


| Basic Information | |
|---|---|
| Family ID | F038737 |
| Family Type | Metagenome |
| Number of Sequences | 165 |
| Average Sequence Length | 46 residues |
| Representative Sequence | IEEPVLKSIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.45 % |
| % of genes near scaffold ends (potentially truncated) | 92.12 % |
| % of genes from short scaffolds (< 2000 bps) | 91.52 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.485 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF13414 | TPR_11 | 45.45 |
| PF14559 | TPR_19 | 12.12 |
| PF13432 | TPR_16 | 11.52 |
| PF00515 | TPR_1 | 4.24 |
| PF12895 | ANAPC3 | 3.03 |
| PF01977 | UbiD | 1.82 |
| PF09084 | NMT1 | 1.21 |
| PF00753 | Lactamase_B | 1.21 |
| PF00248 | Aldo_ket_red | 0.61 |
| PF04365 | BrnT_toxin | 0.61 |
| PF14294 | DUF4372 | 0.61 |
| PF04909 | Amidohydro_2 | 0.61 |
| PF00581 | Rhodanese | 0.61 |
| PF13431 | TPR_17 | 0.61 |
| PF07719 | TPR_2 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.82 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.21 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.21 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.36 % |
| Unclassified | root | N/A | 3.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000837|AP72_2010_repI_A100DRAFT_1018936 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300002124|C687J26631_10050190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1457 | Open in IMG/M |
| 3300003999|Ga0055469_10191357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300004114|Ga0062593_102380167 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300004463|Ga0063356_103386066 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300004463|Ga0063356_104774174 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300004480|Ga0062592_102040239 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005093|Ga0062594_100458457 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005167|Ga0066672_10890355 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005205|Ga0068999_10127795 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005295|Ga0065707_10424796 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005331|Ga0070670_101370366 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005332|Ga0066388_103284545 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005339|Ga0070660_100782437 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005343|Ga0070687_100624891 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005444|Ga0070694_101235002 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005446|Ga0066686_10334789 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300005450|Ga0066682_10541466 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005459|Ga0068867_100961588 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005459|Ga0068867_101122280 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005467|Ga0070706_101432527 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005467|Ga0070706_102068665 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005468|Ga0070707_100972805 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005545|Ga0070695_100700104 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005545|Ga0070695_101311299 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005552|Ga0066701_10042078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2458 | Open in IMG/M |
| 3300005559|Ga0066700_10880390 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005615|Ga0070702_101525733 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005617|Ga0068859_100412821 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300005764|Ga0066903_104998673 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005840|Ga0068870_10988831 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005841|Ga0068863_101842140 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005844|Ga0068862_102607879 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005937|Ga0081455_10531676 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300006196|Ga0075422_10418548 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006796|Ga0066665_10538775 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006804|Ga0079221_10101695 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300006806|Ga0079220_11647708 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006845|Ga0075421_100818598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300006846|Ga0075430_100525201 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300006852|Ga0075433_10834756 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006854|Ga0075425_101499982 | Not Available | 761 | Open in IMG/M |
