


| Basic Information | |
|---|---|
| Family ID | F037841 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KEIAACEMKPDPEDLESRLLEELEKSTGRRGNTIIAFCLAS |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.60 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 91.02 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.958 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.874 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF16326 | ABC_tran_CTD | 49.70 |
| PF03486 | HI0933_like | 13.17 |
| PF07488 | Glyco_hydro_67M | 5.39 |
| PF03648 | Glyco_hydro_67N | 3.59 |
| PF00005 | ABC_tran | 2.99 |
| PF00588 | SpoU_methylase | 1.80 |
| PF02321 | OEP | 1.20 |
| PF01663 | Phosphodiest | 1.20 |
| PF12680 | SnoaL_2 | 0.60 |
| PF13387 | DUF4105 | 0.60 |
| PF02371 | Transposase_20 | 0.60 |
| PF04972 | BON | 0.60 |
| PF01431 | Peptidase_M13 | 0.60 |
| PF03692 | CxxCxxCC | 0.60 |
| PF00150 | Cellulase | 0.60 |
| PF03916 | NrfD | 0.60 |
| PF07676 | PD40 | 0.60 |
| PF13690 | CheX | 0.60 |
| PF12704 | MacB_PCD | 0.60 |
| PF02687 | FtsX | 0.60 |
| PF00069 | Pkinase | 0.60 |
| PF00474 | SSF | 0.60 |
| PF01370 | Epimerase | 0.60 |
| PF10518 | TAT_signal | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 26.35 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 26.35 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 13.17 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 13.17 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 13.17 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 13.17 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 13.17 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 13.17 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 13.17 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 13.17 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 13.17 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 13.17 |
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 8.98 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.40 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.40 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.22 % |
| Unclassified | root | N/A | 10.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001175|JGI12649J13570_1016466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 816 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100090856 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
| 3300004091|Ga0062387_101280490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300004092|Ga0062389_101247078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 929 | Open in IMG/M |
| 3300005176|Ga0066679_10626606 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005177|Ga0066690_10066258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2247 | Open in IMG/M |
| 3300005179|Ga0066684_10425656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
| 3300005180|Ga0066685_10389601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 968 | Open in IMG/M |
| 3300005436|Ga0070713_100679441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
| 3300005437|Ga0070710_10630344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 749 | Open in IMG/M |
| 3300005541|Ga0070733_10832330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 620 | Open in IMG/M |
| 3300005542|Ga0070732_10382131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005542|Ga0070732_10827600 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005554|Ga0066661_10075955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1971 | Open in IMG/M |
| 3300005575|Ga0066702_10734533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300005591|Ga0070761_10120783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis → Terriglobus saanensis SP1PR4 | 1521 | Open in IMG/M |
| 3300005591|Ga0070761_10688473 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005610|Ga0070763_10508606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 690 | Open in IMG/M |
| 3300005764|Ga0066903_103655549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 828 | Open in IMG/M |
