


| Basic Information | |
|---|---|
| Family ID | F038430 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.27 % |
| % of genes near scaffold ends (potentially truncated) | 78.31 % |
| % of genes from short scaffolds (< 2000 bps) | 84.94 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.723 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF07813 | LTXXQ | 6.06 |
| PF02769 | AIRS_C | 3.64 |
| PF04365 | BrnT_toxin | 3.03 |
| PF00589 | Phage_integrase | 3.03 |
| PF14384 | BrnA_antitoxin | 2.42 |
| PF13356 | Arm-DNA-bind_3 | 1.82 |
| PF13395 | HNH_4 | 1.82 |
| PF13432 | TPR_16 | 1.21 |
| PF13589 | HATPase_c_3 | 1.21 |
| PF05014 | Nuc_deoxyrib_tr | 1.21 |
| PF04752 | ChaC | 0.61 |
| PF00072 | Response_reg | 0.61 |
| PF08843 | AbiEii | 0.61 |
| PF04255 | DUF433 | 0.61 |
| PF06911 | Senescence | 0.61 |
| PF04392 | ABC_sub_bind | 0.61 |
| PF06841 | Phage_T4_gp19 | 0.61 |
| PF02384 | N6_Mtase | 0.61 |
| PF04343 | DUF488 | 0.61 |
| PF01609 | DDE_Tnp_1 | 0.61 |
| PF00185 | OTCace | 0.61 |
| PF01471 | PG_binding_1 | 0.61 |
| PF07929 | PRiA4_ORF3 | 0.61 |
| PF00664 | ABC_membrane | 0.61 |
| PF01011 | PQQ | 0.61 |
| PF07510 | DUF1524 | 0.61 |
| PF13763 | DUF4167 | 0.61 |
| PF12161 | HsdM_N | 0.61 |
| PF13505 | OMP_b-brl | 0.61 |
| PF11185 | DUF2971 | 0.61 |
| PF04545 | Sigma70_r4 | 0.61 |
| PF12120 | Arr-ms | 0.61 |
| PF08972 | DUF1902 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 24.24 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 3.03 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 1.21 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.61 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.61 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.61 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.61 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.61 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.61 |
| COG3703 | Gamma-glutamylcyclotransferase ChaC2 (glutathione degradation) | Inorganic ion transport and metabolism [P] | 0.61 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.61 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.30 % |
| Unclassified | root | N/A | 24.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ02JKIQN | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13792683 | Not Available | 828 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1049087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300000956|JGI10216J12902_104486843 | Not Available | 727 | Open in IMG/M |
| 3300000956|JGI10216J12902_111792817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300001867|JGI12627J18819_10080584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1351 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10458263 | Not Available | 515 | Open in IMG/M |
| 3300005179|Ga0066684_10869928 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005332|Ga0066388_100078953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3650 | Open in IMG/M |
| 3300005332|Ga0066388_100183944 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300005332|Ga0066388_107734803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300005332|Ga0066388_107755830 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005439|Ga0070711_101567300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 575 | Open in IMG/M |
| 3300005518|Ga0070699_100023227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5342 | Open in IMG/M |
| 3300005518|Ga0070699_101365817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300005553|Ga0066695_10606333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300005561|Ga0066699_11107598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 546 | Open in IMG/M |
| 3300005713|Ga0066905_100148788 | Not Available | 1683 | Open in IMG/M |
| 3300005713|Ga0066905_101033137 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005764|Ga0066903_100152170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3327 | Open in IMG/M |
| 3300005764|Ga0066903_103000672 | Not Available | 914 | Open in IMG/M |
| 3300005764|Ga0066903_103855194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 805 | Open in IMG/M |
