|Ga0209275_10697166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 585 | Open in IMG/M |
| 3300027911|Ga0209698_10346570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300028047|Ga0209526_10375263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides gansuensis | 948 | Open in IMG/M |
| 3300028768|Ga0307280_10052487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1277 | Open in IMG/M |
| 3300031231|Ga0170824_115219349 | Not Available | 620 | Open in IMG/M |
| 3300031474|Ga0170818_104724108 | Not Available | 596 | Open in IMG/M |
| 3300031544|Ga0318534_10112905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1560 | Open in IMG/M |
| 3300031544|Ga0318534_10510067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300031549|Ga0318571_10110485 | Not Available | 911 | Open in IMG/M |
| 3300031549|Ga0318571_10160106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300031549|Ga0318571_10257640 | Not Available | 643 | Open in IMG/M |
| 3300031561|Ga0318528_10585525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 599 | Open in IMG/M |
| 3300031564|Ga0318573_10016794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3226 | Open in IMG/M |
| 3300031564|Ga0318573_10432236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300031564|Ga0318573_10745774 | Not Available | 526 | Open in IMG/M |
| 3300031572|Ga0318515_10229761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300031572|Ga0318515_10493080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300031572|Ga0318515_10653587 | Not Available | 557 | Open in IMG/M |
| 3300031640|Ga0318555_10574540 | Not Available | 611 | Open in IMG/M |
| 3300031640|Ga0318555_10686188 | Not Available | 554 | Open in IMG/M |
| 3300031680|Ga0318574_10626768 | Not Available | 630 | Open in IMG/M |
| 3300031713|Ga0318496_10328934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 844 | Open in IMG/M |
| 3300031713|Ga0318496_10580231 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031719|Ga0306917_10570206 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300031720|Ga0307469_11247902 | Not Available | 704 | Open in IMG/M |
| 3300031723|Ga0318493_10687683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300031724|Ga0318500_10710232 | Not Available | 513 | Open in IMG/M |
| 3300031747|Ga0318502_10899066 | Not Available | 538 | Open in IMG/M |
| 3300031748|Ga0318492_10403540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300031763|Ga0318537_10293404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 602 | Open in IMG/M |
| 3300031765|Ga0318554_10373256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300031768|Ga0318509_10246153 | Not Available | 998 | Open in IMG/M |
| 3300031769|Ga0318526_10312969 | Not Available | 642 | Open in IMG/M |
| 3300031770|Ga0318521_10198802 | Not Available | 1157 | Open in IMG/M |
| 3300031770|Ga0318521_10351393 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300031770|Ga0318521_10724712 | Not Available | 604 | Open in IMG/M |
| 3300031778|Ga0318498_10057813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1729 | Open in IMG/M |
| 3300031779|Ga0318566_10165457 | Not Available | 1097 | Open in IMG/M |
| 3300031781|Ga0318547_10285404 | Not Available | 1001 | Open in IMG/M |
| 3300031782|Ga0318552_10534309 | Not Available | 599 | Open in IMG/M |
