


| Basic Information | |
|---|---|
| Family ID | F037866 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RIFVPRTALESLTVLAVIGATRRQRRPEDQRQVPMFEE |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.43 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.449 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.377 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.749 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.701 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF04613 | LpxD | 16.17 |
| PF09286 | Pro-kuma_activ | 8.98 |
| PF04972 | BON | 4.19 |
| PF01553 | Acyltransferase | 2.40 |
| PF08808 | RES | 2.40 |
| PF01790 | LGT | 1.80 |
| PF07517 | SecA_DEAD | 1.80 |
| PF13088 | BNR_2 | 1.20 |
| PF01145 | Band_7 | 1.20 |
| PF13350 | Y_phosphatase3 | 1.20 |
| PF13180 | PDZ_2 | 1.20 |
| PF01850 | PIN | 1.20 |
| PF13517 | FG-GAP_3 | 1.20 |
| PF03960 | ArsC | 1.20 |
| PF01797 | Y1_Tnp | 1.20 |
| PF00294 | PfkB | 0.60 |
| PF02604 | PhdYeFM_antitox | 0.60 |
| PF02627 | CMD | 0.60 |
| PF00912 | Transgly | 0.60 |
| PF00756 | Esterase | 0.60 |
| PF13519 | VWA_2 | 0.60 |
| PF01177 | Asp_Glu_race | 0.60 |
| PF08239 | SH3_3 | 0.60 |
| PF13462 | Thioredoxin_4 | 0.60 |
| PF03544 | TonB_C | 0.60 |
| PF09722 | Xre_MbcA_ParS_C | 0.60 |
| PF14384 | BrnA_antitoxin | 0.60 |
| PF01048 | PNP_UDP_1 | 0.60 |
| PF16640 | Big_3_5 | 0.60 |
| PF08681 | DUF1778 | 0.60 |
| PF00593 | TonB_dep_Rec | 0.60 |
| PF00082 | Peptidase_S8 | 0.60 |
| PF01432 | Peptidase_M3 | 0.60 |
| PF04014 | MazE_antitoxin | 0.60 |
| PF00474 | SSF | 0.60 |
| PF01841 | Transglut_core | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 16.17 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 8.98 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 2.40 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 1.80 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 1.20 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.20 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.60 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.60 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.60 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.60 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.60 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.60 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.60 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.60 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.60 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.45 % |
| Unclassified | root | N/A | 24.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100582214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 996 | Open in IMG/M |
| 3300004082|Ga0062384_101077057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300005175|Ga0066673_10840341 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005176|Ga0066679_10468005 | Not Available | 824 | Open in IMG/M |
| 3300005184|Ga0066671_10423330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 854 | Open in IMG/M |
| 3300005327|Ga0070658_11592636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 566 | Open in IMG/M |
| 3300005337|Ga0070682_100685414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 820 | Open in IMG/M |
| 3300005436|Ga0070713_100491256 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005436|Ga0070713_101365030 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005529|Ga0070741_10477380 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005537|Ga0070730_10971078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005538|Ga0070731_10384967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300005539|Ga0068853_100745386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 936 | Open in IMG/M |
| 3300005541|Ga0070733_10414712 | Not Available | 897 | Open in IMG/M |
| 3300005541|Ga0070733_10841199 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005552|Ga0066701_10588678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300005554|Ga0066661_10888408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005555|Ga0066692_10082718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1868 | Open in IMG/M |