| 3300005921|Ga0070766_10961037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300006028|Ga0070717_12068446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300006052|Ga0075029_100490914 | Not Available | 809 | Open in IMG/M |
| 3300006176|Ga0070765_100022368 | All Organisms → cellular organisms → Bacteria | 4760 | Open in IMG/M |
| 3300006354|Ga0075021_11160409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 507 | Open in IMG/M |
| 3300006755|Ga0079222_11759027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
| 3300006800|Ga0066660_10522283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300009089|Ga0099828_10164821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1965 | Open in IMG/M |
| 3300009143|Ga0099792_10460899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300009524|Ga0116225_1297618 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009628|Ga0116125_1022050 | Not Available | 1582 | Open in IMG/M |
| 3300009701|Ga0116228_10752054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 656 | Open in IMG/M |
| 3300009759|Ga0116101_1078160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300009764|Ga0116134_1325602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009839|Ga0116223_10839928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010048|Ga0126373_10376715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
| 3300010048|Ga0126373_11353846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300010048|Ga0126373_13176319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010339|Ga0074046_10129078 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300010343|Ga0074044_10524194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300010360|Ga0126372_11395140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300010361|Ga0126378_11887102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300010379|Ga0136449_102260376 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300010379|Ga0136449_102832130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300011120|Ga0150983_10860526 | Not Available | 517 | Open in IMG/M |
| 3300012202|Ga0137363_10160252 | Not Available | 1775 | Open in IMG/M |
| 3300012203|Ga0137399_11756332 | Not Available | 509 | Open in IMG/M |
| 3300012354|Ga0137366_10069167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2690 | Open in IMG/M |
| 3300012359|Ga0137385_11595100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012361|Ga0137360_10743566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300012363|Ga0137390_11189557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300012927|Ga0137416_10638561 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300012929|Ga0137404_11511948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012971|Ga0126369_10915459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300014165|Ga0181523_10312311 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300014201|Ga0181537_10033358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3541 | Open in IMG/M |
| 3300014201|Ga0181537_11038001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300014493|Ga0182016_10561335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300014495|Ga0182015_10401446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300014501|Ga0182024_12004519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300015052|Ga0137411_1317827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1502 | Open in IMG/M |
| 3300015372|Ga0132256_102372912 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300017933|Ga0187801_10054953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1453 | Open in IMG/M |
| 3300017933|Ga0187801_10334740 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300017941|Ga0187850_10314387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300017942|Ga0187808_10384255 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300017943|Ga0187819_10436029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300017943|Ga0187819_10561873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300017948|Ga0187847_10613283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300017955|Ga0187817_10297825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300017970|Ga0187783_11181732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300018012|Ga0187810_10413129 | Not Available | 568 | Open in IMG/M |