| 3300006876|Ga0079217_10043060 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300006904|Ga0075424_102024856 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006914|Ga0075436_100070253 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300006954|Ga0079219_10900824 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006969|Ga0075419_10321848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300007004|Ga0079218_12333694 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009012|Ga0066710_100460317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1909 | Open in IMG/M |
| 3300009081|Ga0105098_10349369 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009087|Ga0105107_10310545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1098 | Open in IMG/M |
| 3300009088|Ga0099830_10005739 | All Organisms → cellular organisms → Bacteria | 7172 | Open in IMG/M |
| 3300009098|Ga0105245_12861426 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009100|Ga0075418_10811441 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009137|Ga0066709_103938660 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009147|Ga0114129_12274024 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009156|Ga0111538_11390155 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300009157|Ga0105092_10213885 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300009157|Ga0105092_10716298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300009157|Ga0105092_10976370 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009162|Ga0075423_10835926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300009162|Ga0075423_11528123 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009553|Ga0105249_10037580 | All Organisms → cellular organisms → Bacteria | 4394 | Open in IMG/M |
| 3300009553|Ga0105249_13126628 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010029|Ga0105074_1065878 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010036|Ga0126305_10457196 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010037|Ga0126304_10899898 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010043|Ga0126380_11791670 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010043|Ga0126380_11932338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae | 538 | Open in IMG/M |
| 3300010046|Ga0126384_11305274 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010048|Ga0126373_10017491 | All Organisms → cellular organisms → Bacteria | 5984 | Open in IMG/M |
| 3300010373|Ga0134128_10367773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300010400|Ga0134122_10573214 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300011271|Ga0137393_11710461 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300011429|Ga0137455_1246924 | Not Available | 527 | Open in IMG/M |
| 3300012039|Ga0137421_1125117 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012041|Ga0137430_1130895 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012173|Ga0137327_1081969 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012208|Ga0137376_10539275 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300012211|Ga0137377_11078017 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012226|Ga0137447_1110093 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012355|Ga0137369_10286468 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012477|Ga0157336_1001522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 3300012483|Ga0157337_1000945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300012511|Ga0157332_1005502 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012515|Ga0157338_1072102 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012925|Ga0137419_11097439 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012929|Ga0137404_10009623 | All Organisms → cellular organisms → Bacteria | 6653 | Open in IMG/M |
