


| Basic Information | |
|---|---|
| Family ID | F038320 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.06 % |
| % of genes near scaffold ends (potentially truncated) | 92.77 % |
| % of genes from short scaffolds (< 2000 bps) | 87.95 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.373 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.663 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.904 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.386 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 19.12% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF11794 | HpaB_N | 22.29 |
| PF05726 | Pirin_C | 10.24 |
| PF01613 | Flavin_Reduct | 9.64 |
| PF01315 | Ald_Xan_dh_C | 4.82 |
| PF02738 | MoCoBD_1 | 3.61 |
| PF02668 | TauD | 2.41 |
| PF12697 | Abhydrolase_6 | 2.41 |
| PF04392 | ABC_sub_bind | 1.81 |
| PF04075 | F420H2_quin_red | 1.81 |
| PF00903 | Glyoxalase | 1.81 |
| PF00528 | BPD_transp_1 | 1.81 |
| PF00248 | Aldo_ket_red | 1.81 |
| PF03928 | HbpS-like | 1.81 |
| PF00496 | SBP_bac_5 | 1.20 |
| PF05977 | MFS_3 | 1.20 |
| PF01738 | DLH | 1.20 |
| PF00561 | Abhydrolase_1 | 1.20 |
| PF00296 | Bac_luciferase | 1.20 |
| PF07885 | Ion_trans_2 | 1.20 |
| PF04307 | YdjM | 0.60 |
| PF00582 | Usp | 0.60 |
| PF13561 | adh_short_C2 | 0.60 |
| PF12399 | BCA_ABC_TP_C | 0.60 |
| PF01636 | APH | 0.60 |
| PF01627 | Hpt | 0.60 |
| PF01243 | Putative_PNPOx | 0.60 |
| PF00135 | COesterase | 0.60 |
| PF01717 | Meth_synt_2 | 0.60 |
| PF00939 | Na_sulph_symp | 0.60 |
| PF00871 | Acetate_kinase | 0.60 |
| PF04909 | Amidohydro_2 | 0.60 |
| PF00691 | OmpA | 0.60 |
| PF00753 | Lactamase_B | 0.60 |
| PF08241 | Methyltransf_11 | 0.60 |
| PF08240 | ADH_N | 0.60 |
| PF04314 | PCuAC | 0.60 |
| PF04185 | Phosphoesterase | 0.60 |
| PF02958 | EcKL | 0.60 |
| PF08334 | T2SSG | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 10.24 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 9.64 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.41 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.20 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.20 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.60 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.60 |
| COG0510 | Thiamine kinase or a related kinase | Coenzyme transport and metabolism [H] | 0.60 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.60 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.60 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.60 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.60 |
| COG2334 | Ser/Thr protein kinase RdoA involved in Cpx stress response, MazF antagonist | Signal transduction mechanisms [T] | 0.60 |
| COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 0.60 |
| COG3173 | Predicted kinase, aminoglycoside phosphotransferase (APT) family | General function prediction only [R] | 0.60 |
| COG3178 | Predicted phosphotransferase, aminoglycoside/choline kinase (APH/ChoK) family | General function prediction only [R] | 0.60 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.60 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.37 % |
| Unclassified | root | N/A | 6.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10133485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1551 | Open in IMG/M |
| 3300000955|JGI1027J12803_102518671 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300002558|JGI25385J37094_10121856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
| 3300002562|JGI25382J37095_10190915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 624 | Open in IMG/M |
| 3300005174|Ga0066680_10189641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1297 | Open in IMG/M |
| 3300005174|Ga0066680_10387496 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005174|Ga0066680_10427867 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
| 3300005176|Ga0066679_11051719 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300005177|Ga0066690_10019324 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300005183|Ga0068993_10164017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 756 | Open in IMG/M |
| 3300005332|Ga0066388_107869173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300005356|Ga0070674_100309678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300005365|Ga0070688_100203874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1385 | Open in IMG/M |