| 3300005764|Ga0066903_104489053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300005764|Ga0066903_108150720 | Not Available | 536 | Open in IMG/M |
| 3300005764|Ga0066903_108582204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300006028|Ga0070717_10207506 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300006163|Ga0070715_10709797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300006797|Ga0066659_10084293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2118 | Open in IMG/M |
| 3300009012|Ga0066710_102617054 | Not Available | 724 | Open in IMG/M |
| 3300009137|Ga0066709_104618666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300009147|Ga0114129_11855033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 732 | Open in IMG/M |
| 3300009553|Ga0105249_12027761 | Not Available | 648 | Open in IMG/M |
| 3300010043|Ga0126380_10026069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2889 | Open in IMG/M |
| 3300010043|Ga0126380_10026069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2889 | Open in IMG/M |
| 3300010043|Ga0126380_10089348 | Not Available | 1813 | Open in IMG/M |
| 3300010043|Ga0126380_10869771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 745 | Open in IMG/M |
| 3300010046|Ga0126384_10075393 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
| 3300010047|Ga0126382_10549080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300010047|Ga0126382_11589849 | Not Available | 606 | Open in IMG/M |
| 3300010048|Ga0126373_10158505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2159 | Open in IMG/M |
| 3300010304|Ga0134088_10510609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300010358|Ga0126370_11885060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_66_14 | 581 | Open in IMG/M |
| 3300010361|Ga0126378_10335618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1619 | Open in IMG/M |
| 3300010362|Ga0126377_10356186 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300010366|Ga0126379_13810926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010398|Ga0126383_10084444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2784 | Open in IMG/M |
| 3300010398|Ga0126383_10695537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
| 3300010398|Ga0126383_12031681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300010398|Ga0126383_13060757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300010863|Ga0124850_1151386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300012189|Ga0137388_10163945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1979 | Open in IMG/M |
| 3300012204|Ga0137374_10909480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300012208|Ga0137376_10740462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300012212|Ga0150985_102580621 | Not Available | 824 | Open in IMG/M |
| 3300012212|Ga0150985_109216495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300012212|Ga0150985_118826693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300012285|Ga0137370_10546923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300012358|Ga0137368_10492073 | Not Available | 791 | Open in IMG/M |
| 3300012359|Ga0137385_11310816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012469|Ga0150984_119361760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
| 3300012961|Ga0164302_10507942 | Not Available | 852 | Open in IMG/M |
| 3300013296|Ga0157374_12204809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 578 | Open in IMG/M |
| 3300013308|Ga0157375_10484764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1401 | Open in IMG/M |
| 3300015372|Ga0132256_101528526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 778 | Open in IMG/M |
| 3300016319|Ga0182033_10223675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1513 | Open in IMG/M |
| 3300016319|Ga0182033_10594855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300016341|Ga0182035_11335559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 642 | Open in IMG/M |
| 3300016371|Ga0182034_10978608 | Not Available | 730 | Open in IMG/M |