| 3300012944|Ga0137410_11957344 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012971|Ga0126369_11825787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300013307|Ga0157372_10263594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2001 | Open in IMG/M |
| 3300014271|Ga0075326_1119857 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300014296|Ga0075344_1047090 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300014866|Ga0180090_1095466 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014878|Ga0180065_1052218 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300014969|Ga0157376_12724456 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300015077|Ga0173483_10192814 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300015245|Ga0137409_11239422 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300015253|Ga0180081_1078043 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300015371|Ga0132258_11838489 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300015372|Ga0132256_100472823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300015372|Ga0132256_101091942 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300015372|Ga0132256_101981517 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300015373|Ga0132257_101436391 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300018029|Ga0187787_10047505 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300018031|Ga0184634_10093420 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300018063|Ga0184637_10206186 | Not Available | 1205 | Open in IMG/M |
| 3300018074|Ga0184640_10003666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4972 | Open in IMG/M |
| 3300018075|Ga0184632_10017342 | All Organisms → cellular organisms → Bacteria | 3030 | Open in IMG/M |
| 3300018076|Ga0184609_10059244 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300018077|Ga0184633_10412963 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018082|Ga0184639_10063055 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300018422|Ga0190265_12488770 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300018422|Ga0190265_12671048 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300018466|Ga0190268_11769725 | Not Available | 555 | Open in IMG/M |
| 3300018469|Ga0190270_11845042 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018481|Ga0190271_11183472 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300018481|Ga0190271_12080395 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300021073|Ga0210378_10257641 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021073|Ga0210378_10409413 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025155|Ga0209320_10195021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300025537|Ga0210061_1009543 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300025567|Ga0210076_1002616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4377 | Open in IMG/M |
| 3300025910|Ga0207684_11419466 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025910|Ga0207684_11634912 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025917|Ga0207660_10059082 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300025930|Ga0207701_10011949 | All Organisms → cellular organisms → Bacteria | 8502 | Open in IMG/M |
| 3300025931|Ga0207644_10466534 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300025932|Ga0207690_10503993 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025961|Ga0207712_10917181 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025972|Ga0207668_10474448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300026035|Ga0207703_11425749 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026075|Ga0207708_11333955 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026089|Ga0207648_12284386 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026111|Ga0208291_1003042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2843 | Open in IMG/M |
