


| Basic Information | |
|---|---|
| Family ID | F038097 |
| Family Type | Metagenome |
| Number of Sequences | 166 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MMYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.30 % |
| % of genes near scaffold ends (potentially truncated) | 9.64 % |
| % of genes from short scaffolds (< 2000 bps) | 43.37 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.771 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (26.506 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 16.67% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF01227 | GTP_cyclohydroI | 24.70 |
| PF01027 | Bax1-I | 9.04 |
| PF01230 | HIT | 7.23 |
| PF01370 | Epimerase | 4.22 |
| PF13394 | Fer4_14 | 3.01 |
| PF04055 | Radical_SAM | 2.41 |
| PF01242 | PTPS | 1.81 |
| PF01041 | DegT_DnrJ_EryC1 | 1.81 |
| PF13671 | AAA_33 | 1.81 |
| PF02739 | 5_3_exonuc_N | 1.81 |
| PF03819 | MazG | 1.20 |
| PF13517 | FG-GAP_3 | 1.20 |
| PF00004 | AAA | 1.20 |
| PF14743 | DNA_ligase_OB_2 | 1.20 |
| PF00782 | DSPc | 1.20 |
| PF00730 | HhH-GPD | 0.60 |
| PF01555 | N6_N4_Mtase | 0.60 |
| PF13203 | DUF2201_N | 0.60 |
| PF09834 | DUF2061 | 0.60 |
| PF00383 | dCMP_cyt_deam_1 | 0.60 |
| PF00156 | Pribosyltran | 0.60 |
| PF00118 | Cpn60_TCP1 | 0.60 |
| PF00011 | HSP20 | 0.60 |
| PF02592 | Vut_1 | 0.60 |
| PF07724 | AAA_2 | 0.60 |
| PF14235 | DUF4337 | 0.60 |
| PF09414 | RNA_ligase | 0.60 |
| PF11351 | GTA_holin_3TM | 0.60 |
| PF01467 | CTP_transf_like | 0.60 |
| PF03721 | UDPG_MGDP_dh_N | 0.60 |
| PF02915 | Rubrerythrin | 0.60 |
| PF00574 | CLP_protease | 0.60 |
| PF04325 | DUF465 | 0.60 |
| PF00082 | Peptidase_S8 | 0.60 |
| PF01503 | PRA-PH | 0.60 |
| PF00462 | Glutaredoxin | 0.60 |
| PF01648 | ACPS | 0.60 |
| PF10431 | ClpB_D2-small | 0.60 |
| PF12708 | Pectate_lyase_3 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.81 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.81 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.81 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.81 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.81 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.81 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.81 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.81 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.60 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.60 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.60 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.60 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.60 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.60 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.60 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.60 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.60 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.23 % |
| Unclassified | root | N/A | 42.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10185244 | Not Available | 716 | Open in IMG/M |
| 3300000736|JGI12547J11936_1092858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300002144|M2t2BS2_10483637 | Not Available | 780 | Open in IMG/M |
| 3300002408|B570J29032_109313955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300002408|B570J29032_109632948 | Not Available | 966 | Open in IMG/M |
| 3300002835|B570J40625_101206170 | Not Available | 633 | Open in IMG/M |
| 3300004128|Ga0066180_10236215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300004128|Ga0066180_10283845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300005581|Ga0049081_10000099 | Not Available | 32732 | Open in IMG/M |
| 3300005581|Ga0049081_10329747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300005582|Ga0049080_10016044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2605 | Open in IMG/M |
| 3300005584|Ga0049082_10023537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2140 | Open in IMG/M |
| 3300005585|Ga0049084_10291310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300005662|Ga0078894_11538544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300005805|Ga0079957_1143784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300005912|Ga0075109_1228104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300005913|Ga0075108_10015223 | Not Available | 3012 | Open in IMG/M |