| 3300016387|Ga0182040_11201081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300016404|Ga0182037_10387993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1147 | Open in IMG/M |
| 3300016404|Ga0182037_11606890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300016422|Ga0182039_11942139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 541 | Open in IMG/M |
| 3300016445|Ga0182038_11197914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300018469|Ga0190270_11462650 | Not Available | 731 | Open in IMG/M |
| 3300019259|Ga0184646_1611346 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300021372|Ga0213877_10092218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300021404|Ga0210389_10092469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2325 | Open in IMG/M |
| 3300021405|Ga0210387_11316266 | Not Available | 624 | Open in IMG/M |
| 3300021560|Ga0126371_11087520 | Not Available | 939 | Open in IMG/M |
| 3300021560|Ga0126371_11169891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300021560|Ga0126371_13895919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300022756|Ga0222622_10362813 | Not Available | 1012 | Open in IMG/M |
| 3300025900|Ga0207710_10244529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 896 | Open in IMG/M |
| 3300025903|Ga0207680_10277615 | Not Available | 1163 | Open in IMG/M |
| 3300025922|Ga0207646_11630260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300025932|Ga0207690_10548517 | Not Available | 939 | Open in IMG/M |
| 3300025961|Ga0207712_10495416 | Not Available | 1044 | Open in IMG/M |
| 3300026310|Ga0209239_1086508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1347 | Open in IMG/M |
| 3300026551|Ga0209648_10539789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 656 | Open in IMG/M |
| 3300026552|Ga0209577_10626682 | Not Available | 631 | Open in IMG/M |
| 3300026557|Ga0179587_10535266 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300027105|Ga0207944_1025938 | Not Available | 504 | Open in IMG/M |
| 3300028875|Ga0307289_10260410 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300028885|Ga0307304_10284342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 727 | Open in IMG/M |
| 3300028885|Ga0307304_10590249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031094|Ga0308199_1129848 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031544|Ga0318534_10632112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031545|Ga0318541_10403068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300031549|Ga0318571_10166001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. | 771 | Open in IMG/M |
| 3300031561|Ga0318528_10087918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1618 | Open in IMG/M |
| 3300031561|Ga0318528_10154897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1221 | Open in IMG/M |
| 3300031561|Ga0318528_10356493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031564|Ga0318573_10146573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300031573|Ga0310915_10732170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300031679|Ga0318561_10459966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300031681|Ga0318572_10738443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300031719|Ga0306917_10870740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
| 3300031744|Ga0306918_10793572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300031763|Ga0318537_10119126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300031768|Ga0318509_10093713 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300031770|Ga0318521_10317332 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300031771|Ga0318546_10353760 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300031780|Ga0318508_1012094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1967 | Open in IMG/M |
| 3300031797|Ga0318550_10288831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300031819|Ga0318568_10867244 | Not Available | 559 | Open in IMG/M |
| 3300031821|Ga0318567_10562331 | Not Available | 648 | Open in IMG/M |