| 3300005366|Ga0070659_101660767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 571 | Open in IMG/M |
| 3300005445|Ga0070708_100060136 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
| 3300005446|Ga0066686_10208256 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300005447|Ga0066689_10489581 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005451|Ga0066681_10428135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 813 | Open in IMG/M |
| 3300005546|Ga0070696_100612979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 879 | Open in IMG/M |
| 3300005546|Ga0070696_101265966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300005552|Ga0066701_10677186 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005554|Ga0066661_10340288 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005560|Ga0066670_10596463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300005560|Ga0066670_10797781 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005561|Ga0066699_10332320 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005561|Ga0066699_10884494 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005576|Ga0066708_10431136 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005713|Ga0066905_101162083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 688 | Open in IMG/M |
| 3300005713|Ga0066905_101850216 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005718|Ga0068866_10534612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300005764|Ga0066903_100275339 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300005764|Ga0066903_101453034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300005764|Ga0066903_104382750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 754 | Open in IMG/M |
| 3300005843|Ga0068860_100389635 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300005843|Ga0068860_101319921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 742 | Open in IMG/M |
| 3300005844|Ga0068862_100032821 | All Organisms → cellular organisms → Bacteria | 4385 | Open in IMG/M |
| 3300006176|Ga0070765_100131663 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300006845|Ga0075421_100545618 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300006846|Ga0075430_100903205 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300006852|Ga0075433_11488483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300006853|Ga0075420_100923298 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300006853|Ga0075420_101126163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300006854|Ga0075425_100318526 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300006871|Ga0075434_101229590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300006969|Ga0075419_10998036 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300007004|Ga0079218_10777997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300007265|Ga0099794_10222377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300007265|Ga0099794_10485491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
| 3300009012|Ga0066710_100116025 | All Organisms → cellular organisms → Bacteria | 3631 | Open in IMG/M |
| 3300009012|Ga0066710_102160068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300009137|Ga0066709_103762588 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 551 | Open in IMG/M |
| 3300009147|Ga0114129_10260112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2326 | Open in IMG/M |
| 3300009147|Ga0114129_10542844 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300009162|Ga0075423_10533102 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300009177|Ga0105248_10256555 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300009610|Ga0105340_1115035 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300009792|Ga0126374_10314062 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1057 | Open in IMG/M |
| 3300010335|Ga0134063_10315536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300010336|Ga0134071_10254194 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300010358|Ga0126370_11563617 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010359|Ga0126376_10101809 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300010359|Ga0126376_11196254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
| 3300010359|Ga0126376_12104812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