| 3300005931|Ga0075119_1056538 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006071|Ga0007876_1000197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25351 | Open in IMG/M |
| 3300006071|Ga0007876_1013740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2316 | Open in IMG/M |
| 3300006071|Ga0007876_1107092 | Not Available | 719 | Open in IMG/M |
| 3300006100|Ga0007806_1005209 | Not Available | 3367 | Open in IMG/M |
| 3300006127|Ga0007805_1027035 | Not Available | 1314 | Open in IMG/M |
| 3300007516|Ga0105050_10000136 | Not Available | 94984 | Open in IMG/M |
| 3300007516|Ga0105050_10025520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5060 | Open in IMG/M |
| 3300008107|Ga0114340_1270739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300008110|Ga0114343_1006982 | Not Available | 5830 | Open in IMG/M |
| 3300008267|Ga0114364_1001643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13261 | Open in IMG/M |
| 3300008267|Ga0114364_1001883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12251 | Open in IMG/M |
| 3300008267|Ga0114364_1176137 | Not Available | 552 | Open in IMG/M |
| 3300009068|Ga0114973_10003186 | Not Available | 11678 | Open in IMG/M |
| 3300009068|Ga0114973_10664225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009151|Ga0114962_10007487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8296 | Open in IMG/M |
| 3300009151|Ga0114962_10100403 | Not Available | 1803 | Open in IMG/M |
| 3300009155|Ga0114968_10006116 | Not Available | 8882 | Open in IMG/M |
| 3300009155|Ga0114968_10006731 | Not Available | 8459 | Open in IMG/M |
| 3300009155|Ga0114968_10015012 | Not Available | 5452 | Open in IMG/M |
| 3300009158|Ga0114977_10046188 | Not Available | 2704 | Open in IMG/M |
| 3300009158|Ga0114977_10059767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 2347 | Open in IMG/M |
| 3300009158|Ga0114977_10133311 | Not Available | 1489 | Open in IMG/M |
| 3300009159|Ga0114978_10000005 | Not Available | 179875 | Open in IMG/M |
| 3300009159|Ga0114978_10000692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28512 | Open in IMG/M |
| 3300009159|Ga0114978_10002244 | Not Available | 15932 | Open in IMG/M |
| 3300009159|Ga0114978_10003883 | Not Available | 12186 | Open in IMG/M |
| 3300009159|Ga0114978_10032786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3697 | Open in IMG/M |
| 3300009159|Ga0114978_10753722 | Not Available | 552 | Open in IMG/M |
| 3300009161|Ga0114966_10053041 | Not Available | 2872 | Open in IMG/M |
| 3300009163|Ga0114970_10004291 | Not Available | 10389 | Open in IMG/M |
| 3300009163|Ga0114970_10033949 | All Organisms → Viruses → Predicted Viral | 3376 | Open in IMG/M |
| 3300009163|Ga0114970_10099214 | All Organisms → Viruses → Predicted Viral | 1804 | Open in IMG/M |
| 3300009164|Ga0114975_10083497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 1857 | Open in IMG/M |
| 3300009164|Ga0114975_10217742 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300009164|Ga0114975_10259473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 970 | Open in IMG/M |
| 3300009183|Ga0114974_10001208 | Not Available | 20485 | Open in IMG/M |
| 3300009183|Ga0114974_10033161 | All Organisms → cellular organisms → Bacteria | 3551 | Open in IMG/M |
| 3300009419|Ga0114982_1156407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300010160|Ga0114967_10300067 | Not Available | 825 | Open in IMG/M |
| 3300010334|Ga0136644_10343584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300010885|Ga0133913_10083181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8583 | Open in IMG/M |
| 3300010885|Ga0133913_10235933 | All Organisms → cellular organisms → Bacteria | 4861 | Open in IMG/M |
| 3300010885|Ga0133913_11474715 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300012347|Ga0157142_1001784 | All Organisms → cellular organisms → Bacteria | 4894 | Open in IMG/M |
| 3300012352|Ga0157138_1004101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2477 | Open in IMG/M |
| 3300012663|Ga0157203_1000018 | Not Available | 68771 | Open in IMG/M |
| 3300012664|Ga0157497_1000061 | Not Available | 24074 | Open in IMG/M |
| 3300012664|Ga0157497_1001105 | All Organisms → cellular organisms → Bacteria | 5078 | Open in IMG/M |
| 3300012665|Ga0157210_1004745 | All Organisms → Viruses → Predicted Viral | 2854 | Open in IMG/M |
| 3300012667|Ga0157208_10006214 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