| 3300031832|Ga0318499_10044116 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300031832|Ga0318499_10075843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1283 | Open in IMG/M |
| 3300031879|Ga0306919_10503456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 933 | Open in IMG/M |
| 3300031890|Ga0306925_10457318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1363 | Open in IMG/M |
| 3300031890|Ga0306925_11532519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 651 | Open in IMG/M |
| 3300031897|Ga0318520_10102708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1606 | Open in IMG/M |
| 3300031910|Ga0306923_10339652 | Not Available | 1713 | Open in IMG/M |
| 3300031910|Ga0306923_10958341 | Not Available | 933 | Open in IMG/M |
| 3300031912|Ga0306921_10197844 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
| 3300031941|Ga0310912_10339119 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031941|Ga0310912_10791801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 732 | Open in IMG/M |
| 3300031942|Ga0310916_10143173 | Not Available | 1966 | Open in IMG/M |
| 3300031942|Ga0310916_10407213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1158 | Open in IMG/M |
| 3300031942|Ga0310916_10933593 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031945|Ga0310913_10006338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6836 | Open in IMG/M |
| 3300031946|Ga0310910_11218268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031947|Ga0310909_10713547 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031954|Ga0306926_10527817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1448 | Open in IMG/M |
| 3300031954|Ga0306926_12887708 | Not Available | 516 | Open in IMG/M |
| 3300031962|Ga0307479_12047107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNHC229A00 | 521 | Open in IMG/M |
| 3300031981|Ga0318531_10546668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300032010|Ga0318569_10298716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. | 749 | Open in IMG/M |
| 3300032010|Ga0318569_10624074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032035|Ga0310911_10052890 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300032035|Ga0310911_10111483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1510 | Open in IMG/M |
| 3300032035|Ga0310911_10581119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 650 | Open in IMG/M |
| 3300032043|Ga0318556_10043292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. | 2151 | Open in IMG/M |
| 3300032043|Ga0318556_10690747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300032044|Ga0318558_10246468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300032059|Ga0318533_10976194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300032060|Ga0318505_10199033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 937 | Open in IMG/M |
| 3300032067|Ga0318524_10332816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300032076|Ga0306924_11461776 | Not Available | 726 | Open in IMG/M |
| 3300032076|Ga0306924_12586772 | Not Available | 507 | Open in IMG/M |
| 3300032090|Ga0318518_10205613 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032094|Ga0318540_10117700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300032261|Ga0306920_100676545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1522 | Open in IMG/M |
| 3300033289|Ga0310914_10094750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2557 | Open in IMG/M |
| 3300033289|Ga0310914_10421989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300033289|Ga0310914_11016510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300033290|Ga0318519_10638368 | Not Available | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_11284720 | 2170459024 | Grass Soil | TMRKRLAAVRAATAAIRPALMRFYEALDRGQKVRFAGMS |
| ICChiseqgaiiFebDRAFT_137926831 | 3300000363 | Soil | PVGRMETRRKRLAAVRAATTSIRPALMHFYEALDEGQKVRFAGMS* |
| AP72_2010_repI_A100DRAFT_10490871 | 3300000837 | Forest Soil | KRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| JGI10216J12902_1044868432 | 3300000956 | Soil | MRKRLVAVRAATAAIRPTLMHFYEALDQGQKVRFAGMS* |
