


| Basic Information | |
|---|---|
| Family ID | F037907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RELWPSIAALLLFAAILIPLSFLVFAWALRRTKVTGTLTHI |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.20 % |
| % of genes near scaffold ends (potentially truncated) | 94.61 % |
| % of genes from short scaffolds (< 2000 bps) | 88.02 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.868 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.569 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.551 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01041 | DegT_DnrJ_EryC1 | 14.37 |
| PF07589 | PEP-CTERM | 7.78 |
| PF13432 | TPR_16 | 7.19 |
| PF13414 | TPR_11 | 5.99 |
| PF13424 | TPR_12 | 4.79 |
| PF13620 | CarboxypepD_reg | 4.19 |
| PF08123 | DOT1 | 4.19 |
| PF00535 | Glycos_transf_2 | 3.59 |
| PF02698 | DUF218 | 2.99 |
| PF07238 | PilZ | 2.40 |
| PF02604 | PhdYeFM_antitox | 1.80 |
| PF06508 | QueC | 1.80 |
| PF04055 | Radical_SAM | 1.20 |
| PF07857 | TMEM144 | 1.20 |
| PF00069 | Pkinase | 1.20 |
| PF00294 | PfkB | 0.60 |
| PF17191 | RecG_wedge | 0.60 |
| PF13345 | Obsolete Pfam Family | 0.60 |
| PF00400 | WD40 | 0.60 |
| PF00282 | Pyridoxal_deC | 0.60 |
| PF05598 | DUF772 | 0.60 |
| PF13307 | Helicase_C_2 | 0.60 |
| PF13701 | DDE_Tnp_1_4 | 0.60 |
| PF02666 | PS_Dcarbxylase | 0.60 |
| PF01135 | PCMT | 0.60 |
| PF02321 | OEP | 0.60 |
| PF05231 | MASE1 | 0.60 |
| PF07690 | MFS_1 | 0.60 |
| PF01370 | Epimerase | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 14.37 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 14.37 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 14.37 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 14.37 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 14.37 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 14.37 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.79 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 2.99 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 2.99 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.80 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.80 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.80 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.80 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.80 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.80 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.60 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.60 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.60 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.60 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.60 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.60 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.66 % |
| Unclassified | root | N/A | 32.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1004625 | Not Available | 1063 | Open in IMG/M |
| 3300001648|JGI20242J16303_101399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100879755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10314398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300004009|Ga0055437_10227531 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004019|Ga0055439_10086577 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300004080|Ga0062385_10197316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1083 | Open in IMG/M |
| 3300004082|Ga0062384_100372216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300004082|Ga0062384_100723889 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300004082|Ga0062384_100726280 | Not Available | 687 | Open in IMG/M |
| 3300004091|Ga0062387_101171654 | Not Available | 600 | Open in IMG/M |
| 3300004091|Ga0062387_101231550 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004092|Ga0062389_102200421 | Not Available | 725 | Open in IMG/M |
| 3300004092|Ga0062389_102541169 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300004635|Ga0062388_100884952 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005216|Ga0068994_10007005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1977 | Open in IMG/M |
| 3300005533|Ga0070734_10164602 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300005538|Ga0070731_10199342 | Not Available | 1329 | Open in IMG/M |