| 3300013004|Ga0164293_10007687 | Not Available | 9113 | Open in IMG/M |
| 3300013004|Ga0164293_10014092 | Not Available | 6716 | Open in IMG/M |
| 3300013004|Ga0164293_10019064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5729 | Open in IMG/M |
| 3300013004|Ga0164293_10056926 | Not Available | 3128 | Open in IMG/M |
| 3300013004|Ga0164293_10096242 | Not Available | 2282 | Open in IMG/M |
| 3300013004|Ga0164293_10297047 | Not Available | 1121 | Open in IMG/M |
| 3300013005|Ga0164292_10065400 | Not Available | 2816 | Open in IMG/M |
| 3300013005|Ga0164292_10208764 | Not Available | 1384 | Open in IMG/M |
| 3300013006|Ga0164294_10003564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13821 | Open in IMG/M |
| 3300013093|Ga0164296_1034084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2748 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10000715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 54729 | Open in IMG/M |
| 3300013372|Ga0177922_10547179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2382 | Open in IMG/M |
| 3300017722|Ga0181347_1017632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2272 | Open in IMG/M |
| 3300017722|Ga0181347_1033886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1585 | Open in IMG/M |
| 3300017736|Ga0181365_1142740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300017754|Ga0181344_1013193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2624 | Open in IMG/M |
| 3300017774|Ga0181358_1186518 | Not Available | 687 | Open in IMG/M |
| 3300017777|Ga0181357_1074272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1305 | Open in IMG/M |
| 3300017777|Ga0181357_1222008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300017778|Ga0181349_1038208 | All Organisms → Viruses → Predicted Viral | 1912 | Open in IMG/M |
| 3300019784|Ga0181359_1000195 | Not Available | 12767 | Open in IMG/M |
| 3300019784|Ga0181359_1008337 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
| 3300019784|Ga0181359_1011731 | All Organisms → Viruses → Predicted Viral | 3154 | Open in IMG/M |
| 3300019784|Ga0181359_1105722 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300020141|Ga0211732_1609528 | Not Available | 751 | Open in IMG/M |
| 3300020151|Ga0211736_10338650 | All Organisms → Viruses → Predicted Viral | 2123 | Open in IMG/M |
| 3300020159|Ga0211734_10868594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2051 | Open in IMG/M |
| 3300020160|Ga0211733_10385749 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300020160|Ga0211733_10404096 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300020160|Ga0211733_10445882 | Not Available | 4455 | Open in IMG/M |
| 3300020160|Ga0211733_11118741 | Not Available | 14435 | Open in IMG/M |
| 3300020160|Ga0211733_11216232 | Not Available | 3039 | Open in IMG/M |
| 3300020161|Ga0211726_10190940 | Not Available | 859 | Open in IMG/M |
| 3300020161|Ga0211726_10383946 | Not Available | 6548 | Open in IMG/M |
| 3300020161|Ga0211726_10654849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
| 3300020161|Ga0211726_10884809 | Not Available | 3357 | Open in IMG/M |
| 3300020161|Ga0211726_10936406 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
| 3300020172|Ga0211729_10911171 | Not Available | 2831 | Open in IMG/M |
| 3300020498|Ga0208050_1006695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300020560|Ga0208852_1019090 | Not Available | 1322 | Open in IMG/M |
| 3300020735|Ga0214219_1018716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
| 3300021956|Ga0213922_1014121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2141 | Open in IMG/M |
| 3300022407|Ga0181351_1005674 | Not Available | 4771 | Open in IMG/M |
| 3300022407|Ga0181351_1158789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300023174|Ga0214921_10021511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6845 | Open in IMG/M |
| 3300023174|Ga0214921_10146474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18 | 1617 | Open in IMG/M |
| 3300023184|Ga0214919_10000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae | 352754 | Open in IMG/M |
| 3300023184|Ga0214919_10000941 | Not Available | 49223 | Open in IMG/M |
| 3300025358|Ga0208504_1004088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2398 | Open in IMG/M |