| 3300005591|Ga0070761_10016673 | All Organisms → cellular organisms → Bacteria | 4083 | Open in IMG/M |
| 3300005591|Ga0070761_10189686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1215 | Open in IMG/M |
| 3300005591|Ga0070761_10821650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300005712|Ga0070764_10801212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 586 | Open in IMG/M |
| 3300005718|Ga0068866_10265239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300005764|Ga0066903_100690083 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300005873|Ga0075287_1049894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300005921|Ga0070766_10050028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2345 | Open in IMG/M |
| 3300005944|Ga0066788_10018909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1515 | Open in IMG/M |
| 3300006046|Ga0066652_100983637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 802 | Open in IMG/M |
| 3300006175|Ga0070712_100087922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2269 | Open in IMG/M |
| 3300006176|Ga0070765_101504992 | Not Available | 633 | Open in IMG/M |
| 3300006755|Ga0079222_10524187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300006797|Ga0066659_11362684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300006806|Ga0079220_10557221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
| 3300006893|Ga0073928_10115326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2225 | Open in IMG/M |
| 3300006893|Ga0073928_11185425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300009089|Ga0099828_11085468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300009093|Ga0105240_11470819 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300009093|Ga0105240_12298871 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009143|Ga0099792_10296957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300009519|Ga0116108_1235303 | Not Available | 535 | Open in IMG/M |
| 3300009645|Ga0116106_1226903 | Not Available | 594 | Open in IMG/M |
| 3300009700|Ga0116217_10605455 | Not Available | 682 | Open in IMG/M |
| 3300009759|Ga0116101_1106519 | Not Available | 656 | Open in IMG/M |
| 3300009839|Ga0116223_10380402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 833 | Open in IMG/M |
| 3300010048|Ga0126373_11582048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300010048|Ga0126373_12673467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300010339|Ga0074046_10003665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12761 | Open in IMG/M |
| 3300010343|Ga0074044_10009043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 7714 | Open in IMG/M |
| 3300010361|Ga0126378_12786634 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010371|Ga0134125_11167358 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010373|Ga0134128_10028288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6608 | Open in IMG/M |
| 3300010376|Ga0126381_104015191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300010401|Ga0134121_11605115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300012096|Ga0137389_10129302 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300012189|Ga0137388_10236071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300012189|Ga0137388_11109312 | Not Available | 728 | Open in IMG/M |
| 3300012199|Ga0137383_10704048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300012200|Ga0137382_11112204 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012200|Ga0137382_11317164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300012201|Ga0137365_10518360 | Not Available | 876 | Open in IMG/M |
| 3300012208|Ga0137376_10778320 | Not Available | 824 | Open in IMG/M |
| 3300012211|Ga0137377_10798347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300012359|Ga0137385_10328292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1312 | Open in IMG/M |
| 3300012685|Ga0137397_10859579 | Not Available | 673 | Open in IMG/M |
| 3300012917|Ga0137395_10005941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6319 | Open in IMG/M |