| 3300005538|Ga0070731_10233210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300005538|Ga0070731_10833580 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005591|Ga0070761_10000500 | All Organisms → cellular organisms → Bacteria | 25250 | Open in IMG/M |
| 3300005591|Ga0070761_10158576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300005591|Ga0070761_10461914 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005602|Ga0070762_10138148 | Not Available | 1448 | Open in IMG/M |
| 3300005602|Ga0070762_11233889 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005610|Ga0070763_10420257 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005842|Ga0068858_100023598 | All Organisms → cellular organisms → Bacteria | 5731 | Open in IMG/M |
| 3300006059|Ga0075017_101025280 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006059|Ga0075017_101606714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300006102|Ga0075015_100535555 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006172|Ga0075018_10398936 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006174|Ga0075014_100213979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300006176|Ga0070765_101946178 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006354|Ga0075021_11187291 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006797|Ga0066659_11023373 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006871|Ga0075434_101332556 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300006881|Ga0068865_101334667 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300007255|Ga0099791_10614771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300009012|Ga0066710_100000039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 47276 | Open in IMG/M |
| 3300009089|Ga0099828_10153014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Ryanbacteria → Candidatus Ryanbacteria bacterium RIFCSPHIGHO2_01_45_13 | 2039 | Open in IMG/M |
| 3300009089|Ga0099828_11679646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300009143|Ga0099792_11026956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009623|Ga0116133_1063220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 921 | Open in IMG/M |
| 3300010379|Ga0136449_104016391 | Not Available | 549 | Open in IMG/M |
| 3300010379|Ga0136449_104414605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300011120|Ga0150983_10206808 | Not Available | 655 | Open in IMG/M |
| 3300011120|Ga0150983_11214815 | Not Available | 717 | Open in IMG/M |
| 3300011271|Ga0137393_10804456 | Not Available | 803 | Open in IMG/M |
| 3300012096|Ga0137389_11168452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300012203|Ga0137399_11744189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300012469|Ga0150984_111249216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300012917|Ga0137395_11240419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012922|Ga0137394_10713885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300012922|Ga0137394_10730427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300012924|Ga0137413_10746213 | Not Available | 747 | Open in IMG/M |
| 3300012925|Ga0137419_10500121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300012931|Ga0153915_12894782 | Not Available | 560 | Open in IMG/M |
| 3300012961|Ga0164302_10246737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300012971|Ga0126369_11573542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300013296|Ga0157374_10178391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2074 | Open in IMG/M |
| 3300013296|Ga0157374_12133454 | Not Available | 587 | Open in IMG/M |
| 3300014158|Ga0181521_10092314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1885 | Open in IMG/M |
| 3300014161|Ga0181529_10415758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 725 | Open in IMG/M |
| 3300014165|Ga0181523_10426134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300014501|Ga0182024_11758264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300014638|Ga0181536_10220346 | Not Available | 929 | Open in IMG/M |
| 3300014638|Ga0181536_10357245 | Not Available | 663 | Open in IMG/M |