| 3300010360|Ga0126372_10222361 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300010362|Ga0126377_10506913 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300010362|Ga0126377_10588545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1156 | Open in IMG/M |
| 3300010362|Ga0126377_10674573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1084 | Open in IMG/M |
| 3300010362|Ga0126377_10786321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1009 | Open in IMG/M |
| 3300010362|Ga0126377_12936639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
| 3300010362|Ga0126377_13061644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300010366|Ga0126379_10932496 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300010398|Ga0126383_13202352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300010401|Ga0134121_10858361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 878 | Open in IMG/M |
| 3300010403|Ga0134123_10190708 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300011414|Ga0137442_1127598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300012096|Ga0137389_10496851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300012206|Ga0137380_10057877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3549 | Open in IMG/M |
| 3300012206|Ga0137380_10727517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 860 | Open in IMG/M |
| 3300012532|Ga0137373_10592120 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012532|Ga0137373_11069906 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012896|Ga0157303_10282668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300012923|Ga0137359_11705826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300012944|Ga0137410_10154143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1752 | Open in IMG/M |
| 3300012948|Ga0126375_11124463 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012986|Ga0164304_10669036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 784 | Open in IMG/M |
| 3300014272|Ga0075327_1015812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2279 | Open in IMG/M |
| 3300014302|Ga0075310_1086217 | Not Available | 652 | Open in IMG/M |
| 3300014868|Ga0180088_1078149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300014968|Ga0157379_11550731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300015054|Ga0137420_1365239 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300015241|Ga0137418_10955452 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300015255|Ga0180077_1113437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300015356|Ga0134073_10367184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300015358|Ga0134089_10073332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1280 | Open in IMG/M |
| 3300015373|Ga0132257_103422173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 577 | Open in IMG/M |
| 3300016445|Ga0182038_11142328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300017974|Ga0187777_10604765 | Not Available | 773 | Open in IMG/M |
| 3300017997|Ga0184610_1065402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1101 | Open in IMG/M |
| 3300018052|Ga0184638_1109075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
| 3300018084|Ga0184629_10138324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1226 | Open in IMG/M |
| 3300018422|Ga0190265_11036077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300018482|Ga0066669_11718624 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018482|Ga0066669_11869851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300018482|Ga0066669_12152655 | Not Available | 528 | Open in IMG/M |
| 3300019377|Ga0190264_10576778 | Not Available | 795 | Open in IMG/M |
| 3300019882|Ga0193713_1043209 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300020581|Ga0210399_11451940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300025910|Ga0207684_10187733 | Not Available | 1782 | Open in IMG/M |
| 3300025910|Ga0207684_10775988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 811 | Open in IMG/M |
| 3300025914|Ga0207671_10201492 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300025923|Ga0207681_10077173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2341 | Open in IMG/M |
| 3300025937|Ga0207669_10448738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
| 3300025938|Ga0207704_10874064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