| 3300018047|Ga0187859_10428017 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018088|Ga0187771_10220084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
| 3300019786|Ga0182025_1045141 | Not Available | 1539 | Open in IMG/M |
| 3300020579|Ga0210407_10193014 | Not Available | 1581 | Open in IMG/M |
| 3300020579|Ga0210407_10194852 | Not Available | 1573 | Open in IMG/M |
| 3300020579|Ga0210407_10876642 | Not Available | 689 | Open in IMG/M |
| 3300020581|Ga0210399_10271858 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300020581|Ga0210399_10546193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300021046|Ga0215015_10536123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300021088|Ga0210404_10032230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2355 | Open in IMG/M |
| 3300021088|Ga0210404_10329210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300021088|Ga0210404_10426952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300021170|Ga0210400_11484595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300021178|Ga0210408_10303490 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300021178|Ga0210408_10372062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300021180|Ga0210396_10340409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300021181|Ga0210388_10222069 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300021181|Ga0210388_10371134 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021401|Ga0210393_10634450 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300021404|Ga0210389_10271907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300021405|Ga0210387_10363010 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300021405|Ga0210387_11078429 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021407|Ga0210383_10415096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300021420|Ga0210394_10869987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300021432|Ga0210384_10259530 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300021474|Ga0210390_10197108 | Not Available | 1703 | Open in IMG/M |
| 3300021474|Ga0210390_10518557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300021474|Ga0210390_10927017 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021475|Ga0210392_10025783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3395 | Open in IMG/M |
| 3300021477|Ga0210398_10033649 | All Organisms → cellular organisms → Bacteria | 4282 | Open in IMG/M |
| 3300021477|Ga0210398_10318842 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300021478|Ga0210402_11212187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300021479|Ga0210410_10475016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300021559|Ga0210409_11380756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300021560|Ga0126371_13176492 | Not Available | 556 | Open in IMG/M |
| 3300022533|Ga0242662_10016709 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300022557|Ga0212123_10056426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3530 | Open in IMG/M |
| 3300022557|Ga0212123_10530151 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300022722|Ga0242657_1017737 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300022881|Ga0224545_1068819 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300023056|Ga0233357_1038134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300023101|Ga0224557_1047410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2016 | Open in IMG/M |
| 3300024225|Ga0224572_1067728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300025463|Ga0208193_1016381 | Not Available | 2105 | Open in IMG/M |