| 3300015264|Ga0137403_10253122 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300015371|Ga0132258_13809171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300017925|Ga0187856_1237898 | Not Available | 646 | Open in IMG/M |
| 3300017928|Ga0187806_1166577 | Not Available | 734 | Open in IMG/M |
| 3300017933|Ga0187801_10496657 | Not Available | 515 | Open in IMG/M |
| 3300017935|Ga0187848_10486752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300017942|Ga0187808_10240723 | Not Available | 808 | Open in IMG/M |
| 3300017966|Ga0187776_11257984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 557 | Open in IMG/M |
| 3300017970|Ga0187783_10626599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300017973|Ga0187780_10285943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300017996|Ga0187891_1311350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300018020|Ga0187861_10048318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2237 | Open in IMG/M |
| 3300018025|Ga0187885_10279933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300018079|Ga0184627_10609932 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix harundinacea | 547 | Open in IMG/M |
| 3300018082|Ga0184639_10098717 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300018085|Ga0187772_11432525 | Not Available | 513 | Open in IMG/M |
| 3300018086|Ga0187769_10569282 | Not Available | 856 | Open in IMG/M |
| 3300019284|Ga0187797_1504480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300020001|Ga0193731_1061139 | Not Available | 988 | Open in IMG/M |
| 3300020002|Ga0193730_1098453 | Not Available | 816 | Open in IMG/M |
| 3300020579|Ga0210407_10745759 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300020579|Ga0210407_11166328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300020581|Ga0210399_10060047 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300020581|Ga0210399_10824959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300021168|Ga0210406_10357149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300021171|Ga0210405_11223751 | Not Available | 555 | Open in IMG/M |
| 3300021178|Ga0210408_10509356 | Not Available | 956 | Open in IMG/M |
| 3300021181|Ga0210388_10304342 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300021401|Ga0210393_11205035 | Not Available | 609 | Open in IMG/M |
| 3300021402|Ga0210385_10303671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300021406|Ga0210386_11822885 | Not Available | 500 | Open in IMG/M |
| 3300021420|Ga0210394_10836894 | Not Available | 803 | Open in IMG/M |
| 3300021420|Ga0210394_11332919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300021432|Ga0210384_10073165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3084 | Open in IMG/M |
| 3300021433|Ga0210391_11530016 | Not Available | 511 | Open in IMG/M |
| 3300021476|Ga0187846_10361570 | Not Available | 598 | Open in IMG/M |
| 3300021477|Ga0210398_10220779 | Not Available | 1544 | Open in IMG/M |
| 3300022505|Ga0242647_1010212 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300022510|Ga0242652_1052920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300022532|Ga0242655_10270951 | Not Available | 544 | Open in IMG/M |
| 3300022716|Ga0242673_1031397 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300022721|Ga0242666_1057564 | Not Available | 832 | Open in IMG/M |
| 3300024227|Ga0228598_1003520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3367 | Open in IMG/M |
| 3300025164|Ga0209521_10167949 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 1342 | Open in IMG/M |
| 3300025318|Ga0209519_10150972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300025453|Ga0208455_1053695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300025900|Ga0207710_10401425 | Not Available | 703 | Open in IMG/M |
| 3300025914|Ga0207671_10428472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300025930|Ga0207701_10294213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
| 3300025943|Ga0210125_1011646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