| 3300031782|Ga0318552_10650733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300031782|Ga0318552_10721368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300031797|Ga0318550_10170436 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031799|Ga0318565_10631619 | Not Available | 514 | Open in IMG/M |
| 3300031819|Ga0318568_10285901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300031821|Ga0318567_10299486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300031833|Ga0310917_10216879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea | 1282 | Open in IMG/M |
| 3300031833|Ga0310917_10680057 | Not Available | 697 | Open in IMG/M |
| 3300031859|Ga0318527_10048910 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300031893|Ga0318536_10237674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 926 | Open in IMG/M |
| 3300031894|Ga0318522_10157910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea | 855 | Open in IMG/M |
| 3300031894|Ga0318522_10272314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300031896|Ga0318551_10334140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 856 | Open in IMG/M |
| 3300031896|Ga0318551_10958078 | Not Available | 501 | Open in IMG/M |
| 3300031912|Ga0306921_10327532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1792 | Open in IMG/M |
| 3300031912|Ga0306921_11558304 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031946|Ga0310910_10394523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300031947|Ga0310909_10150051 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300031947|Ga0310909_10321610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1298 | Open in IMG/M |
| 3300032001|Ga0306922_11606507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300032009|Ga0318563_10307365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 858 | Open in IMG/M |
| 3300032009|Ga0318563_10779490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300032010|Ga0318569_10167000 | Not Available | 1016 | Open in IMG/M |
| 3300032025|Ga0318507_10344021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 649 | Open in IMG/M |
| 3300032039|Ga0318559_10283107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300032039|Ga0318559_10297467 | Not Available | 749 | Open in IMG/M |
| 3300032039|Ga0318559_10384879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300032039|Ga0318559_10607408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300032041|Ga0318549_10309714 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032041|Ga0318549_10349193 | Not Available | 666 | Open in IMG/M |
| 3300032044|Ga0318558_10174905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300032055|Ga0318575_10371963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300032065|Ga0318513_10611173 | Not Available | 534 | Open in IMG/M |
| 3300032067|Ga0318524_10347249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300032076|Ga0306924_10493081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1396 | Open in IMG/M |
| 3300032089|Ga0318525_10267861 | Not Available | 878 | Open in IMG/M |
| 3300032089|Ga0318525_10589712 | Not Available | 567 | Open in IMG/M |
| 3300032090|Ga0318518_10279733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 857 | Open in IMG/M |
| 3300032094|Ga0318540_10218561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
| 3300032160|Ga0311301_10216075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3246 | Open in IMG/M |