| 3300025500|Ga0208686_1086122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300025928|Ga0207700_11334115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300026309|Ga0209055_1205232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300027168|Ga0208239_1028077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027587|Ga0209220_1202720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027605|Ga0209329_1091933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300027648|Ga0209420_1191585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027767|Ga0209655_10196498 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027812|Ga0209656_10416709 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027825|Ga0209039_10056544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. GAS368 | 1769 | Open in IMG/M |
| 3300027842|Ga0209580_10307323 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027869|Ga0209579_10017979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4053 | Open in IMG/M |
| 3300027889|Ga0209380_10676455 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027895|Ga0209624_10327911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300028017|Ga0265356_1015075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300028023|Ga0265357_1041622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300028566|Ga0302147_10079171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300028572|Ga0302152_10095895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300028731|Ga0302301_1095637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300028774|Ga0302208_10150828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300028800|Ga0265338_10216958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300029914|Ga0311359_10186790 | Not Available | 1844 | Open in IMG/M |
| 3300029955|Ga0311342_10622191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300029982|Ga0302277_1068019 | Not Available | 1646 | Open in IMG/M |
| 3300030003|Ga0302172_10239712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300030044|Ga0302281_10160094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300030399|Ga0311353_11582020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300030494|Ga0310037_10041188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2210 | Open in IMG/M |
| 3300030494|Ga0310037_10064058 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300030494|Ga0310037_10241402 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300030509|Ga0302183_10039238 | Not Available | 1901 | Open in IMG/M |
| 3300030520|Ga0311372_10922876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300030943|Ga0311366_10983749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300031242|Ga0265329_10198302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031446|Ga0170820_11361072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300031474|Ga0170818_105833967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3740 | Open in IMG/M |
| 3300031525|Ga0302326_10718693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300031708|Ga0310686_106096562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300031715|Ga0307476_10631301 | Not Available | 794 | Open in IMG/M |
| 3300031720|Ga0307469_12402499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031941|Ga0310912_11196883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300031941|Ga0310912_11328333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031962|Ga0307479_10568083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300032160|Ga0311301_12969788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300032180|Ga0307471_102204263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300032783|Ga0335079_11312071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300032805|Ga0335078_11905141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300032893|Ga0335069_10835788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300032955|Ga0335076_10339235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1389 | Open in IMG/M |