| 3300026499|Ga0257181_1076752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300026871|Ga0207825_114407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300027497|Ga0208199_1025672 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300027648|Ga0209420_1157756 | Not Available | 619 | Open in IMG/M |
| 3300027648|Ga0209420_1199750 | Not Available | 531 | Open in IMG/M |
| 3300027655|Ga0209388_1068368 | Not Available | 1024 | Open in IMG/M |
| 3300027676|Ga0209333_1144566 | Not Available | 640 | Open in IMG/M |
| 3300027692|Ga0209530_1112577 | Not Available | 771 | Open in IMG/M |
| 3300027701|Ga0209447_10207922 | Not Available | 534 | Open in IMG/M |
| 3300027767|Ga0209655_10001272 | All Organisms → cellular organisms → Bacteria | 9382 | Open in IMG/M |
| 3300027795|Ga0209139_10236236 | Not Available | 646 | Open in IMG/M |
| 3300027854|Ga0209517_10079091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. M18 | 2294 | Open in IMG/M |
| 3300027855|Ga0209693_10082662 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300027895|Ga0209624_10174199 | Not Available | 1427 | Open in IMG/M |
| 3300027898|Ga0209067_10815957 | Not Available | 545 | Open in IMG/M |
| 3300027908|Ga0209006_11170466 | Not Available | 603 | Open in IMG/M |
| 3300027910|Ga0209583_10361067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300027910|Ga0209583_10612820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10027267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300028047|Ga0209526_10993182 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix harundinacea | 502 | Open in IMG/M |
| 3300028746|Ga0302233_10003876 | All Organisms → cellular organisms → Bacteria | 8588 | Open in IMG/M |
| 3300028746|Ga0302233_10376883 | Not Available | 537 | Open in IMG/M |
| 3300028801|Ga0302226_10338384 | Not Available | 632 | Open in IMG/M |
| 3300028808|Ga0302228_10025577 | All Organisms → cellular organisms → Bacteria | 2996 | Open in IMG/M |
| 3300028906|Ga0308309_10601122 | Not Available | 955 | Open in IMG/M |
| 3300030646|Ga0302316_10027658 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300030707|Ga0310038_10460799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300030739|Ga0302311_10672142 | Not Available | 688 | Open in IMG/M |
| 3300030967|Ga0075399_10953361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031028|Ga0302180_10072769 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300031234|Ga0302325_12903279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031236|Ga0302324_101215893 | Not Available | 1002 | Open in IMG/M |
| 3300031241|Ga0265325_10130696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300031576|Ga0247727_10056059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4709 | Open in IMG/M |
| 3300031708|Ga0310686_103954443 | Not Available | 990 | Open in IMG/M |
| 3300031708|Ga0310686_107478413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300031718|Ga0307474_11581602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031720|Ga0307469_11478016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031820|Ga0307473_10314882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300031820|Ga0307473_11239534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031837|Ga0302315_10021794 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
| 3300031897|Ga0318520_10341936 | Not Available | 907 | Open in IMG/M |
| 3300031947|Ga0310909_10697943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300031965|Ga0326597_11328364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031965|Ga0326597_11422673 | Not Available | 670 | Open in IMG/M |
| 3300032035|Ga0310911_10247169 | Not Available | 1021 | Open in IMG/M |
| 3300032897|Ga0335071_10113923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2650 | Open in IMG/M |
| 3300032955|Ga0335076_10014729 | All Organisms → cellular organisms → Bacteria | 7856 | Open in IMG/M |
| 3300033513|Ga0316628_102165519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.39% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.19% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.99% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.60% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.60% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005216 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025943 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026871 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10046251 | 3300001082 | Forest Soil | RAALLGGAGWRELWPSIAALLLFAAILIPVSFLIFAWALRRTKVTGTLTHI* |