| 3300012927|Ga0137416_10202445 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300012929|Ga0137404_10365056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300012930|Ga0137407_10291707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1490 | Open in IMG/M |
| 3300012951|Ga0164300_10274627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300012960|Ga0164301_11748539 | Not Available | 521 | Open in IMG/M |
| 3300012971|Ga0126369_12007076 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300014157|Ga0134078_10678302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300014201|Ga0181537_11143872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 526 | Open in IMG/M |
| 3300014495|Ga0182015_10050537 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
| 3300014501|Ga0182024_11109976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300014657|Ga0181522_10694662 | Not Available | 621 | Open in IMG/M |
| 3300015264|Ga0137403_10375342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300015373|Ga0132257_104017233 | Not Available | 535 | Open in IMG/M |
| 3300017928|Ga0187806_1089852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300017943|Ga0187819_10046119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2582 | Open in IMG/M |
| 3300017961|Ga0187778_10534332 | Not Available | 781 | Open in IMG/M |
| 3300017970|Ga0187783_10193952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1493 | Open in IMG/M |
| 3300017970|Ga0187783_10376904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300017972|Ga0187781_11275828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300017974|Ga0187777_11337031 | Not Available | 527 | Open in IMG/M |
| 3300018006|Ga0187804_10070304 | Not Available | 1400 | Open in IMG/M |
| 3300018008|Ga0187888_1382401 | Not Available | 533 | Open in IMG/M |
| 3300018022|Ga0187864_10404708 | Not Available | 587 | Open in IMG/M |
| 3300018046|Ga0187851_10709524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300018085|Ga0187772_11276303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300019879|Ga0193723_1182094 | Not Available | 538 | Open in IMG/M |
| 3300020070|Ga0206356_10658726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300020579|Ga0210407_11483230 | Not Available | 501 | Open in IMG/M |
| 3300020583|Ga0210401_10908914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300021171|Ga0210405_11287817 | Not Available | 537 | Open in IMG/M |
| 3300021180|Ga0210396_11274824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300021362|Ga0213882_10185228 | Not Available | 857 | Open in IMG/M |
| 3300021401|Ga0210393_10701618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300021403|Ga0210397_10253133 | Not Available | 1279 | Open in IMG/M |
| 3300021407|Ga0210383_10270780 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300021432|Ga0210384_11706040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021433|Ga0210391_10730887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300021474|Ga0210390_10822711 | Not Available | 768 | Open in IMG/M |
| 3300021477|Ga0210398_11045232 | Not Available | 650 | Open in IMG/M |
| 3300021478|Ga0210402_10857214 | Not Available | 834 | Open in IMG/M |
| 3300021479|Ga0210410_11188248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300021560|Ga0126371_10947266 | Not Available | 1004 | Open in IMG/M |
| 3300021560|Ga0126371_12030761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300025506|Ga0208937_1019342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1709 | Open in IMG/M |
| 3300025899|Ga0207642_11011068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300025905|Ga0207685_10485462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300025910|Ga0207684_10462524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300025913|Ga0207695_10121851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2575 | Open in IMG/M |
| 3300025914|Ga0207671_10403545 | Not Available | 1087 | Open in IMG/M |
| 3300025915|Ga0207693_10247210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1400 | Open in IMG/M |