| 3300025369|Ga0208382_1031205 | Not Available | 665 | Open in IMG/M |
| 3300025379|Ga0208738_1007500 | Not Available | 1958 | Open in IMG/M |
| 3300025383|Ga0208250_1000196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20784 | Open in IMG/M |
| 3300025392|Ga0208380_1003209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3381 | Open in IMG/M |
| 3300025467|Ga0208260_1057678 | Not Available | 798 | Open in IMG/M |
| 3300025502|Ga0208903_1012732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2851 | Open in IMG/M |
| 3300025606|Ga0207954_1071036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300025723|Ga0208741_10003843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4884 | Open in IMG/M |
| 3300027708|Ga0209188_1010088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5412 | Open in IMG/M |
| 3300027710|Ga0209599_10210898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027720|Ga0209617_10086385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1050659 | Not Available | 2395 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1062388 | Not Available | 2035 | Open in IMG/M |
| 3300027733|Ga0209297_1006794 | Not Available | 5768 | Open in IMG/M |
| 3300027734|Ga0209087_1001359 | Not Available | 14400 | Open in IMG/M |
| 3300027736|Ga0209190_1016620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4206 | Open in IMG/M |
| 3300027754|Ga0209596_1004063 | Not Available | 11271 | Open in IMG/M |
| 3300027759|Ga0209296_1052854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2109 | Open in IMG/M |
| 3300027763|Ga0209088_10010752 | All Organisms → Viruses → Predicted Viral | 4943 | Open in IMG/M |
| 3300027782|Ga0209500_10004459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9256 | Open in IMG/M |
| 3300027782|Ga0209500_10010210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5819 | Open in IMG/M |
| 3300027782|Ga0209500_10253926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11 | 765 | Open in IMG/M |
| 3300027963|Ga0209400_1029002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3105 | Open in IMG/M |
| 3300027969|Ga0209191_1000387 | Not Available | 34786 | Open in IMG/M |
| 3300027971|Ga0209401_1005006 | Not Available | 8094 | Open in IMG/M |
| 3300027971|Ga0209401_1118440 | Not Available | 1070 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1170747 | Not Available | 854 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1241379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1024721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4488 | Open in IMG/M |
| 3300031857|Ga0315909_10061952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3395 | Open in IMG/M |
| 3300031857|Ga0315909_10241088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300031857|Ga0315909_10895171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300032092|Ga0315905_10105420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2841 | Open in IMG/M |
| 3300033993|Ga0334994_0372737 | Not Available | 699 | Open in IMG/M |
| 3300033996|Ga0334979_0283779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18 | 946 | Open in IMG/M |
| 3300034013|Ga0334991_0038932 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300034062|Ga0334995_0054350 | Not Available | 3250 | Open in IMG/M |
| 3300034066|Ga0335019_0001730 | Not Available | 14269 | Open in IMG/M |
| 3300034082|Ga0335020_0076439 | Not Available | 1725 | Open in IMG/M |
| 3300034082|Ga0335020_0099340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1485 | Open in IMG/M |
| 3300034093|Ga0335012_0026630 | All Organisms → Viruses → Predicted Viral | 3413 | Open in IMG/M |
| 3300034093|Ga0335012_0042888 | Not Available | 2633 | Open in IMG/M |
| 3300034102|Ga0335029_0019285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5203 | Open in IMG/M |
| 3300034102|Ga0335029_0098754 | Not Available | 2063 | Open in IMG/M |
| 3300034102|Ga0335029_0493555 | Not Available | 712 | Open in IMG/M |
| 3300034102|Ga0335029_0557098 | Not Available | 652 | Open in IMG/M |
| 3300034272|Ga0335049_0178520 | Not Available | 1504 | Open in IMG/M |
| 3300034283|Ga0335007_0240286 | Not Available | 1227 | Open in IMG/M |