| 3300026121|Ga0207683_11929325 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027682|Ga0209971_1035844 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300027722|Ga0209819_10195981 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027722|Ga0209819_10239924 | Not Available | 629 | Open in IMG/M |
| 3300027725|Ga0209178_1252485 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027862|Ga0209701_10055300 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300027880|Ga0209481_10480504 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027886|Ga0209486_10635970 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300028380|Ga0268265_11613668 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028578|Ga0272482_10128699 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300030620|Ga0302046_10910468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300031184|Ga0307499_10171478 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| (restricted) 3300031237|Ga0255334_1031042 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031538|Ga0310888_10143208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300031744|Ga0306918_10138656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1784 | Open in IMG/M |
| 3300031771|Ga0318546_10800373 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031820|Ga0307473_10797327 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031833|Ga0310917_10517094 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031901|Ga0307406_10190790 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300031908|Ga0310900_11032320 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031910|Ga0306923_12240520 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031941|Ga0310912_10925679 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032002|Ga0307416_103708111 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300032122|Ga0310895_10118324 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300032157|Ga0315912_10575623 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032421|Ga0310812_10423169 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032770|Ga0335085_11033883 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032828|Ga0335080_12101867 | Not Available | 545 | Open in IMG/M |
| 3300033481|Ga0316600_11241775 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300034177|Ga0364932_0150361 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.03% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.21% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.61% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.61% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A100DRAFT_10189361 | 3300000837 | Forest Soil | FKSIIDKIRQESGITAEIPADRLVDLSPLREVRKR* |
| C687J26631_100501901 | 3300002124 | Soil | VLKSIVDKIRQESGITTEIPLDRLVDPSVLREARAELRKR* |
| Ga0055469_101913572 | 3300003999 | Natural And Restored Wetlands | ILKAIVDKIRQESGITAEVPLDRVVDLALLREVQKELLKK* |
| Ga0062593_1023801672 | 3300004114 | Soil | ATLKGIIDKIRQESGLAAEIPSDRLVDLTLLRDVKAELRKK* |
| Ga0063356_1033860661 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KQVVNTDGDIEEPVLKSIVEKIRQETGFAAEVPLDRLVDLSILRELRAELRQR* |
| Ga0063356_1047741742 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IKQVLNADGDIEEPVLKSILDKVRQESGIAAEIPVDRLVDLSMLREARAELRKR* |
| Ga0062592_1020402392 | 3300004480 | Soil | DTLKILRQVVNTDGDIEEAVLKSIVDKVRQESGYAAEISLDRLVDLTVLREVQKELRKK* |
| Ga0062594_1004584573 | 3300005093 | Soil | LKSILNKIRQESGIAAEIPVDRLVDLSMLREARADLRKK* |
| Ga0066672_108903552 | 3300005167 | Soil | YKILKQIVNSDGDIEEPVLRSIVDKLRQESAVTSEIPLDRLVDLSILREVKGELRKR* |
| Ga0068999_101277951 | 3300005205 | Natural And Restored Wetlands | LIAPVLRQIVNVDGDIEEPVLQSIIDKIRQESGVAAEIPLDRLVDLSLLREVKAE |
| Ga0065707_104247962 | 3300005295 | Switchgrass Rhizosphere | VLRAILDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR* |
| Ga0070670_1013703662 | 3300005331 | Switchgrass Rhizosphere | DGDIDDATLKGIIDKIRQESGLGAEIPADRLVDLSLLREVKGELRKK* |
| Ga0066388_1032845453 | 3300005332 | Tropical Forest Soil | VVNSDGDIEDPVLKSIIDKIRQESGIIAEIPADRLIDLSPLREVRKR* |
| Ga0070660_1007824371 | 3300005339 | Corn Rhizosphere | KQIVNTDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK* |