| JGI20242J16303_1013991 | 3300001648 | Forest Soil | GWNQLWPSIAALLVFAAILIPSWFIVFAWSLRRTKITGTLTHI* |
| JGIcombinedJ26739_1008797551 | 3300002245 | Forest Soil | SFAQLWPAVRALLLFAVILLPLSSLIFAWALRRTKITGTLTHL* |
| JGIcombinedJ51221_103143982 | 3300003505 | Forest Soil | TLLAGTGWNQLWPSIAALLVFAAILIPSWFIVFAWSLRRTKITGTLTHI* |
| Ga0055437_102275312 | 3300004009 | Natural And Restored Wetlands | TLWPVLRALILFAVVLLPFSLAVFSWALRRTKVTGTLTHF* |
| Ga0055439_100865771 | 3300004019 | Natural And Restored Wetlands | TLWPVLRALIIFAVVLLPVSLAVFAWALRRTKVTGTLTHF* |
| Ga0062385_101973161 | 3300004080 | Bog Forest Soil | EGMRAALLAGAGWRELWPSIAALLLFAAILIPLSFLVFAWALRRTKVTGTLTHI* |
| Ga0062384_1003722162 | 3300004082 | Bog Forest Soil | MPAALLAGAGWRELWPSIAALLLFAAILIPLSFLVFAWALRRTKITGTLTHI* |
| Ga0062384_1007238892 | 3300004082 | Bog Forest Soil | LLPSFLTLLLFAAILIPLSFAVFSWTLRRTKVTGTLTHI* |
| Ga0062384_1007262802 | 3300004082 | Bog Forest Soil | AGAGWRELWPSIAALLLFAAILIPLSFLIFAWALRRTKITGTLTHI* |
| Ga0062387_1011716541 | 3300004091 | Bog Forest Soil | LDGAGWRDLWPSIAALLLFAAILIPLSFLIFAWALRRTKVTGTLTHI* |
| Ga0062387_1012315502 | 3300004091 | Bog Forest Soil | TYSLDGMRAALLAGAGWSQLRESLAALLAFAAVLIPLSFAVFGWALRRTKITGTLTHI* |
| Ga0062389_1022004211 | 3300004092 | Bog Forest Soil | RELWPSIAALLLFAAILIPLSFLVFAWALRRTKVTGTLTHI* |
| Ga0062389_1025411691 | 3300004092 | Bog Forest Soil | ELLPSFLTLLLFAAILIPLSFAVFSWALRRTKVTGTLTHI* |
| Ga0062388_1008849521 | 3300004635 | Bog Forest Soil | AALLGGAGWRELWPSLAALLVFAAILIPLSFLVFAWALRRTKITGTLTHI* |
| Ga0068994_100070053 | 3300005216 | Natural And Restored Wetlands | GRLWPQIAALGLFAVVLLPLSFVVFAWALRRTKINGTLTHF* |
| Ga0070734_101646021 | 3300005533 | Surface Soil | GELWPAIRALLAFAVVLLPISFASFAWALRRTKITGTLTHF* |
| Ga0070731_101993423 | 3300005538 | Surface Soil | LPSIGALLIFAAVLIPLSFAVFAWALRRTKVTGTLTHI* |
| Ga0070731_102332101 | 3300005538 | Surface Soil | AALWPSLRALLLFAVVLLPASFATFAWALRRTKTTGTLTHF* |
| Ga0070731_108335801 | 3300005538 | Surface Soil | NASFLELWPSLAALLIFAVLLLPISFFVFSWALRRTKITGTLTHF* |
| Ga0070761_1000050016 | 3300005591 | Soil | MRAELLAGAGWRELWPSIAALLVFAAILIPLSFLVFAWALRRTKVTGTLTHI* |
| Ga0070761_101585762 | 3300005591 | Soil | LLVLLLFAAVLLPVSMAVFAWALRRTKTTGTLMHR* |
| Ga0070761_104619142 | 3300005591 | Soil | LEGMRAALLAGAGWNQLWPSIAALLIFAAILIPSSFVVFAWSLRRTKITGTLTHI* |
| Ga0070762_101381481 | 3300005602 | Soil | NRIGPSILALLAFAAILLPLSFSVFAWALNRTRVTGTLTHI* |
| Ga0070762_112338892 | 3300005602 | Soil | WPSIAALLIFAAILIPLSFLIFGWALRRTKVTGTLTHI* |
| Ga0070763_104202572 | 3300005610 | Soil | PIGALLIFAVILIPISFVVFSWALRRTKITGTLTHI* |
| Ga0068858_1000235981 | 3300005842 | Switchgrass Rhizosphere | RALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM* |
| Ga0075017_1010252802 | 3300006059 | Watersheds | AILILFAVVLLPVSMITFAWALRRTKITGTLTHS* |
| Ga0075017_1016067141 | 3300006059 | Watersheds | ILGHASLFELWPALAGLLAFAAVLIPISFAVFSWAIRRTKITGTLTHF* |
| Ga0075015_1005355551 | 3300006102 | Watersheds | PIAALLLFAALLLPISFSIFSWALRRTKITGTLTHF* |
| Ga0075018_103989362 | 3300006172 | Watersheds | QLWPAVRALLLFAVVLLPLSSLVFAWAMRRTKITGTLTHL* |
| Ga0075014_1002139792 | 3300006174 | Watersheds | WPSIRALAAFAIVLLPVSFAAFSWALRRTKINGTLSHY* |
| Ga0070765_1019461782 | 3300006176 | Soil | WPSVRALLLFAVILLPLSSAVFAWALRRTKITGTLSHL* |
| Ga0075021_111872912 | 3300006354 | Watersheds | LAGASFAQLWPAVRALLLFAVVLLPLSSLVFAWAMRRTKITGTLTHL* |
| Ga0066659_110233731 | 3300006797 | Soil | LAILLLFAAVLLPLSMSVFAWSLRRTKITGTLTHS* |
| Ga0075434_1013325562 | 3300006871 | Populus Rhizosphere | MRQALLGGASFVQLWPSVRALILFAAILLPLAGTIFAWALRQTKITGTLTHM* |
| Ga0068865_1013346672 | 3300006881 | Miscanthus Rhizosphere | WPAVRALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM* |
| Ga0099791_106147712 | 3300007255 | Vadose Zone Soil | WRPLAVLLLSALAVLPGSMAVFAWALRRTKITGTLTHR* |
| Ga0066710_1000000391 | 3300009012 | Grasslands Soil | ALWRPLATLLLFAAVLLPLSMSVFAWSLRRTKITGTLTHS |
| Ga0099828_101530142 | 3300009089 | Vadose Zone Soil | WPSLRALLLFAIVLLPLSFTVFSWALRRTKITGTLTHF* |