| 3300034284|Ga0335013_0132355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1713 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.22% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.01% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.41% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.20% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.60% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.60% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.60% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101852442 | 3300000101 | Marine | MRYYITNKQGTVNLPYEPGLIEWLQEHYPVSKYRIVEVV* |
| JGI12547J11936_10928581 | 3300000736 | Freshwater And Sediment | MYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT* |
| M2t2BS2_104836374 | 3300002144 | Marine | MIKYITNKSGTINLPWEPGMLEWLRERYPASQYRVVEVA* |
| B570J29032_1093139553 | 3300002408 | Freshwater | MMYITNITGEIKLPWEPGLLEWLHENYPASKYRVVELT* |
| B570J29032_1096329483 | 3300002408 | Freshwater | MTIITNITGEINLPWEPGLLEWLQEHYPASKYRVVELT* |
| B570J40625_1012061701 | 3300002835 | Freshwater | MIYITNRDGSIKLPWEPDLLEWLQEQYPYSQYHLAELDKITQ* |
| Ga0066180_102362151 | 3300004128 | Freshwater Lake | KMTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0066180_102838451 | 3300004128 | Freshwater Lake | KMTIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT* |
| Ga0049081_100000995 | 3300005581 | Freshwater Lentic | MKYITNITGEIKLPWEPGLLEWLQEQYPASKYRIVESI* |
| Ga0049081_103297473 | 3300005581 | Freshwater Lentic | ITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0049080_100160444 | 3300005582 | Freshwater Lentic | MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0049082_100235372 | 3300005584 | Freshwater Lentic | MTIITNITGKIKLPWEPGLLEWLQEQYPASQYRVVELT* |
| Ga0049084_102913103 | 3300005585 | Freshwater Lentic | MIYITNITGEIKLPWEPGLLEWLQEQYPASKYRVVELT* |
| Ga0078894_115385442 | 3300005662 | Freshwater Lake | MKIIVNKAGDIQLPWEPGLLAWLQERYPASKYQEVIL* |
| Ga0079957_11437841 | 3300005805 | Lake | MMIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVKLTRGKQNE* |
| Ga0075109_12281042 | 3300005912 | Saline Lake | MIYIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA* |
| Ga0075108_100152238 | 3300005913 | Saline Lake | MKYYIANKSGTINLPWEPGLVEWLQEKYPASQYRVVEAV* |
| Ga0075119_10565383 | 3300005931 | Saline Lake | YIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA* |
| Ga0007876_100019728 | 3300006071 | Freshwater | MYITNCTGEIRLPNEPGLLEWLQENYPYSKYRLVNV* |
| Ga0007876_10137405 | 3300006071 | Freshwater | MYITERTGTIRLPAEPGLLEWLQSQYPYSKYRLVQE* |
| Ga0007876_11070923 | 3300006071 | Freshwater | MYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELF* |
| Ga0007806_10052099 | 3300006100 | Freshwater | MYITNRTGEIRLPNEPGLLAWLQDTYPYSQYHIVNDE* |
| Ga0007805_10270353 | 3300006127 | Freshwater | MKFILNKAGNIKLPYEPGLLEWLQEKYPASQYRIIYD* |
| Ga0105050_1000013655 | 3300007516 | Freshwater | MKYITNKSGTINLPWEPGLLEWLRENYPASDYRIVGIEYEYV* |
| Ga0105050_100255201 | 3300007516 | Freshwater | MKYYIANKSGTINLPWEPGLVEWLQERYPASQYRVVEVA* |
| Ga0114340_12707391 | 3300008107 | Freshwater, Plankton | MYITNITGEIKLPWEPGLLEWLQENYPASKYRVLELT* |
| Ga0114343_10069828 | 3300008110 | Freshwater, Plankton | MNYIRNRAGTVVLPEEPGLLEWLQTQYPFSQYYVVEVSNGM* |
| Ga0114364_100164311 | 3300008267 | Freshwater, Plankton | MIYITNRDGSIKLPWEPDLLEWLQQQYPYSQYRLAELDKNTQ* |
| Ga0114364_100188325 | 3300008267 | Freshwater, Plankton | MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNTQ* |
| Ga0114364_11761371 | 3300008267 | Freshwater, Plankton | MIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT* |
| Ga0114973_1000318612 | 3300009068 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQEHYPASQYKVVELT* |
| Ga0114973_106642251 | 3300009068 | Freshwater Lake | MSIKYITNKSKTVNLPWEPGLLEWLNEHYPYSKYYEVELK* |
| Ga0114962_100074876 | 3300009151 | Freshwater Lake | MRVIVNKAGNIRLPWEPGLLEWLQEQYPYSQYRIVESTR* |
| Ga0114962_101004033 | 3300009151 | Freshwater Lake | MMYITNITGEIKLPWEPGLLEWLHENYPASKYKVVELT* |
| Ga0114968_1000611614 | 3300009155 | Freshwater Lake | MKIIVNKFNTIQLPWEPGLLEWLNEHYPYSKYYEVELT* |
| Ga0114968_1000673112 | 3300009155 | Freshwater Lake | MIIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI* |
| Ga0114968_100150129 | 3300009155 | Freshwater Lake | MYITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT* |
| Ga0114977_100461882 | 3300009158 | Freshwater Lake | MYITNRTGEINLPWEPGLLEWLQEHYPASRYRVVELT* |
| Ga0114977_100597673 | 3300009158 | Freshwater Lake | MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVIL* |