| JGI10216J12902_1117928171 | 3300000956 | Soil | METMRKRLAAVRAATATIRPALARFYEALDQGQKVRFAGMS* |
| JGI12627J18819_100805844 | 3300001867 | Forest Soil | LAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| JGIcombinedJ51221_104582631 | 3300003505 | Forest Soil | ARMALMRARLLAVRQATAAISPALTQFYEALDQGQKVYFAGMR* |
| Ga0066684_108699281 | 3300005179 | Soil | LTPVGRMATLRARLAAVRAATAAIRPALSRFYELLDQGQKVRFAGMS* |
| Ga0066388_1000789533 | 3300005332 | Tropical Forest Soil | TPVGRMDAMRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS* |
| Ga0066388_1001839441 | 3300005332 | Tropical Forest Soil | GRMDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0066388_1077348031 | 3300005332 | Tropical Forest Soil | PVGRMDAMRKRLAAVRAATAAIRPALVHFYEVLDQGQKVRFAGMS* |
| Ga0066388_1077558302 | 3300005332 | Tropical Forest Soil | AMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0070711_1015673001 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MALMRARLLAVRQATAAISPALTQFYEALDQGQKVYFAGMR* |
| Ga0070699_1000232277 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | METMRKRLSAVRAATAAIRPALMRFYEALDQGQKVRFAGMS* |
| Ga0070699_1013658171 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAMRKRLAAVRAATAAIRAPLARFYEALDQGQQVRFAGMS* |
| Ga0066695_106063332 | 3300005553 | Soil | METMRKRLAAVRAAIAAIRPALMHFYEALDQGQKMRFAGI* |
| Ga0066699_111075981 | 3300005561 | Soil | GRMQAMRQRLTAVRAATAAIRPALTRFYDALDQGQQQRFAGMS* |
| Ga0066905_1001487881 | 3300005713 | Tropical Forest Soil | MRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0066905_1010331371 | 3300005713 | Tropical Forest Soil | VGRMDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0066903_1001521701 | 3300005764 | Tropical Forest Soil | RKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0066903_1030006722 | 3300005764 | Tropical Forest Soil | MATLRARLAAVRAATAAIRPALARFYDSLDQGQKVRFAGMN* |
| Ga0066903_1033644792 | 3300005764 | Tropical Forest Soil | METLRARLGAARAATAAIRPAFAHFFDSLDQAQQVRFAPMN* |
| Ga0066903_1038551942 | 3300005764 | Tropical Forest Soil | LAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0066903_1044890531 | 3300005764 | Tropical Forest Soil | RARLAAVRQATVAIRPALTQFYETLDQVQKVQFAEMR* |
| Ga0066903_1081507201 | 3300005764 | Tropical Forest Soil | TLRARLAAVRAATAAIRPALARFYESLDQGQKVRFADMS* |
| Ga0066903_1085822041 | 3300005764 | Tropical Forest Soil | VGRMETMRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAAMS* |
| Ga0070717_102075064 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RQRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| Ga0070715_107097972 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MALMRARLLAVRQATTAISPALTQFYEALDQGQKVYFAGMR* |
| Ga0066659_100842932 | 3300006797 | Soil | METMRKRLAAVRAAIAAIRPALMHFYEALDQGQKVRFAGI* |
| Ga0066710_1026170541 | 3300009012 | Grasslands Soil | METMRKRLSAVRAATAAIRPALMRFYEALDQGQKVRFA |
| Ga0066709_1046186661 | 3300009137 | Grasslands Soil | LSAVRAATAAIRAPLARFYEALDQGQKVRFAGMS* |
| Ga0114129_118550333 | 3300009147 | Populus Rhizosphere | SLRARLAAVRAATAAIRPALTRFYEALDQGQKVRFAGMS* |
| Ga0105249_120277611 | 3300009553 | Switchgrass Rhizosphere | RARLLAVRQATTAIHPALTQFYEALDQGQKVRFAAMR* |
| Ga0126374_119032511 | 3300009792 | Tropical Forest Soil | PAETALTPVGRMATLRTRLEAARAATAAIRPVFTHFFDSLDQAQQARFAPMN* |
| Ga0126380_100260691 | 3300010043 | Tropical Forest Soil | LAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS* |
| Ga0126380_100260693 | 3300010043 | Tropical Forest Soil | MCKRLVAVRAATAAIRPTLMHFHEALDQGQKVRFAGMS* |
| Ga0126380_100893481 | 3300010043 | Tropical Forest Soil | PVGRMDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0126380_108697712 | 3300010043 | Tropical Forest Soil | RKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS* |
| Ga0126384_100753931 | 3300010046 | Tropical Forest Soil | PVGRMDAMRKRLSAVRAATAAIRPALVRFYEALDQGQKVRFAGMS* |
| Ga0126382_105490801 | 3300010047 | Tropical Forest Soil | KRLAAVRSATAAIRPALMHFYEALDQGQKVRFAGMS* |
| Ga0126382_115898491 | 3300010047 | Tropical Forest Soil | RARLAAVREATDATYPALTRFYDVLDQGQRVAFAEMR* |