| 3300033158|Ga0335077_10319748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300033888|Ga0334792_067479 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.99% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.80% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.20% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.20% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.60% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12649J13570_10164662 | 3300001175 | Forest Soil | GATDEEIAACEMKPDPDDLESALLQQLENTTGIHGNTIIAFCLASEPIK* |
| JGIcombinedJ26739_1000908561 | 3300002245 | Forest Soil | LCFQGASDEEVARCEMKPDPDDLESRVLEELETSAGVEGKTIIAYCLAT* |
| Ga0062387_1012804901 | 3300004091 | Bog Forest Soil | GATDEEIAECEMNPDPDDLESTLLQEIEQTTGARGQTIVAFCLAS* |
| Ga0062389_1012470781 | 3300004092 | Bog Forest Soil | LCYQGASDEEIATCEMTPDPDDLESDLLREVEESQGVRGNTIIAFCLAR* |
| Ga0066679_106266061 | 3300005176 | Soil | QIAACEMKPDPDDLESALLHQLEKAHGVCVNTIVAFCLR* |
| Ga0066690_100662582 | 3300005177 | Soil | EIAACEMIPDPEDMESRLLKEVEKGTGFRGDTIIAFPLAA* |
| Ga0066684_104256562 | 3300005179 | Soil | TSEEVAACEMQPDPENLESTLVRELETSSGLAGHTIVAFCLAS* |
| Ga0066685_103896011 | 3300005180 | Soil | ELCYHGFSEKEIAACEMIPDPEDMESRLLKEVEKGTGFRGDTIIAFPLAA* |
| Ga0070713_1006794411 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ACEMKPDPDDLESKLLKEFEKKSGRKGNTIIAFALAKERD* |
| Ga0070710_106303441 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KEIAACEMIPDPEDLESRILKEVEKGTGHRGDTIISFPLAA* |
| Ga0070733_108323302 | 3300005541 | Surface Soil | EIAGCEMIPDPDDLEASLLRDLEKRSGRRGNTVTAFCLAK* |
| Ga0070732_103821312 | 3300005542 | Surface Soil | EIAACEMTPDPDDLESRLLEKLEKSTGRSGNTIIAFCLK* |
| Ga0070732_108276001 | 3300005542 | Surface Soil | SEEKIAACEMRADPDDLESKLLRELEKKTGAHGNTIIAFCLAARDDQAIRR* |
| Ga0066661_100759551 | 3300005554 | Soil | CEMKPDPNDLESALLKRLEDNMVVRGHTIIAFCLER* |
| Ga0066702_107345331 | 3300005575 | Soil | EMQPDPENLESTLVRELETSSGLAGHTIVAFCLAS* |
| Ga0070761_101207832 | 3300005591 | Soil | CEMKPDPDDLESRLLEELEASTGTRGNTIIAFCLASSEVDPT* |
| Ga0070761_106884732 | 3300005591 | Soil | MNPDPDDLESTLVEDVEKATGVRGQTIVAFCLAS* |
| Ga0070763_105086062 | 3300005610 | Soil | DEEIAACEMKPDPNDLESTLLKMLEASTGTSGETIIAFCLAS* |
| Ga0066903_1036555492 | 3300005764 | Tropical Forest Soil | KGATDKQIAACEMVPDPDDLESRLVRQLEKKTGVKGETIVAFCLAG* |
| Ga0070766_109610371 | 3300005921 | Soil | EMKPDPDDLESVLLKKVEASTGTRGNTIIAFCLTS* |
| Ga0070717_120684462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FSEKEIAACEMIPDPEDLESRLLKDAEKSTGRRGDTIIAFPLAT* |
| Ga0075029_1004909142 | 3300006052 | Watersheds | ATIEEVAACELKADPDDLESALLEELEKSTGARGNTIIAFCLAR* |
| Ga0070765_1000223684 | 3300006176 | Soil | MIPDPDDLESNLIEELEKTTGARGQTIVAFCLAS* |
| Ga0075021_111604091 | 3300006354 | Watersheds | KEIAACEMIPDPEDLESRLLKEVEEGTGLRGDTIIAFPLAA* |
| Ga0079222_117590272 | 3300006755 | Agricultural Soil | LNFQGATNQEIAACEMEVDPDDLEPKLIKEAEKNAGARGQTIVAFSMAG* |
| Ga0066660_105222831 | 3300006800 | Soil | IAVCEMTPDPDDLESALLQEVEKNAGVRGNTIIAFCLSSD* |
| Ga0099828_101648211 | 3300009089 | Vadose Zone Soil | VAACEMQPDPENLESTLVRELEMSSGLAGHTIVAFCLAS* |
| Ga0099792_104608991 | 3300009143 | Vadose Zone Soil | IAACEMIPDPDDLESALVQELEEATGARGKTIIAFALAR* |
| Ga0116225_12976182 | 3300009524 | Peatlands Soil | CFQGATDAEIAACEMNPDPDDLESALIAELEKATGARGRTIVAFCLAS* |
| Ga0116125_10220501 | 3300009628 | Peatland | LCFQGASDQEIAACEMKPDPDDLESSVLKEIEKRTGKHGNTIIAYALAR* |
| Ga0116228_107520541 | 3300009701 | Host-Associated | IPDPDDLESTLLEQLERQGGATGNTIVAFALRDQTQT* |
| Ga0116101_10781601 | 3300009759 | Peatland | EMKPDPDDLESSVLKEIEKRTGKHGNTIIAYALAR* |
| Ga0116134_13256022 | 3300009764 | Peatland | ATNQEIAACEMKPDPDDLESGLLEQLETSTGTRGGTIIAFCLAS* |
| Ga0116223_108399282 | 3300009839 | Peatlands Soil | EQIAACEMKPDPDDLESDLVEELEMTTGTRGNTIIAFCLAS* |
| Ga0126373_103767151 | 3300010048 | Tropical Forest Soil | IAACEMIPDPDDLEGPLVAKAEKSSGRNGETIIALCLAS* |
| Ga0126373_113538463 | 3300010048 | Tropical Forest Soil | FQGASDEQIAACEMIPDPDDLESKLLERVEQNTGKRGNTTIAFCLGT* |
| Ga0126373_131763192 | 3300010048 | Tropical Forest Soil | ASDEEIAACEMTPDPDNLEEVLVKDVEQVVGVRGNTIVAFCLASPPR* |
| Ga0074046_101290781 | 3300010339 | Bog Forest Soil | MTPDPDDLESELLKDLEDSRGIRGKTIIAFCLAS* |
| Ga0074044_105241942 | 3300010343 | Bog Forest Soil | YHGASDEEIAACEMKPDPDDLESALVMEVEESEGVRGDTIVAFCLAR* |