| Ga0099828_116796462 | 3300009089 | Vadose Zone Soil | ASFGELWPSLRALLLFAVVFLPVSFAAFAWALRRTKVTGTLTHF* |
| Ga0099792_110269562 | 3300009143 | Vadose Zone Soil | PLLLLLVFAAVLLPFSVLIFSWSLRRTKITGTLTHR* |
| Ga0116133_10632201 | 3300009623 | Peatland | GAGWRELWPSIAALLLFAAILIPLSFVVFAWALRRTKITGTLTHI* |
| Ga0136449_1040163912 | 3300010379 | Peatlands Soil | SIVALLVFAAILIPLSFAVFAWALRRTKITGTLTHI* |
| Ga0136449_1044146052 | 3300010379 | Peatlands Soil | LLLLLVFAAILLPASMAAFAWALRRTKTTGTLTHS* |
| Ga0150983_102068082 | 3300011120 | Forest Soil | VTYSLDGMRAALLAGVRWSQLLPSLAALLGFAAVLIPLSFAVFGWALRRTKITGTLTHI* |
| Ga0150983_112148152 | 3300011120 | Forest Soil | FVTLPAFAAVLIPLSLVVFGSALRRTRITGTLTHTQ* |
| Ga0137393_108044562 | 3300011271 | Vadose Zone Soil | RDLWPSLAALLIFAAILLPVSFATFSWALRRTKITGTLTHF* |
| Ga0137389_111684521 | 3300012096 | Vadose Zone Soil | LAALLAFAAIILPVSVATFSWALRRTKITGTLTHF* |
| Ga0137399_117441892 | 3300012203 | Vadose Zone Soil | TLAAIWPPLTILLLFAAVLLPISMGVFAWALRRTKITGTLSHR* |
| Ga0150984_1112492161 | 3300012469 | Avena Fatua Rhizosphere | ENASVAVLWPTIRDLLLFALVLLPVSLAVFTWALRRTKVTGTLTHF* |
| Ga0137395_112404191 | 3300012917 | Vadose Zone Soil | LLGHAAVRDLWPSLAALLIFAAILLPVSFVAFSWALRRTKITGTLTHF* |
| Ga0137394_107138852 | 3300012922 | Vadose Zone Soil | RPLTVLLLSALVLLPSSMAVFAWALRRTKITGTLTHS* |
| Ga0137394_107304271 | 3300012922 | Vadose Zone Soil | RPLAVLLLSALAVLPGSMAVFAWALRRTKITGTLTHR* |
| Ga0137413_107462132 | 3300012924 | Vadose Zone Soil | LDGAGWNRIGPSILALIAFAAILLPLSFLIFAWALNRTRVTGTLTHI* |
| Ga0137419_105001212 | 3300012925 | Vadose Zone Soil | AVLLLSAVTLLPGSMAVFAWALRRTKITGTLTHS* |
| Ga0153915_128947821 | 3300012931 | Freshwater Wetlands | RAALLGGAGWRQLGPLLGALLGFAALLIPASFAVFAWALRRTKVTGTLTHM* |
| Ga0164302_102467373 | 3300012961 | Soil | TFAQLWPAVRALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM* |
| Ga0126369_115735422 | 3300012971 | Tropical Forest Soil | RLRQIAPAVAMLLLFALILLPASIWSFSWALRRTKITGTLSHR* |
| Ga0157374_101783913 | 3300013296 | Miscanthus Rhizosphere | LRQLWPTLAALLIFAVILLPISLVTFSWALRRTKITGTLTHF* |
| Ga0157374_121334542 | 3300013296 | Miscanthus Rhizosphere | SLWELFPSIAVLLLFAAILLPISFAIFSWALRRTKITGTLTHF* |
| Ga0181521_100923143 | 3300014158 | Bog | LALLAFAAVLLPISFFVFSWALRQTKITGTLTHF* |
| Ga0181529_104157582 | 3300014161 | Bog | ALLAGAGWRELWPSIAALLLFAAILIPLSFVVFAWALRRTKITGTLTHI* |
| Ga0181523_104261342 | 3300014165 | Bog | ALLGHAPMRELLPPLLALLAFAAVLLPISFLVFSWALRRTKITGTLTHF* |
| Ga0182024_117582641 | 3300014501 | Permafrost | ILGHASLRELLPSIAALLLFAAILLPVSFAVFSWALRRTKITGTLTHF* |
| Ga0181536_102203461 | 3300014638 | Bog | AQLWPSVRALLLFAVVLLPLSSLIFAWALRQTKITGTLTHF* |
| Ga0181536_103572451 | 3300014638 | Bog | AGFAQLWPSVRALLLFSVVVLPLSSVIFAWALRQTKITGTLTHF* |
| Ga0137403_102531221 | 3300015264 | Vadose Zone Soil | WPSVRALLLFAVVLLPLSSWIFAWALRQTKITGTLTHL* |
| Ga0132258_138091712 | 3300015371 | Arabidopsis Rhizosphere | ALLTGASFAQLWPAARALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM* |
| Ga0187856_12378982 | 3300017925 | Peatland | GAGFRELWPSIAALLIFAVVLLPLSFAVFAWAVRRTKITGTLTHL |
| Ga0187806_11665771 | 3300017928 | Freshwater Sediment | AALLSGAGWREIWPSVGALLIFAAILLPVSFGVFEWALRRTKITGTLTHI |
| Ga0187801_104966571 | 3300017933 | Freshwater Sediment | ALLSGAGWSELWRSVAALLIFAAILLPLSFAVFGWALRRTKITGTLTHI |
| Ga0187848_104867522 | 3300017935 | Peatland | GRPLLVLLLFGAALLPTSMVAFSWALRRTKITGTLTHS |
| Ga0187808_102407232 | 3300017942 | Freshwater Sediment | LWKSLVALLIFAAILIPASFAVFAWALRRTKVTGTLTHI |
| Ga0187776_112579841 | 3300017966 | Tropical Peatland | EGMRAALLEGAGWSGLWHPLVALLVFAAVLIPLSFAVFSWALRRTRITGTLTHI |
| Ga0187783_106265991 | 3300017970 | Tropical Peatland | LEGMRAALLEGAGWGELWRSIAALLVFAVVLIPLSFGVFAWALRRTKVTGTLTHI |
| Ga0187780_102859431 | 3300017973 | Tropical Peatland | ATWGKLWPSVVALLAFALILIPVSFLVFAWALRRTKVTGTLTHN |
| Ga0187891_13113502 | 3300017996 | Peatland | QELWPSLAALLVFAAILLPASFAIFFLALRRTKITGTLTHF |
| Ga0187861_100483185 | 3300018020 | Peatland | GAGFAQLWPSVRALLLFAVVLLPLSSVIFAWALRQTKITGTLTHL |
| Ga0187885_102799332 | 3300018025 | Peatland | ALLAGAGFAQLWPSVRALLLFSVVLLPLSSVIFTWALRQTKITGTLTHF |
| Ga0184627_106099321 | 3300018079 | Groundwater Sediment | ALLGGASLSELWPDLRALLLLAAVLLPLSFAAFSWALRRTKITGTLTHM |