| Ga0126373_101585051 | 3300010048 | Tropical Forest Soil | MDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0134088_105106092 | 3300010304 | Grasslands Soil | METMRKRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| Ga0126370_118850602 | 3300010358 | Tropical Forest Soil | DAMRKRLVAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| Ga0126378_103356182 | 3300010361 | Tropical Forest Soil | ETALTPVGRMATLRARLAAVRAATAAIRPALERFYESLDQGQKVRFAGMS* |
| Ga0126377_103561861 | 3300010362 | Tropical Forest Soil | LAAVRAATAAIRPALMHFYEALDQGQKMRFAGMS* |
| Ga0126379_120217512 | 3300010366 | Tropical Forest Soil | GRMETLRARLGAARAATAAIRPAFAHFFDSLDQAQQVRFAPMN* |
| Ga0126379_138109262 | 3300010366 | Tropical Forest Soil | GRMASLRARLAAVRAAAAAIRPALARFYEALDQGQKVRFAGMS* |
| Ga0126381_1001655156 | 3300010376 | Tropical Forest Soil | LTPVGRMETLRARLGAARAATAAIRPEFEHFFDSLDQVQQVQFAPMN* |
| Ga0126383_100844445 | 3300010398 | Tropical Forest Soil | AMRKRLTAVRAATAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0126383_106955371 | 3300010398 | Tropical Forest Soil | MEAMRKRLTAVRAATAAIRPALTHFYEALDQGQKVR |
| Ga0126383_120316811 | 3300010398 | Tropical Forest Soil | MRQRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| Ga0126383_130607571 | 3300010398 | Tropical Forest Soil | PVGRMDAMRKRLSAVRAATAAIRPALVHFYEALDQGQKVRFAGMS* |
| Ga0124850_11513861 | 3300010863 | Tropical Forest Soil | MDAMRKRLAAVRAAAAAIRPALTHFYEALDQGQKVRFAGMS* |
| Ga0137388_101639451 | 3300012189 | Vadose Zone Soil | MDAMRQRLAAVRAATAAIRPALVHFYEGLDQGQKVRFAGMS* |
| Ga0137374_109094801 | 3300012204 | Vadose Zone Soil | VPSGFWRVSDLDRMETMRKRLSAVCGVTGAIRPALARFYEALDQGQKVRFAGMS* |
| Ga0137376_107404622 | 3300012208 | Vadose Zone Soil | MPFGQRKGRMELMRKRLAAVRAATAAIRPALARFYEALDQGQKVRFAGMS* |
| Ga0150985_1025806211 | 3300012212 | Avena Fatua Rhizosphere | MKMMLARLAAVRQATATIRPAFAHFYEALDRVQKVRFAGMR* |
| Ga0150985_1092164951 | 3300012212 | Avena Fatua Rhizosphere | TRLAAVRAATAAILPALARFYEALDQEQKVRFSGMS* |
| Ga0150985_1188266933 | 3300012212 | Avena Fatua Rhizosphere | PARRMDLLRQRLAAVREATVAVRPTLLRFFGALDQQQKVRFAGLS* |
| Ga0137370_105469231 | 3300012285 | Vadose Zone Soil | RMETMRKRLTAVRAATAAIRPALARFYEALDQGQKVRFAGI* |
| Ga0137368_104920731 | 3300012358 | Vadose Zone Soil | METMRKRLVAVRAATAAIRPALMCFYEALSIRGRR* |
| Ga0137385_113108162 | 3300012359 | Vadose Zone Soil | METMRKRLAAVREASVAIRPALVRFYEALDQGQKVRFAGMS* |
| Ga0150984_1193617601 | 3300012469 | Avena Fatua Rhizosphere | GRLTQMRARLLAVRQATTSIHPALTQFYEALDQGQKVRFAAMR* |
| Ga0164302_105079422 | 3300012961 | Soil | RQRLSAVRAATAAIRPALLHFYEVLDQGQQQRFAGMS* |
| Ga0126369_128036792 | 3300012971 | Tropical Forest Soil | LTPVGRMETLRARLGAARAATAAIRPAFAHFFDSLDQAQQVRFAPMN* |
| Ga0157374_122048091 | 3300013296 | Miscanthus Rhizosphere | LLAVRQATVAIRPALEQFYESLDQGQKVYFAAMR* |
| Ga0157375_104847644 | 3300013308 | Miscanthus Rhizosphere | ALLRTQLLAVRQATVAIRPALEQFYESLDQGQKVYFAAMR* |
| Ga0132256_1015285262 | 3300015372 | Arabidopsis Rhizosphere | METMRKRLAAVRAATAAIRPALARFYEALDQEQKVRFAGMS* |
| Ga0182033_102236751 | 3300016319 | Soil | MALLRARLAAVRQATAAIRPALTQFYEALDQGQKVQFAAMR |
| Ga0182033_105948552 | 3300016319 | Soil | RMDAMRKRLAAVRAATAAIRPALAHFYEALDQGQKVRFAGMS |
| Ga0182035_113355593 | 3300016341 | Soil | RARLAAVRQATVAIRPALTQFYEALDQGQKVQFAEMR |
| Ga0182034_109786083 | 3300016371 | Soil | RLAAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0182040_112010811 | 3300016387 | Soil | AMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0182037_103879931 | 3300016404 | Soil | LLRARLAAVRQATVAIRPALTQFYEALDQGQKVQFAEMR |
| Ga0182037_116068902 | 3300016404 | Soil | MATLRARLAAVRAATAAIRPALARFYESLDQGQKVRFAGMR |
| Ga0182039_119421391 | 3300016422 | Soil | RLTAVRQAAAAIRPALTQFYEALDQGQKAQFDAMR |
| Ga0182038_111979141 | 3300016445 | Soil | LRARLAAVRAATAAIRPALARFYESLDQGQKVRFAGMR |
| Ga0190270_114626501 | 3300018469 | Soil | LGRLTQMRARLLAVRQATTAIHPALTQFYEALDQGQKVRFAAMR |
| Ga0184646_16113462 | 3300019259 | Groundwater Sediment | PTRRLEVLRQRLAAVRQATVAIRPALLRFFGALDQQQKVRFAGLS |
| Ga0213877_100922183 | 3300021372 | Bulk Soil | MDAMRKRLAAVRAATAAIRPALTHFYEALDQEQKVRFAGMS |