| 3300032160|Ga0311301_10747051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300032205|Ga0307472_101419406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300032261|Ga0306920_102048485 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300032515|Ga0348332_10393764 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300032770|Ga0335085_10186854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2552 | Open in IMG/M |
| 3300032805|Ga0335078_10826404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300032828|Ga0335080_10638471 | Not Available | 1116 | Open in IMG/M |
| 3300032896|Ga0335075_10170952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2664 | Open in IMG/M |
| 3300033134|Ga0335073_10056567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5215 | Open in IMG/M |
| 3300033289|Ga0310914_10682136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 923 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 46.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.21% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1053710482 | 3300005332 | Tropical Forest Soil | DRYTDQMLHVWVVPYPGGVFSDDLSASATNAAVQAVLAQHG* |
| Ga0068854_1007666231 | 3300005578 | Corn Rhizosphere | TAQMLHVWVVPYPGGPFSDDLSRAATNAAVRSVLARQ* |
| Ga0070762_110163611 | 3300005602 | Soil | TAQMLHVWVVPYPGGVFSDDLSAAATSAAVQAALAGRSS* |
| Ga0066903_1032898632 | 3300005764 | Tropical Forest Soil | DRYTAQMLHVWVVPYPGGPFSDDLSAAATNAAVRAVLGRG* |
| Ga0066903_1039403181 | 3300005764 | Tropical Forest Soil | RYTTQMLHVWVVPYPGGVFSDDLSAAATRAAVQAVLSEHA* |
| Ga0066656_110347112 | 3300006034 | Soil | DRYTAQMLHVWVVPYPGGPFSDDLSPAATNAAVRAALGRQ* |
| Ga0070712_1018883531 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YTAQMLHVWVVPYPGGVFSDDLSAAATNAAVNAVLAEQK* |
| Ga0068871_1010888212 | 3300006358 | Miscanthus Rhizosphere | RYTAQMLHVWVVPYPGGPFSDDLSRAATNAAVRSVLARQ* |
| Ga0075425_1000554881 | 3300006854 | Populus Rhizosphere | DQYTGQMLHVWVVPYPGGPFSDDLSRAATDAAVRAVLSKG* |
| Ga0099794_105549302 | 3300007265 | Vadose Zone Soil | MLHVWVVPYPGGVFSDDLSAAATSTAVEAVLAEHS* |
| Ga0114129_106042461 | 3300009147 | Populus Rhizosphere | QMLHVWVVPYPGGPFSDDLSRAATNAAVQAVLARK* |
| Ga0126374_101340524 | 3300009792 | Tropical Forest Soil | YTAQMLHVWVVSYPGGVFSDDLSSAATNAAVNAVLAEQK* |
| Ga0126373_109686781 | 3300010048 | Tropical Forest Soil | TWRDQYTAQMLHVWVVPYPGGVFSDDLSAAATNAAAHAALAEHG* |
| Ga0126373_129237081 | 3300010048 | Tropical Forest Soil | QMLHVWVVPYPGGVFSDDLSTAATNAAAHAALAEHR* |
| Ga0126370_110980691 | 3300010358 | Tropical Forest Soil | QMLHVWVVPYVGGPFSDDLSRSATNAAVRAVLDHK* |
| Ga0126376_126860132 | 3300010359 | Tropical Forest Soil | SQMLHVWAVPYSGGPFSDDLSLAATNAAARAALAQHQ* |
| Ga0126372_108606742 | 3300010360 | Tropical Forest Soil | YTAQMLHVWVVPYPGGVFSDDLSAAATKAAAHAALAEHG* |
| Ga0126372_123503301 | 3300010360 | Tropical Forest Soil | QMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGK* |
| Ga0126378_100579991 | 3300010361 | Tropical Forest Soil | DTYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVHAALAEHG* |
| Ga0126378_103081501 | 3300010361 | Tropical Forest Soil | NRYTAQMLHVWVVPYPGGPFSDDLSRAATNAAVRAVLSQK* |
| Ga0126377_114496622 | 3300010362 | Tropical Forest Soil | LHVWVVPYPGGVFSDDLSTAATSAAAHAALAEHG* |
| Ga0126379_116642811 | 3300010366 | Tropical Forest Soil | MLHVWVVPYPGGVFSDDLSQAATNSAVQAVLAGK* |
| Ga0126379_131632062 | 3300010366 | Tropical Forest Soil | MLHVWVTPYPGGIFSVDLSAAATHAAVQAALAAHH* |