| 3300025941|Ga0207711_10126995 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300025944|Ga0207661_11192657 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025945|Ga0207679_10522503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300026102|Ga0208914_1023359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300026310|Ga0209239_1255418 | Not Available | 605 | Open in IMG/M |
| 3300026313|Ga0209761_1091665 | Not Available | 1543 | Open in IMG/M |
| 3300026313|Ga0209761_1242096 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026317|Ga0209154_1199301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
| 3300026318|Ga0209471_1272222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300026324|Ga0209470_1120268 | Not Available | 1166 | Open in IMG/M |
| 3300026324|Ga0209470_1237055 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026325|Ga0209152_10385587 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300026329|Ga0209375_1317129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300026334|Ga0209377_1218012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
| 3300026528|Ga0209378_1219283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300026540|Ga0209376_1302999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300026542|Ga0209805_1303310 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026555|Ga0179593_1029079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3672 | Open in IMG/M |
| 3300027815|Ga0209726_10094393 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300027873|Ga0209814_10004141 | All Organisms → cellular organisms → Bacteria | 5469 | Open in IMG/M |
| 3300027882|Ga0209590_11017813 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300027886|Ga0209486_10782754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
| 3300028380|Ga0268265_10133901 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300028381|Ga0268264_10422312 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300028381|Ga0268264_10674703 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300028792|Ga0307504_10366642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300031455|Ga0307505_10474407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300031543|Ga0318516_10014791 | All Organisms → cellular organisms → Bacteria | 3863 | Open in IMG/M |
| 3300031548|Ga0307408_102246363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300031720|Ga0307469_10492491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1072 | Open in IMG/M |
| 3300031720|Ga0307469_11752402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
| 3300031720|Ga0307469_12197641 | Not Available | 537 | Open in IMG/M |
| 3300031740|Ga0307468_100881779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
| 3300031765|Ga0318554_10591696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300031820|Ga0307473_10444750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 861 | Open in IMG/M |
| 3300031821|Ga0318567_10472790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
| 3300031854|Ga0310904_11148525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300031890|Ga0306925_10005361 | All Organisms → cellular organisms → Bacteria | 11744 | Open in IMG/M |
| 3300031910|Ga0306923_10223787 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300031944|Ga0310884_10346927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
| 3300031954|Ga0306926_10033174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6075 | Open in IMG/M |
| 3300032041|Ga0318549_10146935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1048 | Open in IMG/M |
| 3300032043|Ga0318556_10374844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 744 | Open in IMG/M |
| 3300032180|Ga0307471_101933694 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032180|Ga0307471_102125181 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300032205|Ga0307472_100148296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1709 | Open in IMG/M |
| 3300033550|Ga0247829_10557655 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300034090|Ga0326723_0205473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300034155|Ga0370498_085201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300034669|Ga0314794_100500 | Not Available | 619 | Open in IMG/M |
| 3300034671|Ga0314796_184269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300034817|Ga0373948_0216185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.81% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.20% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.60% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_101334852 | 3300000443 | Soil | MVAPIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK* |