| Ga0210389_100924691 | 3300021404 | Soil | MALLRARLLAVRQATVAIRPALAQFYESLDQGQKVYFAAMR |
| Ga0210387_113162661 | 3300021405 | Soil | PPARMALLRARLLAVRQATAAIHPALTQFYEALDQRQKFYFAGMR |
| Ga0126371_110875201 | 3300021560 | Tropical Forest Soil | TPVGRMDAMRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0126371_111698911 | 3300021560 | Tropical Forest Soil | MRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0126371_138959192 | 3300021560 | Tropical Forest Soil | DAMRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0222622_103628131 | 3300022756 | Groundwater Sediment | RQRLAAVRQATVAIRPALLRFFGALDQQQKVRFAGLS |
| Ga0207710_102445292 | 3300025900 | Switchgrass Rhizosphere | MALLRTQLLAVRQATVAIRPALEQFYESLDQGQKVYFAAMR |
| Ga0207680_102776153 | 3300025903 | Switchgrass Rhizosphere | LTQMRARLLAVRQATTAIHPALTQFYEALDQGQKVRFAAMR |
| Ga0207646_116302602 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RQRLAAVRAATAAIRPALVHFFEALDQGQKVRFAGMS |
| Ga0207690_105485171 | 3300025932 | Corn Rhizosphere | ALTPGRRIEILRQRLAAVREATAAIRPALLRFLGTLDQQQQVRFAGLS |
| Ga0207689_101121571 | 3300025942 | Miscanthus Rhizosphere | MSASGGAGCPETALTPVGRMETMRKRLAAVRAATAAIRPALVRFYEALDQGQ |
| Ga0207712_104954161 | 3300025961 | Switchgrass Rhizosphere | FRRIELLRQRLAAIRDATLAIRPALLRFLGSLDHQQKVRFAGLN |
| Ga0209239_10865082 | 3300026310 | Grasslands Soil | METMRKRLAAVRAAIAAIRPALMHFYEALDQGQKVRFAGI |
| Ga0209648_105397891 | 3300026551 | Grasslands Soil | MRQRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0209577_106266821 | 3300026552 | Soil | RARLAAVRAATAAIRPALSRFYELLDQGQKVRFAGMS |
| Ga0179587_105352663 | 3300026557 | Vadose Zone Soil | PTRRLEVLRQRLAAVRLATVAIRPALLRFFGALDQLQKVRFAGLS |
| Ga0207944_10259381 | 3300027105 | Forest Soil | MALMRARLLAVRQATAAISPALTQFYEALDQGQKVYFAGMR |
| Ga0307289_102604102 | 3300028875 | Soil | MDTMRKRLAAVREATVAIRPSLVRFYDVLDNGQKSRFAAMI |
| Ga0307304_102843423 | 3300028885 | Soil | PGGRMATLRSRLAAVRAATAAIHPTLTRFYEALDQGQKMRFAAMR |
| Ga0307304_105902492 | 3300028885 | Soil | LQARLSAVRAATAAIQPALTRFYEALDQGQKVRFAGMR |
| Ga0308199_11298483 | 3300031094 | Soil | EVLRQRLAAVRQATVAIRPALLRFFGALDQQQKVRFAGLS |
| Ga0318534_106321122 | 3300031544 | Soil | RLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0318541_104030682 | 3300031545 | Soil | ARMATLRARLAAVRAATAAIRPALARFYESLDQGQKVRFAGMR |
| Ga0318571_101660012 | 3300031549 | Soil | PVGRMDAMRKRLTSVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318528_100879182 | 3300031561 | Soil | MDAMRKRLTSVRAATAAIRPALTRFYEALDQGQKVRFAGMS |
| Ga0318528_101548972 | 3300031561 | Soil | MRQRLSAVRAATAAIRPALAHFYEALDQGQKLRFAGMS |
| Ga0318528_103564931 | 3300031561 | Soil | RKRLAAVRAATATIRPALMHFYEVLDQGQKVRFAGMS |
| Ga0318573_101465734 | 3300031564 | Soil | RLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318573_102592291 | 3300031564 | Soil | PAETALTPPGRITQTRARLAAVRQAITAIWPAFTEFYEALDHGQKVRFAGMR |
| Ga0310915_107321704 | 3300031573 | Soil | QRLSAVRAATAAIRPALAHFYEALDQGQKLRFAGMS |
| Ga0318561_104599661 | 3300031679 | Soil | TRLAAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0318572_107384431 | 3300031681 | Soil | LRTRLAAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0318560_105258551 | 3300031682 | Soil | LDALAGGCLAETALTPPARMALLRARAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0306917_108707403 | 3300031719 | Soil | RARLAAVRQATAAIRPALTQFYEALDQGQKVQFAAMR |
| Ga0306918_107935723 | 3300031744 | Soil | RLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0318537_101191263 | 3300031763 | Soil | PVGRMDAMRKRLVAVRAATAAIRPALVHFYEALDQGQEVRFAGMS |
| Ga0318509_100937131 | 3300031768 | Soil | DAMRKRLSAARAAIAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0318521_103173321 | 3300031770 | Soil | GLGRMDAMRKRLSAARAAIAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0318546_103537601 | 3300031771 | Soil | KRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318508_10120946 | 3300031780 | Soil | VRKRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0318550_102888312 | 3300031797 | Soil | DAMRQRLAAMRAATAAIRPALVHFYEALDQGQKARFAGMS |