| 3300025916|Ga0207663_10534182 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300025942|Ga0207689_10388724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300025945|Ga0207679_10021461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4379 | Open in IMG/M |
| 3300025949|Ga0207667_11184632 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025996|Ga0208777_1020041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300026023|Ga0207677_10136112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1873 | Open in IMG/M |
| 3300026121|Ga0207683_11183640 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026215|Ga0209849_1024541 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300026323|Ga0209472_1025273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2779 | Open in IMG/M |
| 3300026537|Ga0209157_1160035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300027625|Ga0208044_1217449 | Not Available | 505 | Open in IMG/M |
| 3300027648|Ga0209420_1045004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300027652|Ga0209007_1021944 | Not Available | 1649 | Open in IMG/M |
| 3300027725|Ga0209178_1120956 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027738|Ga0208989_10077805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300027787|Ga0209074_10407647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027846|Ga0209180_10285476 | Not Available | 947 | Open in IMG/M |
| 3300027853|Ga0209274_10010820 | All Organisms → cellular organisms → Bacteria | 4097 | Open in IMG/M |
| 3300027853|Ga0209274_10202427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300027867|Ga0209167_10108941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
| 3300027867|Ga0209167_10183796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300027879|Ga0209169_10693470 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027895|Ga0209624_10994152 | Not Available | 544 | Open in IMG/M |
| 3300027911|Ga0209698_10781896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300027911|Ga0209698_10922030 | Not Available | 654 | Open in IMG/M |
| 3300028780|Ga0302225_10312512 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300028906|Ga0308309_10038189 | All Organisms → cellular organisms → Bacteria | 3366 | Open in IMG/M |
| 3300029917|Ga0311326_10479402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 609 | Open in IMG/M |
| 3300030053|Ga0302177_10055064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2398 | Open in IMG/M |
| 3300030763|Ga0265763_1027261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300031028|Ga0302180_10251110 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031708|Ga0310686_111831412 | All Organisms → cellular organisms → Bacteria | 3993 | Open in IMG/M |
| 3300031716|Ga0310813_10592561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300031716|Ga0310813_11652222 | Not Available | 599 | Open in IMG/M |
| 3300031720|Ga0307469_10032183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3062 | Open in IMG/M |
| 3300031754|Ga0307475_10935301 | Not Available | 683 | Open in IMG/M |
| 3300031781|Ga0318547_10795002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031823|Ga0307478_10725502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300031945|Ga0310913_10578937 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 796 | Open in IMG/M |
| 3300031962|Ga0307479_10173647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2118 | Open in IMG/M |
| 3300031962|Ga0307479_11214740 | Not Available | 717 | Open in IMG/M |
| 3300031962|Ga0307479_11358954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300031996|Ga0308176_10504485 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300032261|Ga0306920_101351061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1023 | Open in IMG/M |
| 3300032261|Ga0306920_104058589 | Not Available | 530 | Open in IMG/M |
| 3300032770|Ga0335085_12428815 | Not Available | 522 | Open in IMG/M |
| 3300032805|Ga0335078_12129764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 594 | Open in IMG/M |
| 3300032828|Ga0335080_11586544 | Not Available | 645 | Open in IMG/M |
| 3300032893|Ga0335069_10155677 | All Organisms → cellular organisms → Bacteria | 2825 | Open in IMG/M |
