


| Basic Information | |
|---|---|
| Family ID | F037836 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKK |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.06 % |
| % of genes near scaffold ends (potentially truncated) | 94.01 % |
| % of genes from short scaffolds (< 2000 bps) | 93.41 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.072 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.551 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.725 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01165 | Ribosomal_S21 | 11.98 |
| PF05362 | Lon_C | 1.80 |
| PF00313 | CSD | 1.80 |
| PF00343 | Phosphorylase | 1.20 |
| PF00140 | Sigma70_r1_2 | 1.20 |
| PF00571 | CBS | 1.20 |
| PF05598 | DUF772 | 1.20 |
| PF07750 | GcrA | 1.20 |
| PF03979 | Sigma70_r1_1 | 0.60 |
| PF07508 | Recombinase | 0.60 |
| PF03006 | HlyIII | 0.60 |
| PF13185 | GAF_2 | 0.60 |
| PF12769 | PNTB_4TM | 0.60 |
| PF07369 | DUF1488 | 0.60 |
| PF01734 | Patatin | 0.60 |
| PF00027 | cNMP_binding | 0.60 |
| PF00982 | Glyco_transf_20 | 0.60 |
| PF04986 | Y2_Tnp | 0.60 |
| PF13333 | rve_2 | 0.60 |
| PF00271 | Helicase_C | 0.60 |
| PF13581 | HATPase_c_2 | 0.60 |
| PF02190 | LON_substr_bdg | 0.60 |
| PF13763 | DUF4167 | 0.60 |
| PF13683 | rve_3 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 11.98 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 1.80 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.80 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 1.80 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 1.80 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 1.80 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 1.20 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 1.20 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.60 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.60 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.60 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.60 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.60 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.07 % |
| Unclassified | root | N/A | 35.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1059847 | Not Available | 582 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1005454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2425 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109204374 | Not Available | 647 | Open in IMG/M |
| 3300004479|Ga0062595_102187611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 541 | Open in IMG/M |
| 3300004479|Ga0062595_102289083 | Not Available | 532 | Open in IMG/M |
| 3300005332|Ga0066388_106263868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300005332|Ga0066388_106879332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 572 | Open in IMG/M |
| 3300005332|Ga0066388_108521577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 510 | Open in IMG/M |
| 3300005556|Ga0066707_10913713 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005557|Ga0066704_10072482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2219 | Open in IMG/M |
| 3300005713|Ga0066905_100288888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1281 | Open in IMG/M |
| 3300005713|Ga0066905_101373527 | Not Available | 638 | Open in IMG/M |
| 3300005713|Ga0066905_102126428 | Not Available | 522 | Open in IMG/M |
| 3300005764|Ga0066903_100637231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1859 | Open in IMG/M |
| 3300005764|Ga0066903_102275882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300006032|Ga0066696_10327191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300006046|Ga0066652_101131051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300006059|Ga0075017_100300461 | Not Available | 1185 | Open in IMG/M |
| 3300006102|Ga0075015_100102507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1439 | Open in IMG/M |
| 3300006176|Ga0070765_100216695 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300006176|Ga0070765_102131336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 523 | Open in IMG/M |
| 3300006796|Ga0066665_10822404 | Not Available | 730 | Open in IMG/M |
| 3300006796|Ga0066665_11637379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300006800|Ga0066660_11148184 | Not Available | 612 | Open in IMG/M |
| 3300006847|Ga0075431_100734125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 964 | Open in IMG/M |
| 3300007076|Ga0075435_100710679 | Not Available | 874 | Open in IMG/M |
| 3300009156|Ga0111538_12053118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300009177|Ga0105248_12120360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300009522|Ga0116218_1260278 | Not Available | 779 | Open in IMG/M |
| 3300009522|Ga0116218_1325752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300009525|Ga0116220_10281282 | Not Available | 730 | Open in IMG/M |
| 3300009698|Ga0116216_10207161 | Not Available | 1202 | Open in IMG/M |
| 3300009808|Ga0105071_1085511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300010358|Ga0126370_12141990 | Not Available | 550 | Open in IMG/M |
| 3300010361|Ga0126378_12433122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300010361|Ga0126378_12812334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300010366|Ga0126379_10820338 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300010376|Ga0126381_104558662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010398|Ga0126383_12605606 | Not Available | 589 | Open in IMG/M |
| 3300010398|Ga0126383_13479009 | Not Available | 514 | Open in IMG/M |
| 3300010880|Ga0126350_10063161 | Not Available | 507 | Open in IMG/M |
| 3300011271|Ga0137393_10558623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 982 | Open in IMG/M |
| 3300011271|Ga0137393_11062106 | Not Available | 688 | Open in IMG/M |
| 3300011420|Ga0137314_1163959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300012010|Ga0120118_1050323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga arsenatis | 1052 | Open in IMG/M |