| Ga0318568_108672442 | 3300031819 | Soil | ARMALLRTRLAAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0318567_105623311 | 3300031821 | Soil | AGLRARLAAVRAATDAIRPALTRFYEVLDQGQKVRFAEMS |
| Ga0318499_100441163 | 3300031832 | Soil | PVGRMDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0318499_100758431 | 3300031832 | Soil | AMRQRLSAVRAATAAIRPALAHFYEALDQGQKLRFAGMS |
| Ga0306919_105034561 | 3300031879 | Soil | RARLAAVRAATAAIRPALARFYESLDQGQKVRFAGMR |
| Ga0306925_104573181 | 3300031890 | Soil | RKRLTSVRAATAAIRPALTRFYEALDQGQKVRFAGMS |
| Ga0306925_115325192 | 3300031890 | Soil | MDAMRKRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0318520_101027081 | 3300031897 | Soil | MRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0306923_103396523 | 3300031910 | Soil | MALLRARAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0306923_109583413 | 3300031910 | Soil | LRARLAAVRQATAAIRPALTQFYEALDQGQKVQFAAMR |
| Ga0306921_101978446 | 3300031912 | Soil | AMRKRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0310912_103391191 | 3300031941 | Soil | RKRLAAVRAATAAIRPALAHFYEALDQGQKVRFAGMS |
| Ga0310912_107918012 | 3300031941 | Soil | TLRARLAAVRAATAAIRAALARFYESLDQGQKVRFAGMR |
| Ga0310916_101431732 | 3300031942 | Soil | DAMRKRLVAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0310916_104072131 | 3300031942 | Soil | ARLAAVRAATAAIRAALARFYESLDQGQKVRFAGMR |
| Ga0310916_109335931 | 3300031942 | Soil | DAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0310913_100063387 | 3300031945 | Soil | TPVGRMDAMRKRLTSVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0310910_112182681 | 3300031946 | Soil | VGRMETMRKRLAAVRAATATIRPALMHFYEVLDQGQKVRFAGMS |
| Ga0310909_107135472 | 3300031947 | Soil | MRKRLSAARAAIAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0306926_105278171 | 3300031954 | Soil | LRARAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0306926_128877081 | 3300031954 | Soil | ARMATLRARLAAVRAATAAIRAALARFYESLDQGQKVRFAGMR |
| Ga0307479_120471072 | 3300031962 | Hardwood Forest Soil | QRLAAVRAATAAIRPALVHFYEALDQGQKVRFAGMS |
| Ga0318531_105466682 | 3300031981 | Soil | METMRKRLAAVRAATATIRPALMHFYEVLDQGQKVRFAGMS |
| Ga0306922_109240372 | 3300032001 | Soil | AETALTPPARMAQLRARLVAVRQATAAIRPALTQFYEELDQGQKVQFAAMR |
| Ga0318569_102987161 | 3300032010 | Soil | RKRLTSVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318569_106240741 | 3300032010 | Soil | PVARMATLRARLAAVRAATAAIRPALARFYESLDQGQKVRFAGMS |
| Ga0310911_100528901 | 3300032035 | Soil | MDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0310911_101114831 | 3300032035 | Soil | RMDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAGMS |
| Ga0310911_105811191 | 3300032035 | Soil | VGRMDAMRKRLAAVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318556_100432921 | 3300032043 | Soil | AMRKRLAAVRAATAAIRPALAQFYEALDQGQKVRFAGMS |
| Ga0318556_106907471 | 3300032043 | Soil | RLAAVKAATAAIRPALARFYQTLDQGQKVRFAGMS |
| Ga0318558_102464681 | 3300032044 | Soil | VGRMEAMRQRLSAVRAATAAIRPALAHFYEALDQGQKLRFAGMS |
| Ga0318533_109761942 | 3300032059 | Soil | LLRTRLAAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| Ga0318505_101990332 | 3300032060 | Soil | RLDAWRKRLAAVRAATAAIRPALAHFYEALDQGQKVRFAGMS |
| Ga0318524_103328162 | 3300032067 | Soil | MDAMRKRLTSVRAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0306924_114617761 | 3300032076 | Soil | LRARLAAVRAATAAIRAALARFYESLDQGQKVRFAGMR |
| Ga0306924_125867721 | 3300032076 | Soil | RARLAAVRQAITAIWPAFTEFYEALDHGQKVRFAGMR |
| Ga0318518_102056131 | 3300032090 | Soil | MRKRLAAVCAATAAIRPALMHFYEALDQGQKVRFAGMS |
| Ga0318540_101177004 | 3300032094 | Soil | MDAMRKRLVAVRAATAAIRPALVHFYEALDQGQEVRFAGMS |
| Ga0306920_1006765453 | 3300032261 | Soil | RMALLRARLAAVRQATAAIRPALTQFYEALDQEQKVQFAAMR |
| Ga0310914_100947501 | 3300033289 | Soil | RLAAVRQATAAIRPALTQFYEALDQGQKVQFAAMR |
| Ga0310914_104219893 | 3300033289 | Soil | MRKRLAAVRAATATIRPALMHFYEVLDQGQKVRFAGMS |
| Ga0310914_110165102 | 3300033289 | Soil | MDAMRKRLAAVRAATAAIRPALTHFYEALDQGQKVRFAG |
| Ga0318519_106383681 | 3300033290 | Soil | ALLRARAVRQATAAIRPALTQFYEALDQGQKVQFAGMR |
| ⦗Top⦘ |