| JGI1027J12803_1025186711 | 3300000955 | Soil | IQKIVIDQAMVAPIFQQGFIWGVSSRVEVPGAGLIQGYPYAAPCEDMKLK* |
| JGI25385J37094_101218562 | 3300002558 | Grasslands Soil | MLVRSWLGAPIFQQGFIWGVGPRVEVPAAGLIQGYPYAAPAEDMKLK* |
| JGI25382J37095_101909152 | 3300002562 | Grasslands Soil | QKIVTDQTLVAPIFQQGFIWGVAARVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066680_101896411 | 3300005174 | Soil | APIFQQGFIWGVGPRVEVPAAGLIQGYPYAAPAEDMKLK* |
| Ga0066680_103874962 | 3300005174 | Soil | LDRKQREALLRQIQKIVADQVLVAPIFQQGFIWGIGSRVEVSGAGLIQGYPYAAPGEDLKLK* |
| Ga0066680_104278671 | 3300005174 | Soil | MLVRSWLGAPIFQQGFIWGVGPRVEVPAAGLIQGYPYAAPAEDMKLK |
| Ga0066679_110517191 | 3300005176 | Soil | APLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK* |
| Ga0066690_100193241 | 3300005177 | Soil | KIVTDQTLVAPIFQQGFIWGVTSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0068993_101640172 | 3300005183 | Natural And Restored Wetlands | DRVLTAPIFQQAFLCAVGPRVEEAGAGLIQGFPYSAPAEDLKVKP* |
| Ga0066388_1078691732 | 3300005332 | Tropical Forest Soil | KIVADRALVAVLYQQAFPWGVGSRVENSTAGLIEGYPYTGPNEDLKLK* |
| Ga0070674_1003096783 | 3300005356 | Miscanthus Rhizosphere | QVAPIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK* |
| Ga0070688_1002038741 | 3300005365 | Switchgrass Rhizosphere | DQVQVAPIFQQAFLWGIGPRVEQSTAGMIQGFPYAGPCEDLKLK* |
| Ga0070659_1016607672 | 3300005366 | Corn Rhizosphere | VADQVQVAPIFQQAFLWGIGPRVEQSTAGMIQGFPYAGPCEDLKLK* |
| Ga0070708_1000601361 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DQTLVAPIFQQAFLWGVGSRVEQPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066686_102082562 | 3300005446 | Soil | VAPIFQQGFIWGVGSRVDVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066689_104895812 | 3300005447 | Soil | TEQVMVAPIFQQGFIWGVGSRVDVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066681_104281351 | 3300005451 | Soil | QLQKAVLDRVLVAPIFQQGFVCAVGPRVVESGMGPIQGYPYVGPAEDLKLK* |
| Ga0070696_1006129791 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | APIFQQAFIWGVGARVAEPAAGLIEGYPYVGPAEDLKLK* |
| Ga0070696_1012659661 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LDRVLVAPIFQQAFIWGVGSRVAEPAAKLIDGYPYVGPAEDLKLK* |
| Ga0066701_106771861 | 3300005552 | Soil | TLVAPIFQQGFIWGVTSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066661_103402881 | 3300005554 | Soil | LHRIQKMVAERVLVAPLFQQGFIWGVGSRVEESGAGLIQGYPYAAPCEDLRLR* |
| Ga0066670_105964631 | 3300005560 | Soil | VLVAPLFQQGFIWGVGSRVEESGAGLIQGYPYAAPCEDLRLR* |
| Ga0066670_107977812 | 3300005560 | Soil | VAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066699_103323201 | 3300005561 | Soil | IQKMVAERVLVAPLFQQGFIWGVGSRVEESGAGLIQGYPYAAPCEDLRLR* |
| Ga0066699_108844942 | 3300005561 | Soil | FQQGFIWGVGPRVEVSGAGLIQGYPYAAPCEDLKLK* |
| Ga0066708_104311361 | 3300005576 | Soil | QQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066905_1011620832 | 3300005713 | Tropical Forest Soil | QQGFICGVGPRVAESTLGLIQGFPYVGPAEDLKLK* |
| Ga0066905_1018502161 | 3300005713 | Tropical Forest Soil | IFQQGFIWGVGPRVEVSGAGLIQGYPYAAPCEDLKLK* |
| Ga0068866_105346121 | 3300005718 | Miscanthus Rhizosphere | APIFQQAFPWGVGARVAEPAAGLIQGYPYVGPPEDLRLK* |
| Ga0066903_1002753393 | 3300005764 | Tropical Forest Soil | LHQIQKIVTDQAMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0066903_1014530343 | 3300005764 | Tropical Forest Soil | FQQAFIWGVGQRVAESTAGLIEGYPYVGPCEDLKLQ* |
| Ga0066903_1043827501 | 3300005764 | Tropical Forest Soil | HVLVAPLFQQAFIWGVGSRVAESTAGLVEGYPYVAPCEDLKLN* |
| Ga0068860_1003896352 | 3300005843 | Switchgrass Rhizosphere | LVAPLFQQAFIWGVGKRMAEPGAGLIEGYPYVGPFEDVRLR* |
| Ga0068860_1013199211 | 3300005843 | Switchgrass Rhizosphere | LFQQAFIWGVGSRVAEGGAGLIEGYPYAAPCEDLKLQ* |
| Ga0068862_1000328216 | 3300005844 | Switchgrass Rhizosphere | QAFIWGVGKRVAEPGAGLIEGYPYVGPAEDLRLR* |
| Ga0070765_1001316631 | 3300006176 | Soil | HQIQKIVADQAMVAPIFQQAFIWGVGSRVEQPTAGLIQGYPYAAPCEDLKLK* |
| Ga0075421_1005456184 | 3300006845 | Populus Rhizosphere | QQAFLTGVGARVEQPAAGLIEGFPYSAPCEDLKLK* |
| Ga0075430_1009032051 | 3300006846 | Populus Rhizosphere | VLTAPIFQQAFLCAVAARVENPGAGLIQGFPYSAPAEDLKVKP* |
| Ga0075433_114884832 | 3300006852 | Populus Rhizosphere | LAAPIFQQGFVCAIGPRVAESTLGLIQGFPYVGPAEDAKLK* |
| Ga0075420_1009232982 | 3300006853 | Populus Rhizosphere | PIFQQAFLTGVGARVEQPAAGLIEGFPYSAPCEDLKLK* |