| Ga0070687_1006248911 | 3300005343 | Switchgrass Rhizosphere | KQIVNTDGDIEEPVLKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0070694_1012350022 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DTYRILKQIVNTDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK* |
| Ga0066686_103347893 | 3300005446 | Soil | AVLKSIIDKIRQESGISAEVPADRLVDLSILREVRAELRKR* |
| Ga0066682_105414661 | 3300005450 | Soil | QIVNSDGDIEDAVLKSILDKIKQESGIAGEVPADRLVDLSLLREVRAELRKR* |
| Ga0068867_1009615882 | 3300005459 | Miscanthus Rhizosphere | TDGDIEEPVLKSIVDKIRQESGFAGAIALDRLFDLSVLREVKSELRKK* |
| Ga0068867_1011222801 | 3300005459 | Miscanthus Rhizosphere | LKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0070706_1014325272 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LRQIVNSDGDVEEAVLRSIIEKIRQESSMTTEIPMDRLVDLSILREVKAELKRR* |
| Ga0070706_1020686652 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLKSILDKIKQESGITGEVPADRLVDLSLLREVHAEMRKR* |
| Ga0070707_1009728052 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FKSIIDKIRQESGVSAEVPAERLVDLSILREVGTESKKR* |
| Ga0070695_1007001042 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GDIEEPVLRAILDKLKQESGIAGEITVDRLVDLSLLREVRVELRKR* |
| Ga0070695_1013112992 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DIEEPVLKSIVEKLKQESGITAEIPLDRLVDLSILREVKGKK* |
| Ga0066701_100420786 | 3300005552 | Soil | PVFKSIVDKIRQESGIATEIPADRLIDQSILRESKGELGKG* |
| Ga0066700_108803901 | 3300005559 | Soil | KQVVNSDGDIEEPVFKSIIDKIRQESGVSAEVPAERLIDLSILRELGTESKKR* |
| Ga0070702_1015257331 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSILEKIRQESGFSAEIPVDRVVDLSLLRQVKADLRKK* |
| Ga0068859_1004128211 | 3300005617 | Switchgrass Rhizosphere | KTILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK* |
| Ga0066903_1049986732 | 3300005764 | Tropical Forest Soil | VLKSIIDKVTQESGIGVEIPMNRLPDLTILREVKAELKKK* |
| Ga0068870_109888312 | 3300005840 | Miscanthus Rhizosphere | ILEKLKQEAGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0068863_1018421402 | 3300005841 | Switchgrass Rhizosphere | DGDIEEPVLKTILEKLKQEAGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0068862_1026078791 | 3300005844 | Switchgrass Rhizosphere | VNTDGDIEEPVLKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0081455_105316762 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KSIIDKIRQESGITAEMPADRLVDLSPLREVRKR* |
| Ga0075422_104185481 | 3300006196 | Populus Rhizosphere | PVLKTILEKLKQESGVTAEVPLDRLVDLSLLRDVKAEVGKK* |
| Ga0066665_105387753 | 3300006796 | Soil | ILKQIVNSDGDIEEPVLRSIVDKLRQESAVTSEIPLDRLVDLSILREVKGELRKR* |
| Ga0079221_101016953 | 3300006804 | Agricultural Soil | VLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKGELGKK* |
| Ga0079220_116477081 | 3300006806 | Agricultural Soil | TDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK* |
| Ga0075421_1008185983 | 3300006845 | Populus Rhizosphere | ADSYRQIKQVLNADGDIEEPVLKSILNKIRQESGIAAEISTDRLVDLSMLREARADLRKK |
| Ga0075430_1005252011 | 3300006846 | Populus Rhizosphere | QIKQVLNADGDIEEPVLKSILNKIRQESGIAAEIPMDRLVDLSMLREARADLRKK* |
| Ga0075433_108347561 | 3300006852 | Populus Rhizosphere | LEKLKQESGVTAEVPLDRLVDLSLLRDVKAEVGKK* |
| Ga0075425_1014999822 | 3300006854 | Populus Rhizosphere | YEKIKQESGITGEIPLDRLVDLSLLREAKTELYK* |
| Ga0079217_100430601 | 3300006876 | Agricultural Soil | PILKSILNKIRQEAGIAAEVPVDRLVDLSILREARAELRKR* |
| Ga0075424_1020248562 | 3300006904 | Populus Rhizosphere | RQIVNSDGDIEDGVLKSILDKIKQESGITGEVPADRLVDLSLLREVHAEMRKR* |
| Ga0075436_1000702531 | 3300006914 | Populus Rhizosphere | DIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0079219_109008242 | 3300006954 | Agricultural Soil | IEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK* |
| Ga0075419_103218481 | 3300006969 | Populus Rhizosphere | GDIEESVLKSIVDKIRQESGFAGEIPLDRLFDLSILREVKSELRKK* |
| Ga0079218_123336941 | 3300007004 | Agricultural Soil | GDIEGAVLKSIIDKIKQESGIAAEIPVDRLVDLSILREARAELRNR* |
| Ga0066710_1004603174 | 3300009012 | Grasslands Soil | DTFKILKQVVNSDGDIEEAVLKSIIDKIRQESGISAEVPADRLVDLSILREVRAELRKR |
| Ga0105098_103493692 | 3300009081 | Freshwater Sediment | DKIRQESGITAEVSADRLIDLAVLREVQAELKKK* |