| Ga0126372_113951402 | 3300010360 | Tropical Forest Soil | AACEMVPDPDDMESGLVREVENRTGERGETIVAFALAG* |
| Ga0126378_118871022 | 3300010361 | Tropical Forest Soil | GCEMIPDPDDLESRLLHEVEEGTGRRGDTIVAFALAA* |
| Ga0136449_1022603762 | 3300010379 | Peatlands Soil | EIAACEMNADPENLESTLVEELEKSTGAHGQTIVAFCLAS* |
| Ga0136449_1028321301 | 3300010379 | Peatlands Soil | DKEIAACEMKPDPYDLESRLLEHLEKSSGKRGNTIIAFCLAS* |
| Ga0150983_108605263 | 3300011120 | Forest Soil | ASDQEIAACEMTPDPDDLESDVLKKLEDSTGTRGDTIIAFCLAS* |
| Ga0137388_120044232 | 3300012189 | Vadose Zone Soil | ACEMPVDPGGLEPVLLEELEKTTGTRGETIVAFCVSQ* |
| Ga0137363_101602522 | 3300012202 | Vadose Zone Soil | EMVPDPDDLESALLQQLERTTGLREETIVAFALAR* |
| Ga0137399_117563322 | 3300012203 | Vadose Zone Soil | EEIAACEMKPDPDDLESALLQEVEKNTGVRGNTIIAFCLSSD* |
| Ga0137366_100691671 | 3300012354 | Vadose Zone Soil | IAACEMKPDPDDMESRLLEELENSTGASGNTIIAFCLAS* |
| Ga0137385_115951001 | 3300012359 | Vadose Zone Soil | MVPDPDDLESALLQQLERTTGVRGETIVAFALAR* |
| Ga0137360_107435661 | 3300012361 | Vadose Zone Soil | ASCEMVPDPDDLESALLQQLERTTGLREETIVAFALAR* |
| Ga0137390_111895572 | 3300012363 | Vadose Zone Soil | CFKGASNKEIAACEMKPDPDDLELVLLEEIEKSTGVRGNTIIAFCLASE* |
| Ga0137416_106385613 | 3300012927 | Vadose Zone Soil | PDDLESVLLKELEIDSGRSGPTIIAFALASESRD* |
| Ga0137404_115119481 | 3300012929 | Vadose Zone Soil | IASREMVPDPGDLESTLLQQLERTTGVRGETIVAFALAR* |
| Ga0126369_109154591 | 3300012971 | Tropical Forest Soil | VAACEMVPDPDDMESHLLREIERSTGKRGETIVAFALAA* |
| Ga0181523_103123113 | 3300014165 | Bog | FQGASDEEIAACEMIPDPADLESRLLANLEKGTGARGNTIIAFCLAS* |
| Ga0181537_100333584 | 3300014201 | Bog | ACEMKPDPDDLESVLVKEVESSTGVRGDTIIAFCLAR* |
| Ga0181537_110380012 | 3300014201 | Bog | LCYHGASDEEIAACEMKPDPNGLESALLKTVEARVGTRGNTIIAFCLAS* |
| Ga0182016_105613352 | 3300014493 | Bog | CFKGATDEEIAACELKPDPDDLESALLKKYEKAAGTPGNTIIAFCLAS* |
| Ga0182015_104014461 | 3300014495 | Palsa | HGATDEEIAACEMNPDPGDLESALLEKLEKNTVTRGNTIIAFCLAQ* |
| Ga0182024_120045191 | 3300014501 | Permafrost | QEIAACEMKPDPDDLESRLLEELETNTKTHGNTIIAFCLAS* |
| Ga0137411_13178273 | 3300015052 | Vadose Zone Soil | MVVDPQDVESKLLRDVERSNGVRGETIVAFALGR* |
| Ga0132256_1023729121 | 3300015372 | Arabidopsis Rhizosphere | PDDLESDLLDKVEKGKGRRGSTIVAFCLASPSGT* |
| Ga0187801_100549532 | 3300017933 | Freshwater Sediment | QGATDEEIAACEMKPDPDDLESALLKKLESSTGARGETIVAFCLAS |
| Ga0187801_103347402 | 3300017933 | Freshwater Sediment | FQGATDAEIAACEMNPDPDDLESALLAELEKATGARGRTIVAFCLAS |
| Ga0187850_103143872 | 3300017941 | Peatland | CEMKPDPDDLESALLEKLEKAAGKAGNTIIAFCLAS |
| Ga0187808_103842551 | 3300017942 | Freshwater Sediment | SATDEEIAACEMNADAENLESTLVEELEKSTGAHGQTIVAFCLAS |
| Ga0187819_104360292 | 3300017943 | Freshwater Sediment | CYQGATDEEIAACEMKPDPDDLESALLKKLESSTGNRGETIVAFCLAS |
| Ga0187819_105618732 | 3300017943 | Freshwater Sediment | ACEMIPDPDDLESRLLRDLEQRSGRRGNTIIAFCLAK |
| Ga0187847_106132832 | 3300017948 | Peatland | CEMKPDPDDLESSVLKEIEKRTGKHGNTIIAYALAR |
| Ga0187817_102978252 | 3300017955 | Freshwater Sediment | ATDEEIAACEMKPDPDDLESALLKKLESSTGARGETIVAFCLAS |
| Ga0187783_111817321 | 3300017970 | Tropical Peatland | SGIGVCQLCFQGASEEQIAACEMIPDPDDLESKLVERVERNTGKRGNTMIAFCLGT |
| Ga0187810_104131291 | 3300018012 | Freshwater Sediment | EIAACEMKPDPADLESALLKKLESSTGHRGETIVAFCLAS |
| Ga0187859_104280171 | 3300018047 | Peatland | QEIAACEMNPDPDNLESALVEEIEKATGVHGRTIVAFCLAS |
| Ga0187771_102200841 | 3300018088 | Tropical Peatland | SEEEIAACEMIPDPDDLESRVQEKVEKSSGRRGDTIIAFCLAS |
| Ga0182025_10451412 | 3300019786 | Permafrost | EMKPDPEDLESVLLEKLEKATESKGKTIIAFCLAS |
| Ga0210407_101930141 | 3300020579 | Soil | SDQEIAACEMKPDPDGLEARLLEELERSTGARGNTIIAFCLAS |
| Ga0210407_101948521 | 3300020579 | Soil | EVIAACEIKPDPEDLESELLEEIERSSGVRGNTIIAFCLGS |
| Ga0210407_108766421 | 3300020579 | Soil | GASEDEIAACEMNPDPADLESALVQELEKATGARGRTIVAFCLAP |
| Ga0210399_102718582 | 3300020581 | Soil | EIAACEMNPDPDDLESALIAELEKATGARGRTIVAFCLAS |
| Ga0210399_105461931 | 3300020581 | Soil | DEQIAACEMKPDPDDLESALLKRLEDNTGVRGNTIIAFCLAR |