| 3300033158|Ga0335077_10444871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1382 | Open in IMG/M |
| 3300033158|Ga0335077_12028555 | Not Available | 533 | Open in IMG/M |
| 3300034163|Ga0370515_0066056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.20% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.20% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.20% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.20% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.60% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005822141 | 3300002245 | Forest Soil | TQRIFVPRTALESLTVLAVIGATRRPKRGPTDDQRQVTLFEE* |
| Ga0062384_1010770572 | 3300004082 | Bog Forest Soil | TQRMFVPRSALDSLTVLAVIGATRRRRRGMPSDTLQVPMFGEQ* |
| Ga0066673_108403411 | 3300005175 | Soil | QRIFVPRTALESLTVLAVIGATRRKRPAQDQRQVPMFEE* |
| Ga0066679_104680051 | 3300005176 | Soil | IFVPRSALSSLTVVAVIGATRRRRKGALMDTRQVQLFGE* |
| Ga0066671_104233301 | 3300005184 | Soil | TQRIFVPRSALTSLTVLAVIGGGVRRRKEERDTGQVPMFDEEAAGSQ* |
| Ga0070658_115926361 | 3300005327 | Corn Rhizosphere | NPPDLRSNVQRMFVPRLALESLTVLAVIGATRRQRRGPEDVRQVPMFGE* |
| Ga0070682_1006854142 | 3300005337 | Corn Rhizosphere | RIFVPRTALESLTVLAVIGATHRRRKGAPADTRQVPMFGE* |
| Ga0070713_1004912564 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RMFVPRTALESLTVLAVIGATRRQRRGPEDVRQVPMFGE* |
| Ga0070713_1013650302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSNVQRMFVPRGALESLTVLAVIGASRRQRRGPADVLQVPMFGE* |
| Ga0070741_104773801 | 3300005529 | Surface Soil | NPPDLRSNVQRMFVPRTALESLTVLAVIGATRRQRRGPEDVRQVPMFGE* |
| Ga0070730_109710781 | 3300005537 | Surface Soil | VPRTALESLTVLAVIGASRRQRRGAQDQRQVPMFEE* |
| Ga0070731_103849672 | 3300005538 | Surface Soil | RIFVPRGAIDSLSVLAVIGGMNRRRRGAEDQRQVPMFGE* |
| Ga0068853_1007453861 | 3300005539 | Corn Rhizosphere | PPDLRSNVQRLFVPRTALESLTVLAVIGASRRQRRGADDVRQVPMFGE* |
| Ga0070733_104147122 | 3300005541 | Surface Soil | SNTQRIFVPRTALESLTVLAVIGATRRQRRGTDDQRQVSMFEE* |
| Ga0070733_108411993 | 3300005541 | Surface Soil | RIFVPRTALESLTVLAVIGATRRKQRGAEDQRQVPMFEE* |
| Ga0066701_105886781 | 3300005552 | Soil | VQRMFVPRTALESLTVLAVIGAARRQRRGPADVMQVPMFGE* |
| Ga0066661_108884081 | 3300005554 | Soil | LFVPRGALESLTVLAVIGATRRQRPGPADLRQVPMFGE* |
| Ga0066692_100827183 | 3300005555 | Soil | FVPRSALSSLTVLAVIGATRRRRKGALMDTRQVQLFGE* |
| Ga0070761_100166731 | 3300005591 | Soil | NTQRIFVPRTALESLTVLAVIGATRRLRHGAQDQRQVPMFEE* |
| Ga0070761_101896861 | 3300005591 | Soil | NPPDLRSNIQRMFVPRGALESLTVLAVIGASRRQRRDLLTDTRQVPMFGE* |
| Ga0070761_108216502 | 3300005591 | Soil | QRIFVPRSALESLTVLAVIGAPRRPRRGAAEDQRQVTLFEE* |
| Ga0070764_108012122 | 3300005712 | Soil | TQRIFVPRTALESLTVLAVIGATRRPRRGPTDDQRQVPMFEE* |
| Ga0068866_102652391 | 3300005718 | Miscanthus Rhizosphere | RTALESLTVLAVIGATRRQRRGSEDVRQVPMFGE* |
| Ga0066903_1006900831 | 3300005764 | Tropical Forest Soil | PRSALESLTVLAVIGAARRGRRAAEDQRQVPMFEE* |
| Ga0075287_10498941 | 3300005873 | Rice Paddy Soil | RIFVPRTALESLTVLAVIGATRRKRPAQDQRQVPMFEE* |
| Ga0070766_100500282 | 3300005921 | Soil | PRTALESLTVLAVIGAARRRRRDADDQRQVPMFEE* |
| Ga0066788_100189093 | 3300005944 | Soil | QRIFVPRTALESLTVLAVIGATRWQRRDLAGDVRQVTMFEQ* |
| Ga0066652_1009836372 | 3300006046 | Soil | SNVQRLFVPRGALESLTVLAVIGASRRQRRGPEDVRQVPMFGE* |
| Ga0070712_1000879224 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NVQRLFVPRTALESLTVLAVIGASRRQRRGADDVRQVPMFGE* |
| Ga0070765_1015049921 | 3300006176 | Soil | RSALESLTVLAVIGATRRQRRGPLSDAGQVPLFEE* |
| Ga0079222_105241872 | 3300006755 | Agricultural Soil | FVPRTALESLTVLAVIGATRRHRKDRPSDTRQVQLFGE* |
| Ga0066659_113626841 | 3300006797 | Soil | RSALASLTVLAVIGGTHRRRKPTADVRQVPMFEE* |
| Ga0079220_105572211 | 3300006806 | Agricultural Soil | NTQRIFVPRSALSSLTVLAVIGGAVRKRREARDTGQVPMFGEEAAGT* |
| Ga0073928_101153264 | 3300006893 | Iron-Sulfur Acid Spring | SNRQRICVPRGALESLAVLAVIGAKHRRRKGTPTDTRQVQMCGE* |
| Ga0073928_111854252 | 3300006893 | Iron-Sulfur Acid Spring | SNVQRLFVPRGALESLTVLAVIGATRRQRRGPTDLRQVPMFGE* |
| Ga0099828_110854682 | 3300009089 | Vadose Zone Soil | RTALESLTVLAVIGATRRQRTGAEDVRQVPMFGE* |
| Ga0105240_114708191 | 3300009093 | Corn Rhizosphere | DLRSNVQRMFVPRSALESLTVLAVIGATRRQRRGSEDVRQVPMFGE* |