| Ga0114977_101333112 | 3300009158 | Freshwater Lake | MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVTL* |
| Ga0114978_10000005116 | 3300009159 | Freshwater Lake | MKYITNITGEIKLPWEPGLLEWLQEQYPYSKYRVVEEHQDEEISQLVG* |
| Ga0114978_100006925 | 3300009159 | Freshwater Lake | MIYITNCDGSINLPWEPDLLEWLQTQYPYSKYRIVETS* |
| Ga0114978_100022444 | 3300009159 | Freshwater Lake | MIYITNITGEIQLPWEPGLLEWLHENYPASKYYIKEI* |
| Ga0114978_1000388319 | 3300009159 | Freshwater Lake | MIYITNRDGSINLPWEPDLLEWLQEHYPYSQYRLAQTS* |
| Ga0114978_100327865 | 3300009159 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0114978_107537222 | 3300009159 | Freshwater Lake | MKYITNITGEIKLPWEPGLLEWLQEKYPASKYHIVEII* |
| Ga0114966_100530412 | 3300009161 | Freshwater Lake | MTIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI* |
| Ga0114970_100042912 | 3300009163 | Freshwater Lake | MYITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0114970_100339492 | 3300009163 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQENYPASKYRVVELT* |
| Ga0114970_100992145 | 3300009163 | Freshwater Lake | MKIISSYDGSINLPWEPGLLEWLHVHYPYSKYRIVEVEHEV* |
| Ga0114975_100834974 | 3300009164 | Freshwater Lake | MRIITNRSGDIQFPWEPGLLEWLQERYPASKYQEVTL* |
| Ga0114975_102177421 | 3300009164 | Freshwater Lake | KMTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT* |
| Ga0114975_102594732 | 3300009164 | Freshwater Lake | MRIITNQSRDIQLPWEPGLLEWLQERYPASKYQEIIV* |
| Ga0114974_100012088 | 3300009183 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT* |
| Ga0114974_100331617 | 3300009183 | Freshwater Lake | MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT* |
| Ga0114982_11564073 | 3300009419 | Deep Subsurface | MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVMV* |
| Ga0114967_103000673 | 3300010160 | Freshwater Lake | MRIITNRSGDIQFLWEPGLLEWLQERYPASKYQEVIL* |
| Ga0136644_103435842 | 3300010334 | Freshwater Lake | MIRYIINKAGNIKVPWEPGLLEWLQERYPYSQYTIIETIK* |
| Ga0133913_100831814 | 3300010885 | Freshwater Lake | MYITNRTGDITLPWEPGLLEWLQEQYPYSKYKVVETLAF* |
| Ga0133913_102359338 | 3300010885 | Freshwater Lake | MIIISDRTGNIQLPAEPGLLEWLQEHYPYSQYYLTTK* |
| Ga0133913_114747156 | 3300010885 | Freshwater Lake | KRYIRNHTGEIRLPWEPGLLEWLQEQYPVSQYRVVELT* |
| Ga0157142_10017842 | 3300012347 | Freshwater | MIVISNKTGDIQLPYQEGLLEWLQEHYPASKYYLVELA* |
| Ga0157138_10041013 | 3300012352 | Freshwater | MYITNKFDSIRLPVEPGLLEWLQETYPKSEYRVVEV* |
| Ga0157203_100001837 | 3300012663 | Freshwater | MKYITNKYDSIRLPVEPGLLEWLQENYPASKYHEVEL* |
| Ga0157497_10000618 | 3300012664 | Freshwater | MIVISNKAGDIQLPQQEGLLEWLQERYPASKYHLVELA* |
| Ga0157497_10011058 | 3300012664 | Freshwater | MIIITNKTGDIQLPNQEGLLEWLQERYPASKYHLVELA* |
| Ga0157210_10047454 | 3300012665 | Freshwater | MFKYITNKYGSVKFPVEPGLLEWLLEQYPHSEYRIVEIA* |
| Ga0157208_100062143 | 3300012667 | Freshwater | MIIISNKTGEIQLPYQEGLLEWLQERYPASKYHLVELA* |
| Ga0164293_100076876 | 3300013004 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQENYPASQYRVVELT* |
| Ga0164293_100140926 | 3300013004 | Freshwater | MTIITNITGEIQLPWEPGLLEWLQEHYPASQYRVVELT* |
| Ga0164293_100190649 | 3300013004 | Freshwater | MMYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEI* |
| Ga0164293_100569262 | 3300013004 | Freshwater | MIYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT* |
| Ga0164293_100962422 | 3300013004 | Freshwater | MRIITNQAGDIQLPWEPGLLEWLQERYPASKYQEITL* |
| Ga0164293_102970472 | 3300013004 | Freshwater | MIYITNCDGSINLPWEPDLLEWLQEHYPYSKYRLAETS* |
| Ga0164292_100654006 | 3300013005 | Freshwater | MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELT* |
| Ga0164292_102087643 | 3300013005 | Freshwater | MTIITNRTGEINLPWEPGLLEWLQEHYPASKYRVVELT* |
| Ga0164294_1000356413 | 3300013006 | Freshwater | MIYITNRDGTINLPWEPDLLEWLQTQYPYSKYRIVETS* |
| Ga0164296_10340845 | 3300013093 | Freshwater | MYITNRTGDIRLPNEPGLLEWLQDTYPYSQYHIVNDE* |
| (restricted) Ga0172373_1000071534 | 3300013131 | Freshwater | MIITNRTGKIRLPWEPGLLEWLQEHYPASQYRVVELT* |
| Ga0177922_105471795 | 3300013372 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT* |
| Ga0181347_10176323 | 3300017722 | Freshwater Lake | MYITNITGEIKLPWEPGLLEWLQENYPASKYRVLELT |
| Ga0181347_10338862 | 3300017722 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRIVENTNT |
| Ga0181365_11427401 | 3300017736 | Freshwater Lake | GVCTEMTIITNITGEIKLPWESGLLEWLQEQYPASQYRVVELT |