| Ga0215015_105361231 | 3300021046 | Soil | MKPDPDDLESALLEEIETSTGVRGNTIIAFCLASDQIE |
| Ga0210404_100322301 | 3300021088 | Soil | CFQGASDKEIAACEMKPDPDDLESRLLAELEKSAGTRGNTIIAFCLAS |
| Ga0210404_103292102 | 3300021088 | Soil | CFQGATDREIAACEMKPDPGDLESSLLKEVEERIGKRGNTIIAFAMAS |
| Ga0210404_104269521 | 3300021088 | Soil | CYQGFSEKEIAACEMIPDPEDLESRLLKDAEKSTGRRGDTIIAFPLAT |
| Ga0210400_114845951 | 3300021170 | Soil | GASDEEIAACEMIHDPDDLESRLLAELEKKAGARGNTIIAFCLAS |
| Ga0210408_103034902 | 3300021178 | Soil | GDKEIAACEMNADPEDLESTLVEELEKNTGARGQTIVAFCLAS |
| Ga0210408_103720621 | 3300021178 | Soil | IDQQIAACEMKPDPDDLESRLLAELEKKTGKHGNTIIAFCLAS |
| Ga0210396_103404092 | 3300021180 | Soil | SEEEIAACEMKPDLDDLESSLLEELEKNSGKRGNTIVAYALA |
| Ga0210388_102220691 | 3300021181 | Soil | FQGATDAEIAACEMNPDPHDLESTLVEDVEKVTGVHGQTIVAFCLAS |
| Ga0210388_103711341 | 3300021181 | Soil | EMKPDPDNLESALLQDLEKTSGLRGETIIAFCLALD |
| Ga0210393_106344502 | 3300021401 | Soil | CATDEEIAACDMKPDPDDLESELVQEVEKATGVHGETIVAFCLAS |
| Ga0210389_102719071 | 3300021404 | Soil | CFQGASDKEIAACEMTPDPDDLESRLLKDLEKSTGRRGDTIIAFCLAS |
| Ga0210387_103630101 | 3300021405 | Soil | CELCYHGASEQEIAACEIKPDPEDHESALVERLEKSTGTSGNTIIAFCLGS |
| Ga0210387_110784292 | 3300021405 | Soil | DAEIAACEMRSDPEDLESALLRKLELTTGARGETIVAFCLAS |
| Ga0210383_104150961 | 3300021407 | Soil | ACEMKADPDDLESSLLKSLEDGTGTRGDTIIAWCLAS |
| Ga0210394_108699871 | 3300021420 | Soil | EKEIAACEMKPDPDDLEPRLLEELEANTGTHGNTIIAFCLAS |
| Ga0210384_102595301 | 3300021432 | Soil | IAACEMNPDPDDLESVLLEKLEKDTGVCGDTIIAFVMAHEP |
| Ga0210390_101971082 | 3300021474 | Soil | KEIAACEMTSDPDDLESCLLKELEKSTGRRGNTIIAFCLAS |
| Ga0210390_105185572 | 3300021474 | Soil | GATDEEIAACEMKPDPNDLESSLLEELESTTGSRGNTIIAFCLAS |
| Ga0210390_109270171 | 3300021474 | Soil | HGATNDEIAACEISADPDDLESTLLQEIEKATGVHGQTIVAFCLVS |
| Ga0210392_100257831 | 3300021475 | Soil | CFQGASDEEVARCEMKPDPDDLESRVLEELETSAGVEGNTIIAYCLAT |
| Ga0210398_100336491 | 3300021477 | Soil | YHGASDEEIAACEMKPDPDDLESALLKTVEASSGTPGNTIIAFCLAS |
| Ga0210398_103188422 | 3300021477 | Soil | GATDAEIAACEMNPDPDDLESALIAELEKATGARGRTIVAFCLAS |
| Ga0210402_112121871 | 3300021478 | Soil | PDEIASCEMEVDPDDLESPLLEQLRSKTGRDGETIVAFALTR |
| Ga0210410_104750163 | 3300021479 | Soil | SDEEVARCEMKPDPDDLESRVLEELETSAGVEGKTIIAYCLAT |
| Ga0210409_113807562 | 3300021559 | Soil | CFKGASDEVIAACEIKPDPEDLESELLEEIERSSGVRGNTIIAFCLGS |
| Ga0126371_131764922 | 3300021560 | Tropical Forest Soil | DPDDLETGLVEKVEKGIGKRGHTIVAFCLASAPDL |
| Ga0242662_100167091 | 3300022533 | Soil | KEIAACEMKPDPEDLESDVLSDFENSTGAHGRTIVAFGLVSLGD |
| Ga0212123_100564263 | 3300022557 | Iron-Sulfur Acid Spring | MKPDPDDLESALVKRLEDNGGVKGNTIIAFCLAPR |
| Ga0212123_105301511 | 3300022557 | Iron-Sulfur Acid Spring | CEISPDPNDLESTLVQEVEKATNAHGETIVAFCLAS |
| Ga0242657_10177372 | 3300022722 | Soil | FQGATDKEIAACEMTPDPDDLESRLLAELEKNTGRHGNTIIAFCLAC |
| Ga0224545_10688192 | 3300022881 | Soil | LCFHGATDEEIAACEINPDPDDLESTLVQEIEKASGAQGKTIVAFCLAS |
| Ga0233357_10381342 | 3300023056 | Soil | EMKPDPDDLESELLKKLEKSSGARGNTIIAFCLAS |
| Ga0224557_10474101 | 3300023101 | Soil | FQGATDEEIAACELNPDPEDLESTLVEEVEKSTAARGQTIVAFCLAS |
| Ga0224572_10677281 | 3300024225 | Rhizosphere | FQGATDTEIAACEMNPDPDDWESSLLKKLEKATGRKGNTIIAFCLDSSSRQIGF |
| Ga0208193_10163812 | 3300025463 | Peatland | GATDEEIARCEMKPDPDHLESGLVEQVESTTGVRGNTIVPFCLVS |
| Ga0208686_10861221 | 3300025500 | Peatland | FHGATNQEIAACEMKPDPDDLESGLLEQLETSTGTRGGTIIAFCLAS |
| Ga0207700_113341152 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ACEMKPDPDDLESKLLKEFEKKSGRKGNTIIAFALAKERD |
| Ga0209055_12052321 | 3300026309 | Soil | HGFSEKEIAACEMIPDPEDMESRLLKEVEKGTGFRGDTIIAFPLAA |
| Ga0208239_10280771 | 3300027168 | Forest Soil | KEIAACEMKPDPEDLESRLLEELEKSTGRRGNTIIAFCLAS |
| Ga0209220_12027202 | 3300027587 | Forest Soil | EEEIAACEMKPDPDDLESRLLEELEKNTATRGNTIIAFCLAS |
| Ga0209329_10919331 | 3300027605 | Forest Soil | GASDEMIASCEMNPDPDDLESALLKQLEAKTGLRGNTIIAFCLAS |
| Ga0209420_11915852 | 3300027648 | Forest Soil | CEMRPDPDDLESTLLEEVESANGVRGNTVVAFCLAS |
| Ga0209655_101964982 | 3300027767 | Bog Forest Soil | LCFQGATDAEIAACEMNPDPDDLESNLVEDVEKATGVHGQTIVAFCLAS |