| Ga0105240_122988711 | 3300009093 | Corn Rhizosphere | MRSNVQRMFVPRSALESLTVLAVIGASRRQRRGADDVRQVPMFGE* |
| Ga0099792_102969571 | 3300009143 | Vadose Zone Soil | RTALDSLTVLAVIGATRRQRKGGPSDARQVPMFEE* |
| Ga0116108_12353032 | 3300009519 | Peatland | SALESLTVLAVIGATRRHRRGVPEDAGQVPLFGE* |
| Ga0116106_12269031 | 3300009645 | Peatland | TALESLTVLAVIGATRRPRRGAAEDQRQVPMFEE* |
| Ga0116217_106054551 | 3300009700 | Peatlands Soil | PRTALESRTVLAVIGATRRPRRGPTDDQRQVPMFEE* |
| Ga0116101_11065191 | 3300009759 | Peatland | RIFVPRTALDSLTVLAVIGATRRTRRGGAEDQRQVPMFEE* |
| Ga0116223_103804022 | 3300009839 | Peatlands Soil | TQRIFVPRTALESLTVLAVIGATRRPRRGAAEDQRQVTLFEE* |
| Ga0126373_115820482 | 3300010048 | Tropical Forest Soil | NTQRIFVPRTALESLTVLAVIGGTRRQQRGAQDQRQVTMFEE* |
| Ga0126373_126734672 | 3300010048 | Tropical Forest Soil | LDSLTVLAVIGATRRRRRGLPSDTRQVQLFGETS* |
| Ga0074046_1000366511 | 3300010339 | Bog Forest Soil | RTALESLTVLAVIGAARRQRRAAQDQLQVPMFEE* |
| Ga0074044_100090431 | 3300010343 | Bog Forest Soil | TALESLTVLAVIGATRRPRRGTVDDQRQVPMFED* |
| Ga0126378_127866342 | 3300010361 | Tropical Forest Soil | SNVQRLFVPRTALESLSVLAVIGATRRHRRGADDVRQVPMFGE* |
| Ga0134125_111673582 | 3300010371 | Terrestrial Soil | RGALESLTVLAVIGATRRQRHGPTDLRQVPMFGE* |
| Ga0134128_100282881 | 3300010373 | Terrestrial Soil | RLFVPRTALESLTVLAVIGASRRQRRGADDVRQVPMFGE* |
| Ga0126381_1040151911 | 3300010376 | Tropical Forest Soil | PRTALESLTVIAVIGATRRQRRLAQDQRQVPMFEE* |
| Ga0134121_116051152 | 3300010401 | Terrestrial Soil | SALATLNVLAVIGGSHRRRRTGAEDVRQVQLFGE* |
| Ga0137389_101293021 | 3300012096 | Vadose Zone Soil | RTALESLTVLAVIGASNRRRRGAADDQRQVPLFEG* |
| Ga0137388_102360711 | 3300012189 | Vadose Zone Soil | RIFVPRSALESLTVLAVIGATHRRRKGATTDTRQVPMFGE* |
| Ga0137388_111093122 | 3300012189 | Vadose Zone Soil | SNVQRLFVPRTALESLTVLAVIGATRRQRRGAEDVRQVPMFGE* |
| Ga0137383_107040481 | 3300012199 | Vadose Zone Soil | LRSNVQKLFVPRTALESLTVLAVIGATRRQRRGAEDVRQVPMFGE* |
| Ga0137382_111122042 | 3300012200 | Vadose Zone Soil | PRTALESLTVLAVIGASRRLRRGAEDVRQVPMFGE* |
| Ga0137382_113171641 | 3300012200 | Vadose Zone Soil | RIFVPRSALDSLTVLAVIGGTHRKRLQPEDQLQVPMFGE* |
| Ga0137365_105183601 | 3300012201 | Vadose Zone Soil | PRTALESLNVLAVIGAARRQRRGAEDVRQVPMFGE* |
| Ga0137376_107783201 | 3300012208 | Vadose Zone Soil | LRSNVQRMFIPRSALESLTVLAVIGAARRQRRGPADVMQVPMFGE* |
| Ga0137377_107983471 | 3300012211 | Vadose Zone Soil | RIFVPRTALESLTVLAVIGATRRQRRGGTQDQRQVPMFEE* |
| Ga0137385_103282921 | 3300012359 | Vadose Zone Soil | PDLRSNVQKLFVPRTALESLTVLAVIGATRRQRRGAEDVRQVPMFGE* |
| Ga0137397_108595791 | 3300012685 | Vadose Zone Soil | QRSNTQRIFVPRTALESLTVLAVIGATRRQRRGADQRQVPMFEE* |
| Ga0137395_100059415 | 3300012917 | Vadose Zone Soil | FVPRTALESLTVLAVIGAARRQRKAGPSDARQVAMFEE* |
| Ga0137416_102024453 | 3300012927 | Vadose Zone Soil | RIFVPRVALDSLTVLAVIGGTHRQRRRPEDQRQVPMFEP* |
| Ga0137404_103650561 | 3300012929 | Vadose Zone Soil | IFVPRTALESLTVLAVIGATHRRRKGAPTDTRQVPMFGE* |
| Ga0137407_102917073 | 3300012930 | Vadose Zone Soil | QRIFVPRTALESLTVLAVIGATHRRRKGAPADARQVPMFGE* |
| Ga0164300_102746272 | 3300012951 | Soil | TALASLEVLAVIGAARRGRAAAAGDARQVQLFGEG* |
| Ga0164301_117485391 | 3300012960 | Soil | QRIFVPRTALESLTVLAVIGATHRRRKGAQPDTRQVPMFGE* |
| Ga0126369_120070762 | 3300012971 | Tropical Forest Soil | SNTQRIFVPRTALESINVLAVIGAASRRRHPATDQRQVPMFGE* |
| Ga0134078_106783022 | 3300014157 | Grasslands Soil | PRTALESLTVLAVIGAARRQRRGAEDVRQVPMFGE* |
| Ga0181537_111438721 | 3300014201 | Bog | IFVPRTALESLTVLAVIGASRRPRRGPIDDQRQVPMFEE* |
| Ga0182015_100505371 | 3300014495 | Palsa | TALESLTVLAVIGATRRPRRGDLDDQRQVPMFDE* |
| Ga0182024_111099761 | 3300014501 | Permafrost | QRIFVPRTALESLTVLAVIGATRRQRRGAQDQRQVPMFEE* |
| Ga0181522_106946621 | 3300014657 | Bog | TQRIFVPRTALESLTVLAVIGAARRPRRGAVQDQRQVTLFEE* |
| Ga0137403_103753422 | 3300015264 | Vadose Zone Soil | QRIFVPRTALESLTVLAVIGATHRRRKGAPTDTRQVPMFGE* |
| Ga0132257_1040172331 | 3300015373 | Arabidopsis Rhizosphere | RIFVPRTALESLTVLAVIGATRRGRRAAQDQRQVPMFEE* |
| Ga0187806_10898522 | 3300017928 | Freshwater Sediment | FVPRTALESLTVLAVIGATRRRRHGAEDQRQVPMFEE |