| Ga0181344_10131935 | 3300017754 | Freshwater Lake | MIVISNKAGDIQLPQQEGLLEWLQERYPASKYHLVELA |
| Ga0181358_11865183 | 3300017774 | Freshwater Lake | MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNT |
| Ga0181357_10742722 | 3300017777 | Freshwater Lake | MYITNRTGEINLPWEPGLLEWLQENYPASQYKIVENTNT |
| Ga0181357_12220081 | 3300017777 | Freshwater Lake | IITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0181349_10382084 | 3300017778 | Freshwater Lake | MIIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI |
| Ga0181359_100019518 | 3300019784 | Freshwater Lake | MIIITNITGEIQFHWEPGLLEWLQEHYPASQYRVVELT |
| Ga0181359_10083373 | 3300019784 | Freshwater Lake | MTIITNITGEIKLPWESGLLEWLQEQYPASQYRVVELT |
| Ga0181359_10117313 | 3300019784 | Freshwater Lake | MTIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0181359_11057223 | 3300019784 | Freshwater Lake | MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNTQ |
| Ga0211732_16095282 | 3300020141 | Freshwater | MYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0211736_103386503 | 3300020151 | Freshwater | MTIITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0211734_108685942 | 3300020159 | Freshwater | MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELS |
| Ga0211733_103857491 | 3300020160 | Freshwater | ITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0211733_104040962 | 3300020160 | Freshwater | MYITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0211733_1044588210 | 3300020160 | Freshwater | MKYITNITGEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIFQLVR |
| Ga0211733_111187412 | 3300020160 | Freshwater | MKYITNITGEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIS |
| Ga0211733_112162322 | 3300020160 | Freshwater | MIYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT |
| Ga0211726_101909401 | 3300020161 | Freshwater | MIYITNRDGSIKLPWEPDLLEWLQEHYPYSQYQLAETS |
| Ga0211726_103839469 | 3300020161 | Freshwater | MIIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0211726_106548491 | 3300020161 | Freshwater | MMYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0211726_108848097 | 3300020161 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0211726_109364062 | 3300020161 | Freshwater | MMYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEQ |
| Ga0211729_109111712 | 3300020172 | Freshwater | MIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0208050_10066952 | 3300020498 | Freshwater | MYITNRTGKIKLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0208852_10190904 | 3300020560 | Freshwater | MKYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVERFQDEKVS |
| Ga0214219_10187165 | 3300020735 | Freshwater | KMYITNRTGEIRLPNEPGLLAWLQDTYPYSQYHIVNDE |
| Ga0213922_10141217 | 3300021956 | Freshwater | MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVTI |
| Ga0181351_10056743 | 3300022407 | Freshwater Lake | MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT |
| Ga0181351_11587891 | 3300022407 | Freshwater Lake | CTKMIIITNITGEIQFHWEPGLLEWLQEHYPASQYRVVELT |
| Ga0214921_100215112 | 3300023174 | Freshwater | MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0214921_101464742 | 3300023174 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT |
| Ga0214919_10000005152 | 3300023184 | Freshwater | MIIITNYTRDIQLPYEEGLLEWLQQQYPASKYQLVELE |
| Ga0214919_1000094161 | 3300023184 | Freshwater | MIIITNITGDIRLPWEPGLLEWLQEQYPASQYRVVELT |
| Ga0208504_10040881 | 3300025358 | Freshwater | MYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELF |
| Ga0208382_10312053 | 3300025369 | Freshwater | MSIITNKYGNIRLPNEPGLLEWLNEHYPYSEYHVV |
| Ga0208738_10075005 | 3300025379 | Freshwater | MKFILNKAGNIKLPYEPGLLEWLQEKYPASQYRIIYD |
| Ga0208250_100019621 | 3300025383 | Freshwater | MYITNCTGEIRLPNEPGLLEWLQENYPYSKYRLVNV |
| Ga0208380_100320910 | 3300025392 | Freshwater | MYITERTGTIRLPAEPGLLEWLQSQYPYSKYRLVQE |
| Ga0208260_10576781 | 3300025467 | Freshwater | FYXGGDNMYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELFXNK |
| Ga0208903_10127323 | 3300025502 | Saline Lake | MIYIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA |
| Ga0207954_10710362 | 3300025606 | Freshwater | MTIITNITGEIQLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0208741_100038436 | 3300025723 | Freshwater | MYITESTNSIKLPYEPGLLEWLQEHYPFSKYRLVNL |