| Ga0209656_104167091 | 3300027812 | Bog Forest Soil | HGASNEEIAACEMNPDPEDLESRLVEKLEKATGASGQTIVAFCLAS |
| Ga0209039_100565441 | 3300027825 | Bog Forest Soil | EMKPDPDDLESVLLEELEKSTGARGNTIIAFCLAS |
| Ga0209580_103073231 | 3300027842 | Surface Soil | GEITACEMRADPDDLEAKLLRELEKKTALRGNTIIAFCLADARR |
| Ga0209579_100179794 | 3300027869 | Surface Soil | TDQEIAACEMIPDPYDLESRLLRELEKRSGGCGNTLIAFCLAR |
| Ga0209380_106764551 | 3300027889 | Soil | EMNPDPDDLESALVYEVEEATGVRGQTIVAFCLAS |
| Ga0209624_103279111 | 3300027895 | Forest Soil | AACEMKPDPEDLESALLRKLEKGGETRGHTIIAHCLAS |
| Ga0265356_10150752 | 3300028017 | Rhizosphere | TNEEIAACEMKPDPDDLESRLLEELEASTGTRGNTIVAFCLASSEVDPT |
| Ga0265357_10416221 | 3300028023 | Rhizosphere | HGASEQEIAACEMKPDPDDLESRLLEELETNTETHGNTIIAFCLAS |
| Ga0302147_100791711 | 3300028566 | Bog | EIAACEMKPDPDDLESSVLQGVEENTGARGNTIIAFALRR |
| Ga0302152_100958951 | 3300028572 | Bog | AAHEMKPDPDDLESALLEKLERTTGDSGNTIIAFCLASS |
| Ga0302301_10956372 | 3300028731 | Palsa | GATDEEIAACEMKPDPDDLESALLQQLENTTGIHGNTIIAFCLASEPIK |
| Ga0302208_101508282 | 3300028774 | Fen | EIAACEMIPDPDDLEAELLQQLEKTTQARGETIVAFALAI |
| Ga0265338_102169582 | 3300028800 | Rhizosphere | CEMKPDPTDLESRLLKQFEKSTGKRGDTIIAFCLAS |
| Ga0311359_101867901 | 3300029914 | Bog | ELCFKGATDEEIAACELKPDPDDLESALLKKYEKAAGTPGNTIIAFCLAS |
| Ga0311342_106221912 | 3300029955 | Bog | EIAACEMKPDPDDLEEVLVKEVEAGTGVRGDTIIAFCLAR |
| Ga0302277_10680191 | 3300029982 | Bog | AACEMTPDPDDLESTLLKKVEDSTGLHGDTIIAFCLARREGES |
| Ga0302172_102397122 | 3300030003 | Fen | LCFQGATDEEIAACEMKPDPDDLESALVTQLEDTTNLRGNTIIAFCLAK |
| Ga0302281_101600941 | 3300030044 | Fen | DEEIAACEMTPDPDDLESTLLKKVEDSTGLHGDTIIAFCLARREGES |
| Ga0311353_115820202 | 3300030399 | Palsa | CEMKADPDDLESALLKRVEEATGARGETIIAFCLAS |
| Ga0310037_100411883 | 3300030494 | Peatlands Soil | LCFQGASDKEIASCEMKPDPDDLESRVLAELEKNTGQRGNTIIAFCLAS |
| Ga0310037_100640583 | 3300030494 | Peatlands Soil | AACEMNADPENLESALVEELEKTTGVHGQTIVAFCLAS |
| Ga0310037_102414022 | 3300030494 | Peatlands Soil | AACEMNPDPDDLESALIAELEKATGARGRTIVAFCLAS |
| Ga0302183_100392382 | 3300030509 | Palsa | ACEMKPDPDGFESALLKKVEAATGARGETIIAFCLAS |
| Ga0311372_109228761 | 3300030520 | Palsa | AACEMKPDPDDLESALLQQLENTTGIHGNTIIAFCLASEPIK |
| Ga0311366_109837492 | 3300030943 | Fen | ACEMIPDPDDLEAELLQQLEKTTQARGETIVAFALAI |
| Ga0265329_101983022 | 3300031242 | Rhizosphere | ASDKEIAACEMKPDPGDLESKLLKELEQTTGARGNTIIAYCLASDRGRM |
| Ga0170820_113610722 | 3300031446 | Forest Soil | FQGASDRAIAACEMKPDPDDLESRLLADLEKNTGMRGNTIIAFCLAS |
| Ga0170818_1058339671 | 3300031474 | Forest Soil | GASDRAIAACEMKPDPDDLESRLLADLEKNTGMRGNTIIAFCLAS |
| Ga0302326_107186932 | 3300031525 | Palsa | SDEEIAACEMTPDPDDLESTLLKKVEDSTGLHGDTIIAFCLARREGES |
| Ga0310686_1060965621 | 3300031708 | Soil | LCYHGASDEEIAACEMKPDPDDMESALLKTVEDNTGTRGDTVVAFCLAS |
| Ga0307476_106313011 | 3300031715 | Hardwood Forest Soil | VDPDDLESVLVQEMENAHGPTGDTIVAFALAAREK |
| Ga0307469_124024991 | 3300031720 | Hardwood Forest Soil | SCEMIPDPDDLESALLQKLEKDTGVRGDTIVAFALAR |
| Ga0310912_111968831 | 3300031941 | Soil | CEMVADPDDLESRLVEQAEKKAGVTGETIVAFCLAL |
| Ga0310912_113283331 | 3300031941 | Soil | ATCEMVPDPDDLESRLLRDVDTSLGKSGDTIVAFVLAG |
| Ga0307479_105680831 | 3300031962 | Hardwood Forest Soil | ELCYHGASDVEIAACEMNPDPDDLESELLKKVEDSTRMRGNTIIAFALSSDVVRNAKQKR |
| Ga0311301_129697881 | 3300032160 | Peatlands Soil | EMKPDPDDLESRLLVQLEKNAGARGNTIIAFCLAP |
| Ga0307471_1022042632 | 3300032180 | Hardwood Forest Soil | CFEGATNEEIAACEMKPHHDNLESALVEELRKTAGIGGETIIAFALARDESTHRL |
| Ga0335079_113120712 | 3300032783 | Soil | DEQIAACEMIPDPEDLESRLVEQVETATGRRGNTIIAFCLIS |
| Ga0335078_119051411 | 3300032805 | Soil | ISACEMIPDPDDLESELLERFEKKTGRRGKTIIAFCLTCQ |
| Ga0335069_108357881 | 3300032893 | Soil | EIAACEIIPDSDDLESRLLREVRRSTGRRGDTIVAFALAA |
| Ga0335076_103392351 | 3300032955 | Soil | MTPDPENLESSLLKKLEKQTGARGNTIVAWCLAHEPR |
| Ga0335077_103197481 | 3300033158 | Soil | EMKPDPEDLESDLLSELEKSTGARGETIVAFCLASSLET |
| Ga0334792_067479_924_1058 | 3300033888 | Soil | ATDEEIAACGINPDPDDLESTLVQEIEKASGAQGKTIVAFCLAS |
| ⦗Top⦘ |