| Ga0075420_1011261632 | 3300006853 | Populus Rhizosphere | PIFQQGFIWGVGSRVAEGGAGLIQGYPYAAPAEDLKLK* |
| Ga0075425_1003185261 | 3300006854 | Populus Rhizosphere | VAPIFQQGFIWGVGSRVEAPGAGLIQGYPYAAPCEDLKLK* |
| Ga0075434_1012295902 | 3300006871 | Populus Rhizosphere | DQVLAAPIFQQGFLCAVGPRVAESGLGLIQGFPYAGPAEDLRLK* |
| Ga0075419_109980361 | 3300006969 | Populus Rhizosphere | QVLAAPIFQQGFLCAVGPRVAESALGLIQGFPYTGPAEDLRLK* |
| Ga0079218_107779971 | 3300007004 | Agricultural Soil | VLIAPLFQQAFIWGVGSRVEQPAAGLIQGYPYVGPAEDLKLK* |
| Ga0099794_102223773 | 3300007265 | Vadose Zone Soil | IFQQGFICGVGPRVAEPALGLIQGFPYAGPAEDLKLK* |
| Ga0099794_104854912 | 3300007265 | Vadose Zone Soil | PLYQQAFIWGVGSRVAEAGAGLIPGFPYVGPPEDLKLK* |
| Ga0066710_1001160251 | 3300009012 | Grasslands Soil | DQTMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0066710_1021600681 | 3300009012 | Grasslands Soil | DHVLVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK |
| Ga0099829_107313472 | 3300009038 | Vadose Zone Soil | QQAFLTGVGPRVEESGASLIQGFPYSAPAEDLKVKP* |
| Ga0066709_1037625881 | 3300009137 | Grasslands Soil | IQKIVTDEVLVAPIFQQGFVCAIGPRVAESTLGLIQGFPYVGPAEDAKLK* |
| Ga0114129_102601124 | 3300009147 | Populus Rhizosphere | VAPIFQQGFIWGIGSRVDQPGAGLIQGFPYAAPCEDLKLK* |
| Ga0114129_105428441 | 3300009147 | Populus Rhizosphere | QVLVAPIFQQAFLTGVGARVEQPAAGLIEGFPYSAPCEDLKLK* |
| Ga0075423_105331021 | 3300009162 | Populus Rhizosphere | KIVIDQALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK* |
| Ga0105248_102565551 | 3300009177 | Switchgrass Rhizosphere | LVAPLFQQAFIWGVGKRMAEPGAGLIEGYPYMGPFEDVRLR* |
| Ga0105340_11150351 | 3300009610 | Soil | VADQVLAAPIFQQGFIWGMGSRVEVSGAGLIQGYPYAAPGEDLKLK* |
| Ga0126374_103140621 | 3300009792 | Tropical Forest Soil | VLVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKIK* |
| Ga0134063_103155362 | 3300010335 | Grasslands Soil | IADNVLIAPIFQQAFIWGVSARVAEPAAGLIEGYPYIGPAEDLKLK* |
| Ga0134071_102541942 | 3300010336 | Grasslands Soil | LTEQVMVAPIFQQGFIWGVGSRVDVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0126370_115636171 | 3300010358 | Tropical Forest Soil | IQKSVADHVLVAPIFQQAFIWGVGQRVAEPGAGFVEGYPYAAPCEDLKLQ* |
| Ga0126376_101018091 | 3300010359 | Tropical Forest Soil | QVLVAPIFQQAFIWGVGARVEQPAAGLIQGYAYAGPPEDLKLK* |
| Ga0126376_111962542 | 3300010359 | Tropical Forest Soil | IVTDQVLVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDMKLK* |
| Ga0126376_121048121 | 3300010359 | Tropical Forest Soil | APIFQQGFIWGVGSRVETPGAGLIQGYPYAAPCEDLKLK* |
| Ga0126372_102223611 | 3300010360 | Tropical Forest Soil | IFQQAFIWGVGARVEQAGAGLIQGYAYAGPPEDLQLK* |
| Ga0126377_105069133 | 3300010362 | Tropical Forest Soil | AEQVQVAPIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK* |
| Ga0126377_105885451 | 3300010362 | Tropical Forest Soil | HQIQKIVTDQVLVAPIFQQGFIWGVGSRVEAPGAGLIQGYPYAAPCEDLKLK* |
| Ga0126377_106745732 | 3300010362 | Tropical Forest Soil | LVAPIFQQGFIWGVGARVETPGAGLIQGYPYAAPCEDLKLK* |
| Ga0126377_107863212 | 3300010362 | Tropical Forest Soil | VLAAPIFQQAFLWGVGGRVEQPTAGLIQGYPYVGPAEDLKLK* |
| Ga0126377_129366391 | 3300010362 | Tropical Forest Soil | IAPIFQQAFIWGVRDRVAEPAAGLIEGYPYVGPAEDLKLK* |
| Ga0126377_130616442 | 3300010362 | Tropical Forest Soil | IVTDQALVAPIFQQGFIWGVGSRVEVSGAALIQGYPYAAPCEDLKLK* |
| Ga0126379_109324961 | 3300010366 | Tropical Forest Soil | IQKSVADHVLVAPLFQQAFIWGVGQRVAESTAGLIEGYPYVGPCEDLKLQ* |
| Ga0126383_132023522 | 3300010398 | Tropical Forest Soil | VDQALVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKIK* |
| Ga0134121_108583611 | 3300010401 | Terrestrial Soil | VADHTLVAPLFQQAFIWGVGKRMAEPGAGLIEGYPYVGPFEDVRLR* |
| Ga0134123_101907081 | 3300010403 | Terrestrial Soil | QKIVVDQAMVAPIFQQGFIWGVGSRVEVSGAGLIQGYPYAAPCEDMKLT* |
| Ga0137442_11275981 | 3300011414 | Soil | ERVLVAPLYQQAFPWGVGARVDESTAGLIQGFPYTGPFEDLKLK* |
| Ga0137389_104968513 | 3300012096 | Vadose Zone Soil | QQGFIWGVGPRVEEAAAGLIQGYPYVGPAEDLKLR* |
| Ga0137380_100578772 | 3300012206 | Vadose Zone Soil | LTEQVMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK* |
| Ga0137380_107275171 | 3300012206 | Vadose Zone Soil | IFQQAFIWGVGSRVAEAGAKLIDGYPYVGPAEDLKLK* |
| Ga0137373_105921202 | 3300012532 | Vadose Zone Soil | PLYQQAFPWGVGSRVEDSTAGLIQGFPYTGPFEDLKVK* |
| Ga0137373_110699062 | 3300012532 | Vadose Zone Soil | APLYQQAFPWGVGSRVEDSTAGLIQGFPYTGPFEDLKLK* |
| Ga0157303_102826682 | 3300012896 | Soil | VIDQALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK* |