| Ga0105107_103105453 | 3300009087 | Freshwater Sediment | EPVLKSIVDKIRQESGISTEIPLDRLVDLTLLREVKAELRKK* |
| Ga0099830_100057393 | 3300009088 | Vadose Zone Soil | VNSDGDVEEAVLRSIIEKIRQESSMTTEIPMDRLVDLSILREVKGELRKK* |
| Ga0105245_128614261 | 3300009098 | Miscanthus Rhizosphere | YRILKQIVNTDGDIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0075418_108114411 | 3300009100 | Populus Rhizosphere | DGDIEEPVFKSIIDKIRQESGITAEIPADRLVDLSLLREVRKR* |
| Ga0066709_1039386602 | 3300009137 | Grasslands Soil | NSDGDIEEPVFKSIIDKIRQESGITAEIPPERLVDLSLLREVRKR* |
| Ga0114129_122740241 | 3300009147 | Populus Rhizosphere | TTILEKIKQESGVTAEVPLDRLVDLSLLREVKAELGKK* |
| Ga0111538_113901553 | 3300009156 | Populus Rhizosphere | VLKSILNKIRQESGIAAEIPVDRLVDLSMLREARADLRKK* |
| Ga0105092_102138851 | 3300009157 | Freshwater Sediment | VVNSDGDIEDAVFKSIIDKIRQESGITAEIPVDRLVDLSLLREVRKR* |
| Ga0105092_107162981 | 3300009157 | Freshwater Sediment | PVFKSIIDKIRQESGITAEVSADRLIDLAILREVQAELKKK* |
| Ga0105092_109763702 | 3300009157 | Freshwater Sediment | VNTDGDIEEPVLKSIIDKIRQESGYAAEISLDRLVDLTVLREVQKELRKK* |
| Ga0075423_108359261 | 3300009162 | Populus Rhizosphere | PVLRAILDKIKQESGITGEVPVDRLFDLSLLREVRAELRKR* |
| Ga0075423_115281232 | 3300009162 | Populus Rhizosphere | ILKQIVNTGGDIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLRDVKAEVGKK* |
| Ga0105249_100375807 | 3300009553 | Switchgrass Rhizosphere | LKQIVNTDGDIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0105249_131266281 | 3300009553 | Switchgrass Rhizosphere | TILEKIKQESGVTAEVPLDRLVDLSLLREVKAELGKK* |
| Ga0105074_10658781 | 3300010029 | Groundwater Sand | KILKQVVNFDGDIEEPVFRSIVDKIRQESGMTAEIPADRLVDLSLLREARKR* |
| Ga0126305_104571962 | 3300010036 | Serpentine Soil | DSYKILLKVLNSDGDIDDTTLKTIIDKIRQESGLTAEIPSDRLVDLTLLREVKAELRKK* |
| Ga0126304_108998981 | 3300010037 | Serpentine Soil | GDIGDATLKSIIDKIFQESGLTAEIPSDRLVDLTLLREVKAELRKK* |
| Ga0126380_117916701 | 3300010043 | Tropical Forest Soil | SDGDIEDPVLKSIIDKIRQESGITAEISADRLIDLSPLREVRKR* |
| Ga0126380_119323381 | 3300010043 | Tropical Forest Soil | SDGDIEDPVLKSIIDKIRQESGITAEIPADRLTDLSLLREVRKR* |
| Ga0126384_113052742 | 3300010046 | Tropical Forest Soil | VNSDGDIEEPVLKSIIDKVTQESGIGVEIPMNRLPDLTILREVKAELKKK* |
| Ga0126373_100174914 | 3300010048 | Tropical Forest Soil | VLKSIIDKVTQESGIGVEIPMNRLPDLTILREVKAELK |
| Ga0134128_103677731 | 3300010373 | Terrestrial Soil | IEEPVLKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0134122_105732142 | 3300010400 | Terrestrial Soil | VLKTILEKLKQEAGVIAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0137393_117104611 | 3300011271 | Vadose Zone Soil | ILRQIVNSDGDVEEPVLKSIIDKIRLESGIAAEIPMDRLVDLSMLREVKGELRKK* |
| Ga0137455_12469241 | 3300011429 | Soil | VLKSIVDKIRQEAGFAAEIPLDRLFDLSILREVKTELRKR* |
| Ga0137421_11251171 | 3300012039 | Soil | IEEPVLKSIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK* |
| Ga0137430_11308952 | 3300012041 | Soil | LKSIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK* |
| Ga0137327_10819691 | 3300012173 | Soil | YRILRQIVNADGDIEEPVLKAIIDKIRQESGFAAEISLDRLVDLSPLREVKAELRRK* |
| Ga0137376_105392753 | 3300012208 | Vadose Zone Soil | DTYKTLRQIVNSDGDIEDAVLKSILDKIKQESGITGEVPADRLVDLSLLREVRAELRKR* |
| Ga0137377_110780171 | 3300012211 | Vadose Zone Soil | TIDKIRQESGISAEVPADRLVDLSILREVRAELRKR* |
| Ga0137447_11100931 | 3300012226 | Soil | EPVLKSIIDKLRAESGIAAEIPSERLVDLSLLREVKAELKKRAP* |
| Ga0137369_102864682 | 3300012355 | Vadose Zone Soil | VLKSIIDKIKQESGISAEIPLDRLVDLSLLREARAELRKR* |
| Ga0157336_10015223 | 3300012477 | Arabidopsis Rhizosphere | DGDIEEPVLRAILDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR* |
| Ga0157337_10009453 | 3300012483 | Arabidopsis Rhizosphere | QIVNADGDIEEPVLRAILDKLKQEAGIAGEVSVDRLVDLSLLREVRVELRKR* |
| Ga0157332_10055023 | 3300012511 | Soil | DTYKILRQIVNADGDIEEPVLRAILDKLKQESGIAGEVPVDRLVDLSLLRDVRVELRKP* |
| Ga0157338_10721021 | 3300012515 | Arabidopsis Rhizosphere | KQIVNTDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKAEFSRK* |
| Ga0137419_110974392 | 3300012925 | Vadose Zone Soil | IAADTYKILRQIVNSDGDIEDAVLKSILDKIKQESGITGEVPADRLVDLSLLREVHAEMRKR* |
| Ga0137404_100096236 | 3300012929 | Vadose Zone Soil | LKQVVNSDGDIEEAVLKSIIDKIRQESGISAEVPADRLVDLSILREVRAELRKR* |