| Ga0187819_100461194 | 3300017943 | Freshwater Sediment | TQRLFVPRSALESLTVLAVIGATRRRRRGVPVDTGQVPMFGE |
| Ga0187778_105343321 | 3300017961 | Tropical Peatland | QRIFVPRTALESLTVLAVIGATRRKRRGAEDQRQVPMFGE |
| Ga0187783_101939523 | 3300017970 | Tropical Peatland | RMFVPRNALESLTVLAVIGSARRRRRGVAFDTRQVPMFEE |
| Ga0187783_103769042 | 3300017970 | Tropical Peatland | FVPRTALESLTVLAVIGATRRKARGADDQRQVTMFE |
| Ga0187781_112758282 | 3300017972 | Tropical Peatland | SNTQRIFVPRTALESLTVLAVIGAARRQRRGAQDQRQVPMFEE |
| Ga0187777_113370311 | 3300017974 | Tropical Peatland | RIFVPRTALESLTVLAVIGATRRRRKGAPDTRQVPMFGE |
| Ga0187804_100703042 | 3300018006 | Freshwater Sediment | FVPRSALDSLTVLAVIGAARRRRKGAPGDTRQVQLFGE |
| Ga0187888_13824011 | 3300018008 | Peatland | TQRIFVPRTALESLTVLAVIGAPRRPRRAATDDQRQVPMFEEQ |
| Ga0187864_104047081 | 3300018022 | Peatland | RTALESLTVLAVIGATRRPRRGAAGDQRQVPMFEE |
| Ga0187851_107095242 | 3300018046 | Peatland | NTQRIFVPRTALESLTVLAVIGATRRPRHGAQDQRQVPMFEE |
| Ga0187772_112763031 | 3300018085 | Tropical Peatland | RSNIQRMFVPRSALESLTVLAVIGATRRQRRGIISDTRQVPMFGE |
| Ga0193723_11820942 | 3300019879 | Soil | FVPRSALSSLTVLAVIGATRRRRKGALMDTRQVQLFGE |
| Ga0206356_106587262 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | QRIFVPRTALESLTVVAVIGATHRRRKGAPADTRQVPMFGE |
| Ga0210407_114832301 | 3300020579 | Soil | NVQKLFVPRNALESLTVLAVIGATKRQRKGPMDVRQVPMFGE |
| Ga0210401_109089142 | 3300020583 | Soil | VPRSALESLNVLAVIGATRRQRRGIPADAGQVPLFGE |
| Ga0210405_112878172 | 3300021171 | Soil | PRTALESLTVLAVIGAARRPRRGGVDDQRQVTLFEE |
| Ga0210396_112748242 | 3300021180 | Soil | FVPRTALESLTVLAVIGAARRQRRGSQDQRQVPMFEE |
| Ga0213882_101852282 | 3300021362 | Exposed Rock | RCALLSLNVVGVIGGAQRRRKGITGDGRQVQLFGE |
| Ga0210393_107016181 | 3300021401 | Soil | VPRTALESLTVLAVIGAARRQRRGGTQDQRQVPMFEE |
| Ga0210397_102531332 | 3300021403 | Soil | FVPRSALESLTVLGVIGATHRKRRGVGVDTAQVPMFGE |
| Ga0210383_102707801 | 3300021407 | Soil | IFVPRTALESLTVLAVIGAPRRPRRGPTDDQRQVPMFEE |
| Ga0210384_117060401 | 3300021432 | Soil | VPRNAIDSLSVLAVIGGMNRRRRGADDQRQVPMFGE |
| Ga0210391_107308871 | 3300021433 | Soil | SNTQRIFVPRSALESLTVLAVIGATRHPRRGSDTRQVPMFEE |
| Ga0210390_108227111 | 3300021474 | Soil | TQRIFIPRTALESLTVLAVIGAGKRQRRPQDQRQVPMFEE |
| Ga0210398_110452321 | 3300021477 | Soil | LVVPRSALESLTVLAVIGATRRHRRGVPEDAGQVPLFGE |
| Ga0210402_108572141 | 3300021478 | Soil | FVPRTALDSLTVLAVIGGTHRKRRQPEDQLQVPMFGE |
| Ga0210410_111882482 | 3300021479 | Soil | PRSALESLTVLAVIGATRRQRRGGTQDQRQVPMFEE |
| Ga0126371_109472664 | 3300021560 | Tropical Forest Soil | QRMFVPRTALESLIVLAVIGASRRQRRGPADVRQVPMFEE |
| Ga0126371_120307612 | 3300021560 | Tropical Forest Soil | FVPRTALESLTVLAVIGATRRGRRAAEDQRQVPMFGE |
| Ga0208937_10193423 | 3300025506 | Peatland | NTQRIFVPRTALESLTVLAVIGATRRPRRGAAGDQRQVPMFEE |
| Ga0207642_110110682 | 3300025899 | Miscanthus Rhizosphere | NVQRMFVPRTALESLTVLAVIGATRRQRRGSEDVRQVPMFGE |
| Ga0207685_104854622 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RIFVPRSALESLTVLAVIGATHRRRKGSHTDTRQVPMFGE |
| Ga0207684_104625243 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SNVQRLFVPRTALESLTVLAVIGASRRQRRGAEDVRQVPMFGE |
| Ga0207695_101218515 | 3300025913 | Corn Rhizosphere | RSNVQRMFVPRSALESLTVLAVIGATRRQRRGSEDVRQVPMFGE |
| Ga0207671_104035453 | 3300025914 | Corn Rhizosphere | VQRMFVPRSALESLTVLAVIGATRRQRRGSEDVRQVPMFGE |
| Ga0207693_102472101 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RSNVQRMFVPRTALESLNVLAVIGASRRHRRPTDVRQVPMFGE |
| Ga0207663_105341821 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRMFVPRSALESLTVLAVIGASRRQRRGPEDVRQVPMFGE |
| Ga0207689_103887243 | 3300025942 | Miscanthus Rhizosphere | NIQRIFVPRSALESLTVLAVIGATHRRRKGSHTDTRQVPMFGE |
| Ga0207679_100214611 | 3300025945 | Corn Rhizosphere | QRIFVPRTALESLTVLAVIGATHRRRKGAPADTRQVPMFGE |
| Ga0207667_111846322 | 3300025949 | Corn Rhizosphere | VQRMFVPRSALESLTVLAVIGATRRQRRGPEDVRQVPMFGE |
| Ga0208777_10200412 | 3300025996 | Rice Paddy Soil | RIFVPRTALESLTVLAVIGATRRKRPAQDQRQVPMFEE |
| Ga0207677_101361121 | 3300026023 | Miscanthus Rhizosphere | PRSAISSMTVLAVIGATRRTRKGPPDTRQVPMFEQ |
| Ga0207683_111836403 | 3300026121 | Miscanthus Rhizosphere | VPRTALESLTVLAVIGATRRQRRGSEDVRQVPMFGE |