| Ga0137359_117058261 | 3300012923 | Vadose Zone Soil | QQAFLWGVGPRVEQPGAGLIQGYPYAGPCEDLKLK* |
| Ga0137410_101541431 | 3300012944 | Vadose Zone Soil | IQKAVADHVLVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK* |
| Ga0126375_111244632 | 3300012948 | Tropical Forest Soil | SVADHVLVAPLFQQAFIWGVGQRVAESTAGLIEGYPYVGPCEDLKLQ* |
| Ga0164304_106690361 | 3300012986 | Soil | QAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK* |
| Ga0075327_10158121 | 3300014272 | Natural And Restored Wetlands | APIFQQGFIWGVGSRVEQPAAGLIQGFPYVGPAEELKLK* |
| Ga0075310_10862172 | 3300014302 | Natural And Restored Wetlands | QSGCGVGPGPIFQQGFIWGVGSRVEQPAAGLIQGFPYVGPAEELKLK* |
| Ga0180088_10781491 | 3300014868 | Soil | DQVLAAPIFQQGFLCAVGPRVVESGLGLIQGFPYSAPGEDLRLK* |
| Ga0157379_115507312 | 3300014968 | Switchgrass Rhizosphere | DQALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK* |
| Ga0137420_13652392 | 3300015054 | Vadose Zone Soil | PIFQQGFVCAVGPRVAESTLGMIQGFPYVGPAEDAKLK* |
| Ga0137418_109554521 | 3300015241 | Vadose Zone Soil | APIFQQGFVCAVGPRVAESTLGMIQGFPYVGPAEDAKLK* |
| Ga0180077_11134371 | 3300015255 | Soil | QAFLWGVGGRVAEPAAGLIQGYPYVGPAEDLRLK* |
| Ga0134073_103671841 | 3300015356 | Grasslands Soil | AVADHVLVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK* |
| Ga0134089_100733322 | 3300015358 | Grasslands Soil | MLVRSWLGAPIFQQGFIWGIGSRVEVSGAGLIQGYPYAAPGEDLKLK* |
| Ga0132257_1034221731 | 3300015373 | Arabidopsis Rhizosphere | HQMQRSVADHTLVAPLFQQAFIWGVGKRMAEPGAGLIEGYPYVGPFEDVRLR* |
| Ga0182038_111423282 | 3300016445 | Soil | LHQIQKIVVDQAMVAPIFQQGFIWGVSSRVEAPSAGLIQGYPYAAPCEDLKIK |
| Ga0187777_106047652 | 3300017974 | Tropical Peatland | QKIVVDQALVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKIK |
| Ga0184610_10654023 | 3300017997 | Groundwater Sediment | LFQQAFLWGVGSRVAESGAGLIEGFPYTAPFEDLKLK |
| Ga0184638_11090753 | 3300018052 | Groundwater Sediment | PLFQQAFLWGVGSRVAESGAGLLEGFPYTAPFEDLKLK |
| Ga0184629_101383243 | 3300018084 | Groundwater Sediment | VAPLFQQAFLWGVGSRVAEGGAGLIEGFPYTAPFEDLKLK |
| Ga0190265_110360773 | 3300018422 | Soil | AAPIFQQGFLCAVGPRVAESGAGLIQGFPYSAPGEDLRLK |
| Ga0066669_117186242 | 3300018482 | Grasslands Soil | QRKVADYVLVAPLFQQAFIWGVGKRAAEPGAGLIEGYPYSAPAEDLRLQ |
| Ga0066669_118698512 | 3300018482 | Grasslands Soil | ADHVLVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK |
| Ga0066669_121526551 | 3300018482 | Grasslands Soil | KIVTDEVLVAPIFQQGFVCAIGPRVAESTLGMIQGFPYVGPAEDAKLK |
| Ga0190264_105767782 | 3300019377 | Soil | FQQGFLCGVGPRVAEAGLGLVQGYPYVAPAEDLKLK |
| Ga0193713_10432091 | 3300019882 | Soil | APIFQQAFPWGVGARVAEPAAGLIQGYPYVGPAEDLRLK |
| Ga0210399_114519402 | 3300020581 | Soil | QQAFIWAVGSRVEQPAAGLIQGYPYAAPCEDLKLK |
| Ga0207684_101877331 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | APIFQQGFIWGVTSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0207684_107759883 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SQLFQQGFIWGVGPRVVESGAGRIDGFPYAAPFEDLKLR |
| Ga0207671_102014923 | 3300025914 | Corn Rhizosphere | ALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK |
| Ga0207681_100771734 | 3300025923 | Switchgrass Rhizosphere | QQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK |
| Ga0207669_104487383 | 3300025937 | Miscanthus Rhizosphere | VAHGEIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK |
| Ga0207704_108740641 | 3300025938 | Miscanthus Rhizosphere | ADQTLVAPIFQQAFPWGVGARVAEPAAGLIQGYPYVGPPEDLRLK |
| Ga0207711_101269951 | 3300025941 | Switchgrass Rhizosphere | LHQMQRSVADHVLVAPLFQQAFIWGVGKRMAEPGAGLIEGYPYMGPFEDVRLR |
| Ga0207661_111926572 | 3300025944 | Corn Rhizosphere | VIDQALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK |
| Ga0207679_105225033 | 3300025945 | Corn Rhizosphere | IQKIVVDQVQVAPIFQQAFLWGIGPRVEQSTAGMIQGFPYAGPCEELKLK |
| Ga0208914_10233592 | 3300026102 | Natural And Restored Wetlands | QQAFPWGVGARVAEPAAGLIQGYPYVGPAEDLRLK |
| Ga0209239_12554182 | 3300026310 | Grasslands Soil | FQQGFIWGVGPRVEVAAAGLIQGYPYVGPAEDLKLR |
| Ga0209761_10916652 | 3300026313 | Grasslands Soil | TDQTLVAPIFQQGFIWGVAARVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0209761_12420961 | 3300026313 | Grasslands Soil | VAPLFQQGFIWGVGPRVEVAAAGLIQGYPYVGPAEDLKLR |
| Ga0209154_11993011 | 3300026317 | Soil | PLRQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK |
| Ga0209471_12722222 | 3300026318 | Soil | LVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK |
| Ga0209470_11202682 | 3300026324 | Soil | VLIAPIFQQAFIWGVSARVAEPAAGLIEGYPYIGPAEDLKLK |
| Ga0209470_12370551 | 3300026324 | Soil | KLVADQVIAAPIFQQGFIWGVGSRVDVSGAGLIQGYPYAAPTEDLKLK |
| Ga0209152_103855872 | 3300026325 | Soil | LVAPLFQQGFIWGVGPRVEVAAAGLIQGYPYVGPAEDLKLR |
| Ga0209375_13171292 | 3300026329 | Soil | QIQKAVADHVLVAPLHQQAFIWGVNARVEQPAAGLIEGYPYVGPAEDLKLK |
| Ga0209377_12180121 | 3300026334 | Soil | LKIVTDQTLAAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0209378_12192831 | 3300026528 | Soil | IFQQGFIWGVTSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0209376_13029991 | 3300026540 | Soil | IVNEQVMVAPIFQQGFIWGVGSRVDVPGAGLIQGYPYAAPCEDLKLK |
| Ga0209805_13033102 | 3300026542 | Soil | HQLQRILKMVAERVLVAPLFQQGFIWGVGSRVEESGAGLIQGYPYAAPCEDLRLR |
| Ga0179593_10290796 | 3300026555 | Vadose Zone Soil | QQGFIWGVGSRVEESGAGLIQGYAYAAPCEDLRLR |
| Ga0209726_100943934 | 3300027815 | Groundwater | IVAGQVLAAPIFQQAFLWGVGARVEQPAAGLIQGYPYVGPAEDLKLK |
| Ga0209814_100041415 | 3300027873 | Populus Rhizosphere | FQQGFIWGVGSRVEAPGAGLIQGYPYAAPCEDLKLK |
| Ga0209590_110178132 | 3300027882 | Vadose Zone Soil | VADQVLAAPIFQQAFPWGVGARVEQPAAGLIQGYPYVGPAEDLKLK |
| Ga0209486_107827542 | 3300027886 | Agricultural Soil | IVADQTLAAPIFQQAFIWGVGPSVAEAGAGLIEGYPYAAPCEDLKLK |
| Ga0268265_101339011 | 3300028380 | Switchgrass Rhizosphere | DQVLAAPIFQQAFLCAVGARVAESGLGLIQGFPYAGPAEELRLK |
| Ga0268264_104223123 | 3300028381 | Switchgrass Rhizosphere | QILKIVIDQALVAPVFQQAFLWGVGARVEQPAAGLIQGYPYAGPCEDLKLK |
| Ga0268264_106747031 | 3300028381 | Switchgrass Rhizosphere | LYQQAFPWGVGSRVEESTAGLVQGFPYTGPFEDLKLK |
| Ga0307504_103666421 | 3300028792 | Soil | LVAPIFQQAFLWGVGARVEQPGAGLIQGYPYAAPCEDLKLK |
| Ga0307505_104744072 | 3300031455 | Soil | ADQTLVAPIFQQAFLWGVGARVEQPGAGLIQGYPYAAPCEDLKLK |
| Ga0318516_100147914 | 3300031543 | Soil | LHQIQKIVTDQAMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0307408_1022463632 | 3300031548 | Rhizosphere | QRLVAEHTLVAPIFQQAFIWGVGTRVAEAGAGLIEGYPYAAPCEDLKLK |
| Ga0307469_104924912 | 3300031720 | Hardwood Forest Soil | VLVAPIFQQGFIWGVGSRVEAPGAGLIQGYPYAAPCEDLKLK |
| Ga0307469_117524022 | 3300031720 | Hardwood Forest Soil | HQIQKIVTDQTLVAPIFQQGFIWGVAARVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0307469_121976411 | 3300031720 | Hardwood Forest Soil | FQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK |
| Ga0307468_1008817791 | 3300031740 | Hardwood Forest Soil | VLAAPIFQQAFLWGVGGRVEQPAAGLIQGYPYVGPAEDLKLK |
| Ga0318554_105916962 | 3300031765 | Soil | PLFQQAFIWGVGSRVAESTAGLVEGYPYVAPCDDLKLQ |
| Ga0307473_104447502 | 3300031820 | Hardwood Forest Soil | IDQAMVAPIFQQGFIWGVSSRVEVPGAGLIQGYPYAAPCEDMKLK |
| Ga0318567_104727902 | 3300031821 | Soil | AMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0310904_111485252 | 3300031854 | Soil | DQVQVAPIFQQAFLWGIGPRVEQSTAGMIQGFPYAGPCEDLKLK |
| Ga0306925_100053611 | 3300031890 | Soil | IQKIVTDQAMVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0306923_102237871 | 3300031910 | Soil | FQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKIK |
| Ga0310884_103469272 | 3300031944 | Soil | IVTDQTLVAPIFQQGFIWGVASRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0306926_100331748 | 3300031954 | Soil | PLYQQAFPWGVGPRVEDSTAGVIQGFPYTGPDEDLKLK |
| Ga0318549_101469352 | 3300032041 | Soil | FQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKLK |
| Ga0318556_103748442 | 3300032043 | Soil | HQIQKIVVDQALVAPIFQQGFIWGVGSRVEVPGAGLIQGYPYAAPCEDLKIK |
| Ga0307471_1019336941 | 3300032180 | Hardwood Forest Soil | PLFQQGFIWGVGPRVVESGAGLIEGFPYAGPVEDVKVK |
| Ga0307471_1021251812 | 3300032180 | Hardwood Forest Soil | MRVRRSLGVIVLVAPLVQQAFIWGVKSRVEESSAGLIQGYPCAAPCEELKLR |
| Ga0307472_1001482964 | 3300032205 | Hardwood Forest Soil | AEQVQVAPIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK |
| Ga0247829_105576552 | 3300033550 | Soil | QQAFICAVGARVEESGLGLIQGYPYAGPVEDLKLK |
| Ga0326723_0205473_758_871 | 3300034090 | Peat Soil | IFQQGFIWGVGSRVEQAGAGLIQGYPYAAPCEDLKLK |
| Ga0370498_085201_1_120 | 3300034155 | Untreated Peat Soil | APIFQQAFPWGVGGRVAEPAAGLIQGYPYVGPAEDLRLK |
| Ga0314794_100500_479_619 | 3300034669 | Soil | VAEQVQVAPIFQQGFIWGIGPRVEVATAGMIQGFPYAGPCEDLKLK |
| Ga0314796_184269_12_155 | 3300034671 | Soil | MVADQVQVAPIFQQAFLWGIGPRVEQSTAGMIQGFPYAGPCEDLKLK |
| Ga0373948_0216185_357_503 | 3300034817 | Rhizosphere Soil | KIVVDQAMVAPIFQQGFIWGIGPRVEQSGAGLIQGYPYAAPCEDLKLK |
| ⦗Top⦘ |