| Ga0137410_119573441 | 3300012944 | Vadose Zone Soil | DKIKQESGITGEVPADRLVDLSLLREVHAEMRKR* |
| Ga0126369_118257872 | 3300012971 | Tropical Forest Soil | VNSDGDIEEPVLKSIIDKVTQESGIGVEIPMNRLPDLTILREVKAELKKK |
| Ga0157372_102635944 | 3300013307 | Corn Rhizosphere | LEKLKQESGVIAEVPFDRLVDLSLLREVKAEVGKK* |
| Ga0075326_11198571 | 3300014271 | Natural And Restored Wetlands | DAVFKSIIEKIRQESNIAAEVPPERLADLSILHEEKKR* |
| Ga0075344_10470901 | 3300014296 | Natural And Restored Wetlands | NTDGDIEEPVLKSIVDKVRQESGISAEIPLDRLVDLTLLREVKAELRKK* |
| Ga0180090_10954662 | 3300014866 | Soil | MNTGRDHQEPVIKFIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK* |
| Ga0180065_10522181 | 3300014878 | Soil | ADTYRILKQVVNADGDIEDAVFKSIIDKIRQESGIAAEVPAERLVDLSILREVRKR* |
| Ga0157376_127244561 | 3300014969 | Miscanthus Rhizosphere | GDIEEPVLRASLDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR* |
| Ga0173483_101928141 | 3300015077 | Soil | TYRILKQIVNTDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKAEVGKK* |
| Ga0137409_112394221 | 3300015245 | Vadose Zone Soil | KILRQIVNSDGDIEDAVLKSILDKIKQESGITGEVPADRLVDLSLLREVHAEMRKR* |
| Ga0180081_10780431 | 3300015253 | Soil | NPDGDIDDATLKSIIDKIRQESGLTAEIPSDRLVDLSILREVRAELRKR* |
| Ga0132258_118384891 | 3300015371 | Arabidopsis Rhizosphere | ADTFKILRQIVNTDGDIEEPVLKSILEKIRQESGFSAEIPVDRVVDLSLLRQVKADLRKK |
| Ga0132256_1004728233 | 3300015372 | Arabidopsis Rhizosphere | KTILEKIKQESGVTAEVPLDRLVDLSLLREVKAELSKK* |
| Ga0132256_1010919421 | 3300015372 | Arabidopsis Rhizosphere | IEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVTGELGKK* |
| Ga0132256_1019815171 | 3300015372 | Arabidopsis Rhizosphere | ADGDIEEPVLRAILDKLKQESGIAGEVSVDWLVDLSLLREVRVELRKR* |
| Ga0132257_1014363911 | 3300015373 | Arabidopsis Rhizosphere | EEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKAELSKK* |
| Ga0187787_100475053 | 3300018029 | Tropical Peatland | SIVDKIRQETGYAAEIPLDRLVDLSILREVKAELRKKQG |
| Ga0184634_100934201 | 3300018031 | Groundwater Sediment | QIVNADGDIEEPVLKSIIDKIRHELGFAAEIPLDRLVDLSLLREIKAELRRR |
| Ga0184637_102061862 | 3300018063 | Groundwater Sediment | SIVDKIRQEFGIATEIPLDRLVDLSVLREARAELRKR |
| Ga0184640_100036661 | 3300018074 | Groundwater Sediment | IDKIKQESGISAEIPMDRLVDLSLLREVRAEIRKR |
| Ga0184632_100173425 | 3300018075 | Groundwater Sediment | VNSDGDIEEPVFKSIIDKIRQESGITAEVPADRLIDLSLLREVRKR |
| Ga0184609_100592441 | 3300018076 | Groundwater Sediment | ILKQVVNSDGDIEETVLKSIIDKIKQESGITTEIPMDRLVDLSLLREVRAEIRKR |
| Ga0184633_104129631 | 3300018077 | Groundwater Sediment | EESVLKSIIDKIKQESGISAEIPMDRLVDLSLLREVRAEIRKR |
| Ga0184639_100630554 | 3300018082 | Groundwater Sediment | SDGDIEESVLKSIIDKIKQESGISAEIPMDRLVDLSLLREVRAEIRKR |
| Ga0190265_124887701 | 3300018422 | Soil | DGDIEDAVLKSIVDKIRQETGFASEIPMDRLVDLGILREVKAELKKR |
| Ga0190265_126710481 | 3300018422 | Soil | VLNADGDIEEPVLKSILNKIRQESGITAEIPVDRLVDLSILREARAELRSR |
| Ga0190268_117697251 | 3300018466 | Soil | EPVLKSILDKIRQESGYAAEIALDRLVDLTVLREVQKELRKK |
| Ga0190270_118450421 | 3300018469 | Soil | IVDKIRQESGFAGEIPLDRLFDLSLLREVKSELRKK |
| Ga0190271_111834721 | 3300018481 | Soil | KSILNKIRQEAGIAAEVPVDRLVDLSILREARADLRKR |
| Ga0190271_120803952 | 3300018481 | Soil | ADGDLEEPVLKSIIDKLRAESGIAAEIPSERLVDLSVLREVRAELKKRTP |
| Ga0210378_102576411 | 3300021073 | Groundwater Sediment | KSIIDKIKQESGITAEIPMDRLVDLSLLREVRAEIRKR |
| Ga0210378_104094131 | 3300021073 | Groundwater Sediment | LKSIIDKIRQESGISAEVPADRLVDLSILREVRTELRKR |
| Ga0209320_101950211 | 3300025155 | Soil | VLKSIVDKIRQESGITTEIPLDRLVDPSVLREARAELRKR |
| Ga0210061_10095432 | 3300025537 | Natural And Restored Wetlands | QIVNTDGDIEEPILKAIVDKIRQESGITAEVPLDRVVDLALLREVQKELLKK |
| Ga0210076_10026166 | 3300025567 | Natural And Restored Wetlands | IVNTDGDIEEPILKAIVDKIRQESGITAEVPLDRVVDLALLREVQKELLKK |
| Ga0207684_114194661 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRSIIEKIRQESSMTTEIPMDRLVDLSILREVKAELKRR |
| Ga0207684_116349122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLKSILDKIKQESGITGEVPADRLVDLSLLREVHAEMRKR |
| Ga0207660_100590824 | 3300025917 | Corn Rhizosphere | LKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK |
| Ga0207701_1001194910 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KILRQIVNADGDIEEPVLRAILDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR |
| Ga0207644_104665341 | 3300025931 | Switchgrass Rhizosphere | IVNTDGDIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLREVKAEVGKK |
| Ga0207690_105039931 | 3300025932 | Corn Rhizosphere | TILEKIKQESGVTAEVPLDRLVDLSLLREVKTELGKK |
| Ga0207712_109171811 | 3300025961 | Switchgrass Rhizosphere | LKQIVNTDGDIEEPVLKTILEKLKQESGVTAEVPLDRLVDLSLLREVKAEVGKK |
| Ga0207668_104744481 | 3300025972 | Switchgrass Rhizosphere | ADGDIEEPVLRAILDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR |
| Ga0207703_114257492 | 3300026035 | Switchgrass Rhizosphere | RILKQIVNTDGDIEEPVLKTILEKLKQEAGVIAEVPLDRLVDLSLLREVKAEVGKK |
| Ga0207708_113339551 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNADGDIEEPVLKSILNKIRQESGIAAEIPVDRLVDLS |
| Ga0207648_122843862 | 3300026089 | Miscanthus Rhizosphere | TDGDIEEPVLKSILEKIRQESGFSAEIPVDRVVDLSLLRQVKADLRKK |
| Ga0208291_10030424 | 3300026111 | Natural And Restored Wetlands | ADTFKILKQIVNTDGDIEEPILKAIVDKIRQESGITAEVPLDRVVDLALLREVQKELLKK |
| Ga0207683_119293251 | 3300026121 | Miscanthus Rhizosphere | TYRILKQIVNTDGDIEEPVLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKAELSKK |
| Ga0209971_10358441 | 3300027682 | Arabidopsis Thaliana Rhizosphere | TIKILKQVVNTDGDIEEPVLKSIVEKIRQETGFAAEVPLDRLVDLSILRELRAELRQR |
| Ga0209819_101959812 | 3300027722 | Freshwater Sediment | SIIDKIRQESGITAEVPADRLIDLAVLREVQAELKKK |
| Ga0209819_102399242 | 3300027722 | Freshwater Sediment | PVLKSIIDKIRQESGYAAEISLDRLVDLTVLREVQKELRKK |
| Ga0209178_12524852 | 3300027725 | Agricultural Soil | VLKTILEKIKQESGVTAEVPLDRLVDLSLLREVKGELGKK |
| Ga0209701_100553001 | 3300027862 | Vadose Zone Soil | EAVLRSIIEKIRQESSMTTEIPMDRLVDLSILREVKGELRKK |
| Ga0209481_104805041 | 3300027880 | Populus Rhizosphere | GDIEESVLKSIVDKIRQESGFAGEIPLDRLFDLSILREVKSELRKK |
| Ga0209486_106359701 | 3300027886 | Agricultural Soil | QIKQVLNVDGDIEEPVLKSILNKIRQESGIAAEIPVDRLVDLSMLREAKSELRKK |
| Ga0268265_116136682 | 3300028380 | Switchgrass Rhizosphere | VNTDGDIEEPVLKTILEKLKQESGVIAEVPLDRLVDLSLLREVKAEVGKK |
| Ga0272482_101286992 | 3300028578 | Soil | SILNKLRQEAGIAAEIPVDRLVDLSILREARAELRNR |
| Ga0302046_109104681 | 3300030620 | Soil | RIVNTDGDIEEPVLRSIVDKIRQESAVTAEVPLDRVVDLALLREVQKELLKK |
| Ga0307499_101714782 | 3300031184 | Soil | VNADGDIEEPVLRAILDKLKQESGIAGEVPVDRLVDLSLLREVRVELRKR |
| (restricted) Ga0255334_10310422 | 3300031237 | Sandy Soil | DGDIEEPVLKSIIDKIRQESGLAAEVPLDRLVDLSILREVRAELRKW |
| Ga0310888_101432083 | 3300031538 | Soil | DDTTLKTIIDKIRQESGLTAEIPSDRLVDLTLLREVKAELRKK |
| Ga0306918_101386563 | 3300031744 | Soil | ILEKIKQESGVSEEVPLDRLVDLSLLREVKVELSK |
| Ga0318546_108003732 | 3300031771 | Soil | VLRAILEKIKQESGVSEEVPLDRLVDLSLLREVKVELSK |
| Ga0307473_107973271 | 3300031820 | Hardwood Forest Soil | DGDIEEPVLKSIIDIIRQEAGFAAEIALDRLVYLSLVREVKIELRKR |
| Ga0310917_105170942 | 3300031833 | Soil | RQVVNSDGDIEEPVLKSIIDKIRQESGVAAEVPAERLVDLSILREVATEFKKRQP |
| Ga0307406_101907903 | 3300031901 | Rhizosphere | ADGDIEEPVLKSILNKIRQESGIAAEIPVDRLVDLSMLREARADLRKK |
| Ga0310900_110323201 | 3300031908 | Soil | VNADGDIEEPVFKSIIDKIRQESGITAEIPADRLVDLSLLREVRKR |
| Ga0306923_122405202 | 3300031910 | Soil | DKIRQESGVAAEVPAERLVDLSILREVATEFKKRQP |
| Ga0310912_109256792 | 3300031941 | Soil | EPVLRAILEKIKQESGVSEEVPLDRLVDLSLLREVKVELSK |
| Ga0307416_1037081112 | 3300032002 | Rhizosphere | SYRQIKRVLNADGDIEEPVLKSILDKIRQESGIAAEIPVDRLVDLSMLREAKAELRKR |
| Ga0310895_101183242 | 3300032122 | Soil | DGDIEEPVLKSILNKIRQESGIAAEIPVDRLVDLSMLREARADLRKK |
| Ga0315912_105756231 | 3300032157 | Soil | TDGDIEEPVLKSIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK |
| Ga0310812_104231691 | 3300032421 | Soil | NTDGHIEEPVLKTIFEKIKQESEITAEVPMDRLVDLSPLREAQKELRRK |
| Ga0335085_110338831 | 3300032770 | Soil | VLESIVDKIRQETGFAAEIPLDRLVDLSLLREVKAELRKKQG |
| Ga0335080_121018671 | 3300032828 | Soil | LKSIIDKIRQESGVAAEVSAERLVDLSILREVEAELKRR |
| Ga0316600_112417752 | 3300033481 | Soil | TYRILRQVINTDGDIEEPVLKSIVDKIRQESGISAEIPLDRLVDLTLLREVKAELRKK |
| Ga0364932_0150361_762_884 | 3300034177 | Sediment | VLKSIVDKIRQESGITTEIPLDRLVDLSVLREARAELRRR |
| ⦗Top⦘ |