| Ga0209849_10245412 | 3300026215 | Soil | QRIFVPRTALESLTVLAVIGATRWQRRDLAGDVRQVTMFEQ |
| Ga0209472_10252735 | 3300026323 | Soil | QRIFVPRSALTSLTVLAVIGGGVRRRKEERDTGQVPMFDEEAAGSQ |
| Ga0209157_11600351 | 3300026537 | Soil | FVPRSALESLTVLAVIGATRRRRRGMPTDTRQVPMFGE |
| Ga0208044_12174491 | 3300027625 | Peatlands Soil | NTQRIFVPRTALESLTVLAVIGAARRRRRTGEDQLQVPMFGE |
| Ga0209420_10450041 | 3300027648 | Forest Soil | QRIFVPRSALDSLTVLAVIGAARRRRRDADDQRQVPMFDE |
| Ga0209007_10219442 | 3300027652 | Forest Soil | QRSNTQRIFVPRTALESLTVLAVIGATRRQRRGTQDQRQVPMFEE |
| Ga0209178_11209563 | 3300027725 | Agricultural Soil | FVPRTALESLTVLAVIGATRRKRPAQDQRQVPMFEE |
| Ga0208989_100778052 | 3300027738 | Forest Soil | IFVPRTALESLTVLAVIGATRRRPRGAADDQRQVPLFEG |
| Ga0209074_104076472 | 3300027787 | Agricultural Soil | RTALESLTVLAVIGATRRHRKDRPSDTRQVQLFGE |
| Ga0209180_102854762 | 3300027846 | Vadose Zone Soil | FVPRTALESLTVLAVIGATRRPRRGPTDDQRQVPMFEE |
| Ga0209274_100108203 | 3300027853 | Soil | RSNTQRIFVPRTALESLTVLAVIGATRRLRHGAQDQRQVPMFEE |
| Ga0209274_102024272 | 3300027853 | Soil | IFVPRTALESLTVLAVIGASRRGKRPEDQRQVTLFEG |
| Ga0209167_101089411 | 3300027867 | Surface Soil | NTQRIFVPRTALESLTVLAVIGATKRQRRGAEDQRQVPMFEE |
| Ga0209167_101837961 | 3300027867 | Surface Soil | IDTQRIFVPRTALESLTVLAVIGATRRQRRGAEDQRQVPMFEE |
| Ga0209169_106934701 | 3300027879 | Soil | TQRIFVPRTALESLTVLAVIGATRRGRHTQDQRQVPMFEE |
| Ga0209624_109941522 | 3300027895 | Forest Soil | RANTQRIFVPRTALESLTVLAVIGAARHQRRATEDQRQVPMFEE |
| Ga0209698_107818961 | 3300027911 | Watersheds | RIFVPRTALESLTVLAVIGATRRQRRPEDQRQVPMFEE |
| Ga0209698_109220301 | 3300027911 | Watersheds | IFVPRTALESLTVLAVIGATKRQRRGGTQDQRQVPMFEE |
| Ga0302225_103125122 | 3300028780 | Palsa | RIFVPRTALESLTVLAVIGATRRPRHGADDQRQVTLFEK |
| Ga0308309_100381893 | 3300028906 | Soil | VPRTALESLTVLAVIGATRRPRRGDLDDQRQVPMFEE |
| Ga0311326_104794022 | 3300029917 | Bog | TQRIFVPRTALDSLTVLAVIGASRRPRRGPTDDQRQVTLFEE |
| Ga0302177_100550644 | 3300030053 | Palsa | RIFVPRAALESLTVLAVIGATRRKPHPTRGEDQRQVPMFEE |
| Ga0265763_10272611 | 3300030763 | Soil | QRIFVPRTALESLTVLAVIGAARRQRRGSQDQRQVPMFEE |
| Ga0302180_102511102 | 3300031028 | Palsa | QRSNTQRIFVPRTALESLTVLAVIGATRRPRHGADDQRQVTLFEK |
| Ga0310686_1118314121 | 3300031708 | Soil | DQRGNTQRVFVPRTALESLTVLAVIGATRRPRRGAADDQRQVPMFGE |
| Ga0310813_105925612 | 3300031716 | Soil | RIFVPRAALESLTVLAVIGASRRKRRGLPTDTRQVQLFGE |
| Ga0310813_116522223 | 3300031716 | Soil | IFVPLTALESLTVLAVIGATRRKRPAQDQRQVPMFEE |
| Ga0307469_100321831 | 3300031720 | Hardwood Forest Soil | FVPRTALDSLTVLAVIGATHRRRKGAASDARQVPMFGE |
| Ga0307475_109353012 | 3300031754 | Hardwood Forest Soil | TQRIFVPRTALESLTVLAVIGATRRPRRGAGEDQRQVTLFEE |
| Ga0318547_107950022 | 3300031781 | Soil | FIPRSALDSLTVLAVIGATHRRRRRPEDQLQVPMFNE |
| Ga0307478_107255021 | 3300031823 | Hardwood Forest Soil | FVPRTALESLTVLAVIGATRRQRRGAQDQRQVPMFEE |
| Ga0310913_105789371 | 3300031945 | Soil | SNTQRVFVPRTALESLTVLAVIGASRRARRGQQDQRQVPMFEE |
| Ga0307479_101736471 | 3300031962 | Hardwood Forest Soil | QRIFVPRTALESLTVLAVIGSTRRQRRGAQDQRQVPMFEE |
| Ga0307479_112147401 | 3300031962 | Hardwood Forest Soil | NTQRIFVPRTALESLTVLAVIGATRRPRRGPSQDQQVTLFET |
| Ga0307479_113589541 | 3300031962 | Hardwood Forest Soil | FVPRSALESLTVLAVIGATRRQRRGTGADQRQVPMFGE |
| Ga0308176_105044853 | 3300031996 | Soil | VPRTALESLTVLAVIGATRRKRPAQDQRQVPMFEE |
| Ga0306920_1013510611 | 3300032261 | Soil | PRNALESLTVLAVIGSTRRRRRGVPLDTRQVPMFEE |
| Ga0306920_1040585891 | 3300032261 | Soil | NTQRIFVPRTALESLTVLAVIGATRRGRRPAEDQRQVPMFEE |
| Ga0335085_124288151 | 3300032770 | Soil | RIFVPRTALESLTVLAVIGATRRQRRPQDQRQVPMFEE |
| Ga0335078_121297641 | 3300032805 | Soil | PDLRSNIQRMFVPRSALESLTVLAVIGATRRQRRGVISDTRQVPMFGE |
| Ga0335080_115865441 | 3300032828 | Soil | RIFVPRTALESLTVLAVIGAARRQRRPQDQRQVPMFEE |
| Ga0335069_101556771 | 3300032893 | Soil | TQRIFVPRTALESLTVLAVIGATRRQRRGVDEQRQVPLFEE |
| Ga0335077_104448712 | 3300033158 | Soil | FVPRTALESLTVIAVIGATKRQRRPADQRQVPMFEE |
| Ga0335077_120285552 | 3300033158 | Soil | PPDMRSNAQRLFVPRTSLESLTVLAVIGATRRQRRGLSTDVRQVPMFGE |
| Ga0370515_0066056_1_108 | 3300034163 | Untreated Peat Soil | PRTALESLKVLAVIGTARRPRHGMEDGRQVSMFEQ |
| ⦗Top⦘ |