| Ga0184639_100987172 | 3300018082 | Groundwater Sediment | FGELWPSLRALLLFAVVFLPVSFAAFAWALRRTKVTGTLTHF |
| Ga0187772_114325252 | 3300018085 | Tropical Peatland | AALLGGSGLRNLWPSIVALLAFAVVLIPASLAIFSWAVRRTKITGTLTHL |
| Ga0187769_105692822 | 3300018086 | Tropical Peatland | LEGMRAALLGGAGWGQLWPLLVALLAFAAVLIPMSFVVFTWALHRTKITGTLTHM |
| Ga0187797_15044802 | 3300019284 | Peatland | LGALAVFAAVLLPLSFAVFAWALRRTKITGTLTHF |
| Ga0193731_10611392 | 3300020001 | Soil | GGASFAQLWPSVRALLVFAAILLPLSSLTFAWALRQTKISGTLTHS |
| Ga0193730_10984531 | 3300020002 | Soil | EGMRQALLGGASFAQLWPSVRALLVFAAILLPLSSLTFAWALRQTKISGTLTHS |
| Ga0210407_107457591 | 3300020579 | Soil | GGAGWTELWPSFVALLIFAAVLIPASFLVFAWSLRRTKITGTLTHI |
| Ga0210407_111663281 | 3300020579 | Soil | LGVLLLFAAVLLPLSMAVFAWSLRRTKITGTLTHN |
| Ga0210399_100600471 | 3300020581 | Soil | RELLPSIGGLLLFAALLLPISFAIFSWALRRTKITGTLTHF |
| Ga0210399_108249592 | 3300020581 | Soil | AGASFAQLWPAVRALLLFAVILLPLSSLIFAWALRRTKITGTLTHL |
| Ga0210406_103571492 | 3300021168 | Soil | WPSLAALLIFAAILLPVSFATFSWALRRTKITGTLTHF |
| Ga0210405_112237512 | 3300021171 | Soil | MRQLLPSIAGLLLFAAILLPVSFAIFSWALRRTKITGTLTHF |
| Ga0210408_105093562 | 3300021178 | Soil | LAGAGWRELFPSIFALLVFAAVLIPLSFGVFGWALRRTKITGTLTHI |
| Ga0210388_103043423 | 3300021181 | Soil | LGGAGWRELWPSIAALLIFAAILIPLSFLIFGWALRRTKVTGTLTHI |
| Ga0210393_112050352 | 3300021401 | Soil | VTYSLDGMRAALLAGVRWSQLLPSLAALLGFAAVLIPLSFAVFGWALRRTKITGTLTHI |
| Ga0210385_103036711 | 3300021402 | Soil | ALLAGVRWSQLLPSLAALLGFAAVLIPLSFAVFGWALRRTKITGTLTHI |
| Ga0210386_118228851 | 3300021406 | Soil | RAALLAGAGWRELWPSIAALLLFAAILIPLSFVIFAWALRRTKITGTLTHI |
| Ga0210394_108368942 | 3300021420 | Soil | PLVVLVLFAAVLLPTSMAVFAWALRRTKTTGTLMHR |
| Ga0210394_113329191 | 3300021420 | Soil | LLLLLAFAAVLLPSSFLIFSWALRRTKITGTLTHR |
| Ga0210384_100731651 | 3300021432 | Soil | LWPAIRALLLFAIVLLPSSLAAFAWALRRTKVTGTLIHF |
| Ga0210391_115300162 | 3300021433 | Soil | GWRQLWPSIATLLIFAAILIPLSFLVFAWALRRTKVTGTLTHI |
| Ga0187846_103615702 | 3300021476 | Biofilm | WNEIWPSVGALLLFAAILLPVSFAVFAWALRRTKITGTLTHI |
| Ga0210398_102207791 | 3300021477 | Soil | VGAGWRELFPSIFALLVFAAVLIPLSFAVFAWALRRTKITGTLTHI |
| Ga0242647_10102122 | 3300022505 | Soil | WRELWPSIAALLIFAAILIPLSFLIFGWALRRTKVTGTLTHI |
| Ga0242652_10529201 | 3300022510 | Soil | LGVLLLFAAVLLPLSMAVFAWSLRRTKITGTLPHN |
| Ga0242655_102709512 | 3300022532 | Soil | DGAGWGRLWPPLAALLAFAAVLIPLSFAVFGWALRRTKITGTLTHI |
| Ga0242673_10313972 | 3300022716 | Soil | WPSIAALLIFAAILIPLSFLIFGWALRRTKVTGTLTHI |
| Ga0242666_10575642 | 3300022721 | Soil | LSIAALLIFAAILIPLSFLIFGWALRRTKVTGTLTHI |
| Ga0228598_10035202 | 3300024227 | Rhizosphere | MRAALLAGAGWRELWPSIAALLLFAAILIPLSFLVFAWALQHTKVTGTLTHI |
| Ga0209521_101679491 | 3300025164 | Soil | LLPTLRALLLFALVLLPLSLAVFSWALRRTKVTGTLTHF |
| Ga0209519_101509722 | 3300025318 | Soil | EGMRAALLGGAGFAELWPSLRALLVFAAVLLPLSFAAFSWALRRTKITGTLTHM |
| Ga0208455_10536951 | 3300025453 | Peatland | VRALLLFSVVLLPLSSVIFTWALRQTKITGTLTHF |
| Ga0207710_104014252 | 3300025900 | Switchgrass Rhizosphere | MEGMRAAILGHASLWELFPSIAVLLLFAAILLPISFAIFSWALRRTKITGTLTHF |
| Ga0207671_104284721 | 3300025914 | Corn Rhizosphere | GGSFAQLWPAVRALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM |
| Ga0207701_102942133 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GASFAQLWPAVRALLIFAVVLLPLSGVVFAWALRRTKITGTLTHM |
| Ga0210125_10116461 | 3300025943 | Natural And Restored Wetlands | GRLWPQIAALGLFAVVLLPLSFVVFAWALRRTKINGTLTHF |
| Ga0257181_10767522 | 3300026499 | Soil | SFAQLWPSVRALLLFAVILLPLSGLTFAWALRQTKITGTLTHL |
| Ga0207825_1144071 | 3300026871 | Tropical Forest Soil | LSILALFAVVLLPLSIGCFSWALRRTKITGTLSHR |
| Ga0208199_10256722 | 3300027497 | Peatlands Soil | IAVLLLFAALLLPASFAIFSWALRRTKITGTLTHF |
| Ga0209420_11577562 | 3300027648 | Forest Soil | AALLGGAGWRELWPSIAALLLFAAILIPLSFLVFAWALRRTKVTGTLTHI |
| Ga0209420_11997502 | 3300027648 | Forest Soil | KLWPPLVTLLGFATVLIPVSFLVFGWALRRTKITGTLTHI |
| Ga0209388_10683682 | 3300027655 | Vadose Zone Soil | LTVLLLSALVLLPSSMAVFAWALRRTKITGTLTHS |
| Ga0209333_11445661 | 3300027676 | Forest Soil | GAGWRELFPSIFALLVFAAVLIPLSFAVFSWALRRTKITGTLTHI |