| Ga0126381_1006028934 | 3300010376 | Tropical Forest Soil | QMLHVWVVPYPGGVFSDDLSQAETNSAVQAVLAGK* |
| Ga0126381_1007177032 | 3300010376 | Tropical Forest Soil | YTSQMLHVWVVPYPGGPFSDDLSRAATNAAARAALAQS* |
| Ga0126381_1015396312 | 3300010376 | Tropical Forest Soil | QMLHVWVVPYPGGVFSDDLSTAATIAAAHAALAEHG* |
| Ga0126381_1021865303 | 3300010376 | Tropical Forest Soil | QMLHVWVVPYPGGVFSDDLSRAATNSAVHAALAGK* |
| Ga0126381_1031154351 | 3300010376 | Tropical Forest Soil | TSQMLHVWVVPYPGGPFSDDLSRAATNAAVRAVLGQK* |
| Ga0126381_1033504621 | 3300010376 | Tropical Forest Soil | PATWRDQYTAQMLHVWVVPYPGGVFSDDLSAAATRAAVRAVLAEQG* |
| Ga0136449_1002595545 | 3300010379 | Peatlands Soil | MLHVWVVPYPGGVFSDDLSAAATSQAVRAVLAGQGAG* |
| Ga0136449_1007247803 | 3300010379 | Peatlands Soil | PATWQDRYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHS* |
| Ga0136449_1043341901 | 3300010379 | Peatlands Soil | MLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAEHR* |
| Ga0126383_124459231 | 3300010398 | Tropical Forest Soil | NRYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAGRS* |
| Ga0124844_12894241 | 3300010868 | Tropical Forest Soil | TWHDQYTAQMLHVWVVHYPGGVFSDDLSAAATNGAVQAVLAAQGP* |
| Ga0137391_102956771 | 3300011270 | Vadose Zone Soil | PATWQDRYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVNAVLAEQK* |
| Ga0137391_112153791 | 3300011270 | Vadose Zone Soil | SQMLHVWVVPYLGGPFSDDLSRAATNAAVRAVLDHK* |
| Ga0137381_114838132 | 3300012207 | Vadose Zone Soil | RDKYTSQMLHVWVVPYLGGPFSDDLSRAATNAAVRAVLDRK* |
| Ga0137386_106917101 | 3300012351 | Vadose Zone Soil | TAQMLHVWVVPYPGGVFSDDLSAAATSAAVRAVLAEHG* |
| Ga0157330_10816791 | 3300012514 | Soil | TTSGQMLHVWVVPYPGGPFSDDLSLAATNAAVRAVLGRK* |
| Ga0137410_118294342 | 3300012944 | Vadose Zone Soil | PQYTGQMLHVWIVPYPGGVFSDDLSQAATNAAVQAVLAEGK* |
| Ga0126375_111316081 | 3300012948 | Tropical Forest Soil | RYTSQMLHVWVVPYPGGPFSDDLSAAATSAAVRAVLGQR* |
| Ga0126369_108488991 | 3300012971 | Tropical Forest Soil | WRDQYTAQMLHVWVVPYPGGVFSDDLSDAATNAAVRAVLAAHG* |
| Ga0126369_117233992 | 3300012971 | Tropical Forest Soil | YTGQMLHVWVVPYPGGVFSDDLSAAATNAAVNAVLAAQR* |
| Ga0182041_108314391 | 3300016294 | Soil | NPATWQDMYTAQMLHVWVVPYPGGVFSDDLSAAATSSAVQAVLAEHH |
| Ga0182032_100343001 | 3300016357 | Soil | QNTYTAQMLHVWVVPYPGGVFSDDLSAAATNAAAHAALAQHQ |
| Ga0182034_100975991 | 3300016371 | Soil | TYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0182040_100614551 | 3300016387 | Soil | TWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0182037_104357062 | 3300016404 | Soil | TWHDTYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0182039_110455312 | 3300016422 | Soil | QMLHVWVVPYTGGPFSDDLSRSATDAAVRAVLSRG |
| Ga0182039_114490673 | 3300016422 | Soil | LHVWVVPYPGGVFSDDLSAAATNSAVQAVLAQQKLLQAL |
| Ga0182038_100136031 | 3300016445 | Soil | TPQMLHVWVVPYPGGVFSDDLSQAATNSAVHAALTGE |
| Ga0187814_100015058 | 3300017932 | Freshwater Sediment | MLHVWVVPYPGGVFSDDLSAAATSAAVHAVLAEHS |
| Ga0187819_101906632 | 3300017943 | Freshwater Sediment | WQDRYTAQMLHVWVVPYPGGVFSDDLSAAATSAAVNAVLAGQR |
| Ga0187776_103140251 | 3300017966 | Tropical Peatland | MTDRHVWVVPYPGGPFSDDLSRAATSAAVQAILGRK |
| Ga0187777_107944671 | 3300017974 | Tropical Peatland | ATWKNQYTSQMLHVWVVPYPGGVFSDDLSLAATSSAAQAALSGT |
| Ga0187773_108823251 | 3300018064 | Tropical Peatland | TSQMLHVWVVPYRGGPFSDDLSLAATNAAARAALAQN |
| Ga0210399_114843292 | 3300020581 | Soil | TWQNRYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAQHS |
| Ga0210401_100191962 | 3300020583 | Soil | MLHVWVVPYPGGVFSDDLSAAATNAAVQAVLTEHS |
| Ga0210408_106624292 | 3300021178 | Soil | NPATWQDRYTAQMLHVWVVPYPGGVFSDDLSAAATSSAVQAVLAQQGK |
| Ga0210393_105912292 | 3300021401 | Soil | DTYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVRAVLAQHS |
| Ga0210385_107334042 | 3300021402 | Soil | QDKYTEQMLHVWVVPYPGGVFSDDLSETATNSAVQAVLAQHR |
| Ga0210389_101525081 | 3300021404 | Soil | PATWQDKYTEQMLHVWVVPYPGGVFSDDLSEAATNSAVQAVLARHT |
| Ga0210389_107083991 | 3300021404 | Soil | YTAQMLHVWVAPYPGGVFSDDLSAAATNSAVQAVLAQHS |
| Ga0210386_107841782 | 3300021406 | Soil | MLHVWVVPYPGGVFSDDLSEAATNSAVQAVLAQHS |
| Ga0210402_110331792 | 3300021478 | Soil | AQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHS |
| Ga0126371_105539932 | 3300021560 | Tropical Forest Soil | SQMLHVWVVPYPGGPFSDDLSRAATNAAARAALAQS |
| Ga0126371_112343542 | 3300021560 | Tropical Forest Soil | GQMLHVWVVPYPGGPFSDDLSRAATDAAVRAVLSKG |
| Ga0126371_130271842 | 3300021560 | Tropical Forest Soil | YTGQMLHVWVVPYPGGPFSDDLSRAATGAAVRAVLNG |
| Ga0213851_10763492 | 3300021860 | Watersheds | WQDRYTAQMLHVWVVPYPGGVFSDDLSAVATNTAVQAVLAEHR |
| Ga0207692_105471512 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DPASWQNRYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVRAVLAQHS |
| Ga0207693_112060331 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVRAVLAQHS |
| Ga0207693_112592592 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAQHS |
| Ga0207687_106824031 | 3300025927 | Miscanthus Rhizosphere | TAQMLHVWVVPYPGGPFSDDLSRAATNAAVRSVLARQ |
| Ga0209268_11953032 | 3300026314 | Soil | SQMLHVWVVPYTGGPFSDDLSRAATNAAVRAVLDHE |
| Ga0209275_105863032 | 3300027884 | Soil | QYTTQMLHVWVVPYPGGVFSDDLSTAATNAAARAALAETKPGHLAP |
| Ga0209275_106971662 | 3300027884 | Soil | TWQDRYTAQMLHVWVVPYPGGVFSDDLSAAATSAAVQAALAGRSS |
| Ga0209698_103465701 | 3300027911 | Watersheds | TQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHG |
| Ga0209526_103752631 | 3300028047 | Forest Soil | TFSGRYTGQMLHVWVIPYPGGPFSDDLSLAATNAAVQSVLGRR |
| Ga0307280_100524871 | 3300028768 | Soil | TPQMLHVWVVPYPGGPFSDDLSLAATNAAVRAVLGRK |
| Ga0170824_1152193492 | 3300031231 | Forest Soil | VRYTTQMLHVWVVPYPGGVFSDDLSATATHAAVQAVLAEHG |
| Ga0170818_1047241082 | 3300031474 | Forest Soil | RYTTQMLHVWVVPYPGGVFSDDLSATATHAAVQAVLAEHG |
| Ga0318534_101129051 | 3300031544 | Soil | QMLHVWVVPYPGGVFSDDLSRAATDSAVQAALAGNT |
| Ga0318534_105100672 | 3300031544 | Soil | YTSQMLHVWVVPYSGGPFSDDLSLAATNAAARAALAHQ |
| Ga0318571_101104852 | 3300031549 | Soil | YTAQMLHVWVTPYPGGVFSDDLSQAATNSAVQSALAGK |
| Ga0318571_101601061 | 3300031549 | Soil | DQYTSQMLHVWVVPYSGGPFSDDLSLAATNAAARAALAHQ |
| Ga0318571_102576402 | 3300031549 | Soil | TQMLHVWVVPYPGGVFSDDLSSSATNAAVNAVLAEQR |
| Ga0318528_105855251 | 3300031561 | Soil | HDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0318573_100167944 | 3300031564 | Soil | HDQYTGQMLHVWVTPYLGGPFSDDLSRAATNAAVRAVLGHQ |
| Ga0318573_104322362 | 3300031564 | Soil | NPATWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATNSAVQAVLAGK |
| Ga0318573_107457742 | 3300031564 | Soil | SCNPATWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0318515_102297611 | 3300031572 | Soil | RYTAQMLHVWVVPYPGGVFSDDLSEAATNSAVQAVLAQHS |
| Ga0318515_104930801 | 3300031572 | Soil | TYTSQMLHVWVVPYPGGVFSDDLSRAATDSAVQAALAGNT |
| Ga0318515_106535871 | 3300031572 | Soil | WHDTYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318555_105745402 | 3300031640 | Soil | DQYTGQMLHVWVVPYLGGPFSDDLSRAATNAAVRAVLLRK |