| Ga0209188_10100885 | 3300027708 | Freshwater Lake | MRVIVNKAGNIRLPWEPGLLEWLQEQYPYSQYRIVESTR |
| Ga0209599_102108982 | 3300027710 | Deep Subsurface | MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVMV |
| Ga0209617_100863853 | 3300027720 | Freshwater And Sediment | MYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT |
| (restricted) Ga0247836_10506592 | 3300027728 | Freshwater | MIIITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVELKNVGS |
| (restricted) Ga0247836_10623883 | 3300027728 | Freshwater | MMHITNITGEIKLPWEPGLLEWLQEHYPASQYRVAELT |
| Ga0209297_100679412 | 3300027733 | Freshwater Lake | MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVIL |
| Ga0209087_100135923 | 3300027734 | Freshwater Lake | MYITNRTGEINLPWEPGLLEWLQEHYPASRYRVVELT |
| Ga0209190_10166203 | 3300027736 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQENYPASKYRVVELT |
| Ga0209596_100406311 | 3300027754 | Freshwater Lake | MYITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT |
| Ga0209296_10528542 | 3300027759 | Freshwater Lake | MIYITNITGEIQLPWEPGLLEWLHENYPASKYYIKEI |
| Ga0209088_100107526 | 3300027763 | Freshwater Lake | MKYITNITGEIKLPWEPGLLEWLQEQYPYSKYRVVEEHQDEEISQLVG |
| Ga0209500_1000445912 | 3300027782 | Freshwater Lake | MIYITNCDGSINLPWEPDLLEWLQTQYPYSKYRIVETS |
| Ga0209500_100102104 | 3300027782 | Freshwater Lake | MIYITNRDGSINLPWEPDLLEWLQEHYPYSQYRLAQTS |
| Ga0209500_102539262 | 3300027782 | Freshwater Lake | MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVTL |
| Ga0209400_10290026 | 3300027963 | Freshwater Lake | MKIIVNKFNTIQLPWEPGLLEWLNEHYPYSKYYEVELT |
| Ga0209191_100038739 | 3300027969 | Freshwater Lake | MRIITNRTGDIQLPWEPGLLEWLQERYPASKYQEVTL |
| Ga0209401_10050062 | 3300027971 | Freshwater Lake | MTIITNITGEIRLPWEPGLLEWLQEHYPASQYKVVELT |
| Ga0209401_11184403 | 3300027971 | Freshwater Lake | MTVISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI |
| (restricted) Ga0247834_11707472 | 3300027977 | Freshwater | MIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT |
| (restricted) Ga0247834_12413791 | 3300027977 | Freshwater | MYITNITGEIRLPWEPGLLEWLQEHYPASKYRIVELT |
| (restricted) Ga0247844_102472110 | 3300028571 | Freshwater | ITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVELKNVGS |
| Ga0315909_100619524 | 3300031857 | Freshwater | MTIITNCTGEINLPWEPGLLEWLQEHYPASKYRVIELT |
| Ga0315909_102410883 | 3300031857 | Freshwater | MMIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0315909_108951712 | 3300031857 | Freshwater | MKIIVNKAGDIQLPWEPGLLAWLQERYPASKYQEVIL |
| Ga0315905_101054201 | 3300032092 | Freshwater | MIIITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVDLQKVKQ |
| Ga0334994_0372737_31_147 | 3300033993 | Freshwater | MMYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT |
| Ga0334979_0283779_44_154 | 3300033996 | Freshwater | MYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEI |
| Ga0334991_0038932_52_168 | 3300034013 | Freshwater | MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELT |
| Ga0334995_0054350_1604_1720 | 3300034062 | Freshwater | MMYITNITGEIKLPWEPGLLEWLHENYPASKYRVVELT |
| Ga0335019_0001730_9982_10098 | 3300034066 | Freshwater | MTIITNITGEIQLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0335020_0076439_1360_1473 | 3300034082 | Freshwater | MRIITNQAGDIQLPWEPGLLEWLQERYPASKYQEITL |
| Ga0335020_0099340_479_601 | 3300034082 | Freshwater | MMYITNITGEIKLPWEPGLLEWLHENYPASKYRIVENTNT |
| Ga0335012_0026630_2502_2615 | 3300034093 | Freshwater | MKYITNRNGSIKLPWEPGLVEWLQKRYPLSQYQVVEK |
| Ga0335012_0042888_1273_1389 | 3300034093 | Freshwater | MTIITNITGEINLPWEPGLLEWLQEHYPASKYRVVELT |
| Ga0335029_0019285_136_252 | 3300034102 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELN |
| Ga0335029_0098754_143_289 | 3300034102 | Freshwater | MKYITNITGEIKLPWEPGLLEWLQERYPASKYHTVEEYQDEEISQLVG |
| Ga0335029_0493555_574_708 | 3300034102 | Freshwater | MKYITNITEEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIS |
| Ga0335029_0557098_169_303 | 3300034102 | Freshwater | MKYITNITEEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEKIS |
| Ga0335049_0178520_866_994 | 3300034272 | Freshwater | MIYITNRDGTINLPWEPDLLEWLQERYPYSQYRLAELDKNTQ |
| Ga0335007_0240286_328_441 | 3300034283 | Freshwater | MIITNRTGEINLPWEPGLLEWLQEHYPASQYRVVELT |
| Ga0335013_0132355_778_894 | 3300034284 | Freshwater | MTIITNITGEIKLPWEPGLLEWLQENYPASQYRVVELT |
| ⦗Top⦘ |