| Ga0209530_11125772 | 3300027692 | Forest Soil | GWRELWPSIAALLLFAAILIPLSFLVFAWALRRTKVTGTLTHI |
| Ga0209447_102079221 | 3300027701 | Bog Forest Soil | GPSIAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0209655_100012727 | 3300027767 | Bog Forest Soil | MRAALLAGAGWRELWPSIGALLVFAAILIPLSFLVFAWALRRTKVTGTLTHI |
| Ga0209139_102362361 | 3300027795 | Bog Forest Soil | IGALLLFAVILIPLSFLVFAWALRRTKITGTLTHI |
| Ga0209517_100790913 | 3300027854 | Peatlands Soil | LEGMRAALLAGAGWNKLWPSIVALLIFALILIPLSFVTFAWALRRTKITGTLTHI |
| Ga0209693_100826623 | 3300027855 | Soil | PIGALLIFAVILIPISFVVFSWALRRTKITGTLTHI |
| Ga0209624_101741991 | 3300027895 | Forest Soil | LEGMRAALLGGAGWRELWPSIAALLLFATILIPVSFAIFAWALRRTKVTGTLTHI |
| Ga0209067_108159572 | 3300027898 | Watersheds | MRAALLAGAGWGQLWPSLVALLAFAAVLIPLSFAVFGWALRRTKITGTLTHI |
| Ga0209006_111704662 | 3300027908 | Forest Soil | LGPSVAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0209583_103610671 | 3300027910 | Watersheds | LWPSVRALILFAVVLLPLSGVIFAWALRQTKITGTLTHL |
| Ga0209583_106128202 | 3300027910 | Watersheds | MLHSKTIFAAALLPLSMSVFAWSLRRTKITGTLTHS |
| (restricted) Ga0233418_100272671 | 3300027995 | Sediment | AELWPSLRALLVFAIILLPLSFAAFSWALRRTKITGTLTHM |
| Ga0209526_109931821 | 3300028047 | Forest Soil | LEGMRAALLGHAALRDLWPSLAALLIFAGILLPVSFAAFSWALRRTKITGTLTHF |
| Ga0302233_100038761 | 3300028746 | Palsa | IAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0302233_103768831 | 3300028746 | Palsa | LLAHASWSQLWPSVAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0302226_103383841 | 3300028801 | Palsa | ALLAGAGWGELFPSIAALLVFAAVLIPLSFALFAWALHRTKITGTLTHI |
| Ga0302228_100255774 | 3300028808 | Palsa | AALLAGAGWGELFPSIAALLVFAAVLIPLSFALFAWALHRTKITGTLTHI |
| Ga0308309_106011221 | 3300028906 | Soil | SIAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0302316_100276581 | 3300030646 | Palsa | AGWGELFPSIAALLVFAAVLIPLSFALFAWALHRTKITGTLTHI |
| Ga0310038_104607991 | 3300030707 | Peatlands Soil | IGRPLLLLLVFAVILLPASMAAFAWALRRTKTTGTLTHS |
| Ga0302311_106721421 | 3300030739 | Palsa | MRAALLAGAGWGLLWHSIAALLIFAVILIPLSFAVFAWALRRTKITGTLTHI |
| Ga0075399_109533611 | 3300030967 | Soil | LLLLLFFAAILLPASAATFSWALRRTKMTGTLTHN |
| Ga0302180_100727691 | 3300031028 | Palsa | LLARASWAELGPSIAALLIFAAILIPLSFAIFAWALRRTKITGTLTHI |
| Ga0302325_129032792 | 3300031234 | Palsa | VPSIAGLLVFAAILLPVSFAIFSWALQRTKITGTLTHF |
| Ga0302324_1012158932 | 3300031236 | Palsa | WPSIGALLVFAAVLLPLSFAVFGWALRRTKVNGSLTHL |
| Ga0265325_101306961 | 3300031241 | Rhizosphere | LLGHAPMRELMPPLMALLAFAAVLLPTSFLVFSWALRRTKITGTLTHF |
| Ga0247727_100560591 | 3300031576 | Biofilm | LAGLWPAIQALLLFAAVLLPLSLGAFTWALRRTKITGTLTHF |
| Ga0310686_1039544432 | 3300031708 | Soil | MRAELPAGAGWRELWPSIGALLVFAAIRIPLSFLVFAWALRRTKVTGTLTHI |
| Ga0310686_1074784132 | 3300031708 | Soil | ALLAGAGWRELWPSIAALLLFAAILMPSSFLVFAWALRRTKVTGTLTHI |
| Ga0307474_115816022 | 3300031718 | Hardwood Forest Soil | MRAALLAGAGWNQLWPSIAALLVFAVILIPSSFVVFAWSLRRTKITGTLTHI |
| Ga0307469_114780161 | 3300031720 | Hardwood Forest Soil | DATRAAILTGAGLLALWRPIATLLLFAVILLPLSMSVFAWAVRRTKATGTLTHS |
| Ga0307475_100894203 | 3300031754 | Hardwood Forest Soil | YVARPLAVLLLFVVILLPTSMLVFSWALRRTKMNGTLMHR |
| Ga0307473_103148822 | 3300031820 | Hardwood Forest Soil | HPLLILALFALVLLPTSMLAFSWALRRTKITGTLSHR |
| Ga0307473_112395341 | 3300031820 | Hardwood Forest Soil | LWPSVRALLLFSAILLPLSSATFAWALRQTKITGTLTHL |
| Ga0302315_100217944 | 3300031837 | Palsa | LQGMRAALLAGAGWGELFPSIAALLVFAAVLIPLSFALFAWALHRTKITGTLTHI |
| Ga0318520_103419361 | 3300031897 | Soil | LEGMRAALLDGAGWSQFGPSILALLVFAAILLPLSFLVFAWALNRTRVTGTLTHI |
| Ga0310909_106979432 | 3300031947 | Soil | VAMLLLFALILLPASIWSFSWALRRTKITGTLSHR |
| Ga0326597_113283641 | 3300031965 | Soil | SLVSLWPSLRSLLLFALVLLPASLAVFSWALRRTKITGTLTHF |
| Ga0326597_114226731 | 3300031965 | Soil | GGASLSELWPDLRALLVFAAVLLPLSFAAFSWALRRTKITGTLTHM |
| Ga0310911_102471692 | 3300032035 | Soil | IAPAVAMLLLFALILLPASIWSFSWALRRTKITGTLSHR |
| Ga0335071_101139231 | 3300032897 | Soil | ARPLSILLMFALILLPLSFGAFSWALRRTKITGTLSHR |
| Ga0335076_100147294 | 3300032955 | Soil | ARPIAALLIFALFLIPFSFAVFGWALRRTKVTGTLTHI |
| Ga0316628_1021655192 | 3300033513 | Soil | ELWPSLAGLLAFAAVILPVSVVVFSWALRRTKITGTLTHF |
| ⦗Top⦘ |