| Ga0318555_106861882 | 3300031640 | Soil | WHDTYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVRAVLAGK |
| Ga0318574_106267682 | 3300031680 | Soil | WHDTYTSQMLHVWVVPYPGGVFSDDLSQAATNSAVQAVLAGK |
| Ga0318496_103289341 | 3300031713 | Soil | QMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0318496_105802311 | 3300031713 | Soil | TYTTQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHN |
| Ga0306917_105702064 | 3300031719 | Soil | CDPATWQNTYTAQMLHVWVVPYPGGVFSDDLSAAATNAAAHAALAQHQ |
| Ga0307469_112479022 | 3300031720 | Hardwood Forest Soil | YTAQMLHVWVVPYPGGPFSDDLSLAATNAAVRAVLGRK |
| Ga0318493_106876833 | 3300031723 | Soil | CDPATWQNTYTAQMLHVWVVSYPGGVFSDDLSAAATNAAAHAALAQHQ |
| Ga0318500_107102321 | 3300031724 | Soil | TWHDGYTTQMLHVWVVPYPGGVFSDDLSSSATNAAVNAVLAEQR |
| Ga0318502_108990661 | 3300031747 | Soil | TYTAQMLHVWVVPYPGGVFSDDLSTTATNAAARAALAEHG |
| Ga0318492_104035401 | 3300031748 | Soil | CDVYWSCQMLHVWVVPYSGGPFSDDLSLAATNAAARAALAHQ |
| Ga0318537_102934041 | 3300031763 | Soil | PATWHDTYTSQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGK |
| Ga0318554_103732562 | 3300031765 | Soil | QYTSQMLHVWVVPYSGGPFSDDLSLAATNAAARAALAHQ |
| Ga0318509_102461532 | 3300031768 | Soil | YTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318526_103129692 | 3300031769 | Soil | HDTYTSQMLHVWVVPYPGGVFSDDLSQAATNSAVQAVLAGK |
| Ga0318521_101988023 | 3300031770 | Soil | TYTAQMLHVWVVPYPGGVFSDDLSTAATNAAAHAALAEHR |
| Ga0318521_103513931 | 3300031770 | Soil | DGYTAQMLHVWVVPYPGGVFSDDLSAAATSAAVQAALARGN |
| Ga0318521_107247122 | 3300031770 | Soil | TYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVRAVLAGK |
| Ga0318498_100578131 | 3300031778 | Soil | NPATWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0318566_101654572 | 3300031779 | Soil | QMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318547_102854041 | 3300031781 | Soil | DTYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318552_105343092 | 3300031782 | Soil | SCNPATWHDTYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVRAVLAGK |
| Ga0318552_106507333 | 3300031782 | Soil | TYTGQMLHVWVVPYPGGVFSDDLSAAATAAAARAALAQHQ |
| Ga0318552_107213681 | 3300031782 | Soil | ATWQDRYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAGHS |
| Ga0318550_101704361 | 3300031797 | Soil | CNPAAWHDTYTAQMLHVWVVPYPGGVFSDDLSRAATNSAVQAVLAGQ |
| Ga0318565_106316191 | 3300031799 | Soil | HDTYTAQMLHVWVVPYPGGVFSDDLSRAATNSAVQAVLAGH |
| Ga0318568_102859011 | 3300031819 | Soil | SQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGK |
| Ga0318567_102994863 | 3300031821 | Soil | TYTGQMLHVWVVPYPGGVFSDDLSSAATNAAVNAVLAEQR |
| Ga0310917_102168794 | 3300031833 | Soil | YTSQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALAGK |
| Ga0310917_106800571 | 3300031833 | Soil | TAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318527_100489101 | 3300031859 | Soil | TYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318536_102376741 | 3300031893 | Soil | TYTAQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGK |
| Ga0318522_101579101 | 3300031894 | Soil | CNPATWHDTYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAALTGE |
| Ga0318522_102723141 | 3300031894 | Soil | QMLHVWVVPYPGGVFSDDLSAAATNTAAHAALAQHQ |
| Ga0318551_103341401 | 3300031896 | Soil | QYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHS |
| Ga0318551_109580781 | 3300031896 | Soil | DTYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVRAVLAGK |
| Ga0306921_103275322 | 3300031912 | Soil | TGQMLHVWVTPYLGGPFSDDLSRAATNAAVRAVLGHQ |
| Ga0306921_115583041 | 3300031912 | Soil | NPATWQDGYTAQMLHVWVVPYPGGVFSDDLSAAATSAAVQAVLADHG |
| Ga0310910_103945231 | 3300031946 | Soil | RYTAQMLHVWVVPYPGGPFSDDLSAAATSAAVRAVLGQR |
| Ga0310909_101500511 | 3300031947 | Soil | HDTYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0310909_103216101 | 3300031947 | Soil | GSCNPATWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGK |
| Ga0306922_116065071 | 3300032001 | Soil | MYTAQMLHVWVVPYPGGVFSDDLSAAATSSAVQAVLAEHH |
| Ga0318563_103073652 | 3300032009 | Soil | DQYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHS |
| Ga0318563_107794902 | 3300032009 | Soil | HDTYTSQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGT |
| Ga0318569_101670002 | 3300032010 | Soil | ASWHDTYTPQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318507_103440211 | 3300032025 | Soil | QYTGQMMHVWVVPYTGGPFSDDLSRAATDAAVRAVLDHS |
| Ga0318559_102831072 | 3300032039 | Soil | GQMLHVWVVPYLGGPFSDDLSRAATNAAVRAVLDRQ |
| Ga0318559_102974671 | 3300032039 | Soil | YTPQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318559_103848791 | 3300032039 | Soil | NRYTGQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAQQKLLQAL |
| Ga0318559_106074081 | 3300032039 | Soil | MYTAQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAEHH |
| Ga0318549_103097142 | 3300032041 | Soil | TYTAQMLHVWVVPYPGGVFSDDLSRAATNSAVQAVLAGQ |
| Ga0318549_103491931 | 3300032041 | Soil | NPATWHDTYTAQMLHVWVVPYPGGVFSDDLSQAATNSAVHAVLAGK |
| Ga0318558_101749053 | 3300032044 | Soil | AQMLHVWVVPYSGGVFSDDLSAAATNSAVQAVLAEHH |
| Ga0318575_103719631 | 3300032055 | Soil | DTYTSQMLHVWVVPYPGGVFSDDLSQAATNSAVQAVLAGK |
| Ga0318513_106111732 | 3300032065 | Soil | FTDSYTSQMLHVWVVPYPGGPFSDDLSLAATNAAVRAVLAHK |
| Ga0318524_103472491 | 3300032067 | Soil | EQMLHVWVVPYPGGPFSDDLSRAATNAAVRAVLGQK |
| Ga0306924_104930812 | 3300032076 | Soil | GQMLHVWVVPYIGGPFSDDLSRAATNAAVRAVLHQR |
| Ga0318525_102678612 | 3300032089 | Soil | TPQMLHVWVVPYPGGVFSDDLSQAATNSAVRAVLAGK |
| Ga0318525_105897122 | 3300032089 | Soil | YTSQMLHVWVVPYPGGVFSDDLSLAATNAAVQAVLNGK |
| Ga0318518_102797331 | 3300032090 | Soil | DQYTGQMMHVWVVPYTGGPFSDDLSRAATDAAVRAVLDHS |
| Ga0318540_102185614 | 3300032094 | Soil | HDTYTPQMLHVWVVPYPGGVFSDDLSRAATNSAVHAALTGK |
| Ga0311301_102160755 | 3300032160 | Peatlands Soil | MLHVWVVPYPGGVFSDDLSAAATSQAVRAVLAGQGAG |
| Ga0311301_107470511 | 3300032160 | Peatlands Soil | QYTAQMLHVWVVPYPGGVFSDDLSAAATDAAVQAVLAEHNR |
| Ga0307472_1014194061 | 3300032205 | Hardwood Forest Soil | HDRYTAQMLHVWVVPYPGGPFSDDLSRAATNAAVRAVLGRK |
| Ga0306920_1020484852 | 3300032261 | Soil | QDGYTAQMLHVWVVPYPGGVFSDDLSAAATSAAVQAVLADHG |
| Ga0348332_103937641 | 3300032515 | Plant Litter | QDRYTAQMLHVWVVPYPGGVFSDDLSAAATNAAVQAVLAEHS |
| Ga0335085_101868543 | 3300032770 | Soil | MLHVWVVPYPGGVFSDDLSAAATNSAVQSVLAQHS |
| Ga0335078_108264042 | 3300032805 | Soil | MLHVWVVPYPGGVFSDDLSAAATNSAVRAVLAQHS |
| Ga0335080_106384711 | 3300032828 | Soil | WQDRYTPQMLHVWVVPYPGGVFSDDLSRAATDAAVRAALAQHS |
| Ga0335075_101709522 | 3300032896 | Soil | MLHVWVVPYPGGVFSDDLSEAAANSAVQAVLAGHTS |
| Ga0335073_100565671 | 3300033134 | Soil | YTAQMLHVWVVPYPGGVFSDDLSAAATNSAVQAVLAQHS |
| Ga0310914_106821361 | 3300033289 | Soil | NPATWHDTYTSQMLHVWVVPYPGGVFSDDLSQAATDSAVRAVLAGR |
| ⦗Top⦘ |