| 3300012096|Ga0137389_10430138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1129 | Open in IMG/M |
| 3300012137|Ga0137346_1041301 | Not Available | 619 | Open in IMG/M |
| 3300012189|Ga0137388_10613895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300012201|Ga0137365_10804891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300012209|Ga0137379_11318494 | Not Available | 627 | Open in IMG/M |
| 3300012285|Ga0137370_10386511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300012358|Ga0137368_10181227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1519 | Open in IMG/M |
| 3300012361|Ga0137360_10817063 | Not Available | 802 | Open in IMG/M |
| 3300012469|Ga0150984_101152149 | Not Available | 584 | Open in IMG/M |
| 3300012685|Ga0137397_11338502 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012922|Ga0137394_10707012 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012923|Ga0137359_11628246 | Not Available | 533 | Open in IMG/M |
| 3300012925|Ga0137419_11519749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300012944|Ga0137410_10202834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1536 | Open in IMG/M |
| 3300012986|Ga0164304_10969115 | Not Available | 671 | Open in IMG/M |
| 3300012989|Ga0164305_10890056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300014325|Ga0163163_11210912 | Not Available | 818 | Open in IMG/M |
| 3300015371|Ga0132258_11568043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1663 | Open in IMG/M |
| 3300015372|Ga0132256_103210187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300015373|Ga0132257_103148212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300016294|Ga0182041_10847135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300016319|Ga0182033_12108550 | Not Available | 514 | Open in IMG/M |
| 3300016341|Ga0182035_11199741 | Not Available | 678 | Open in IMG/M |
| 3300016341|Ga0182035_12132523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300016371|Ga0182034_11399724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 611 | Open in IMG/M |
| 3300016387|Ga0182040_11824562 | Not Available | 521 | Open in IMG/M |
| 3300016404|Ga0182037_11396560 | Not Available | 619 | Open in IMG/M |
| 3300016422|Ga0182039_10868066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300016422|Ga0182039_11622956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300016422|Ga0182039_11675674 | Not Available | 581 | Open in IMG/M |
| 3300016422|Ga0182039_12112593 | Not Available | 519 | Open in IMG/M |
| 3300016445|Ga0182038_10222590 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300016445|Ga0182038_12127582 | Not Available | 509 | Open in IMG/M |
| 3300017822|Ga0187802_10367559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300018056|Ga0184623_10440403 | Not Available | 566 | Open in IMG/M |
| 3300018422|Ga0190265_13806951 | Not Available | 503 | Open in IMG/M |
| 3300018433|Ga0066667_10996482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300018468|Ga0066662_10759179 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300020015|Ga0193734_1080994 | Not Available | 558 | Open in IMG/M |
| 3300021344|Ga0193719_10036904 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300021401|Ga0210393_10249572 | Not Available | 1439 | Open in IMG/M |
| 3300021402|Ga0210385_10104240 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300021411|Ga0193709_1101764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300021433|Ga0210391_10207017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1543 | Open in IMG/M |
| 3300025846|Ga0209538_1209265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 723 | Open in IMG/M |
| 3300025862|Ga0209483_1077450 | Not Available | 1497 | Open in IMG/M |
| 3300025888|Ga0209540_10148068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300025915|Ga0207693_10266567 | Not Available | 1342 | Open in IMG/M |
| 3300025928|Ga0207700_11646715 | Not Available | 567 | Open in IMG/M |
| 3300026277|Ga0209350_1086595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300026309|Ga0209055_1123292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 977 | Open in IMG/M |
| 3300026532|Ga0209160_1077162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1773 | Open in IMG/M |
| 3300026879|Ga0207763_1005000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1466 | Open in IMG/M |
| 3300027313|Ga0207780_1082690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300027645|Ga0209117_1135317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300027875|Ga0209283_10803243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300027882|Ga0209590_10933030 | Not Available | 545 | Open in IMG/M |
| 3300027907|Ga0207428_10620713 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300028711|Ga0307293_10192140 | Not Available | 650 | Open in IMG/M |
| 3300028717|Ga0307298_10191177 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300028784|Ga0307282_10341926 | Not Available | 723 | Open in IMG/M |
| 3300028799|Ga0307284_10447329 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028881|Ga0307277_10029253 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
| 3300028884|Ga0307308_10192634 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300029636|Ga0222749_10687471 | Not Available | 560 | Open in IMG/M |
| 3300030730|Ga0307482_1162001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300030905|Ga0308200_1064243 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300030989|Ga0308196_1030680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300031090|Ga0265760_10283581 | Not Available | 583 | Open in IMG/M |
| 3300031561|Ga0318528_10402670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 735 | Open in IMG/M |
| 3300031573|Ga0310915_10870239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300031573|Ga0310915_11249904 | Not Available | 512 | Open in IMG/M |
| 3300031640|Ga0318555_10296873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300031668|Ga0318542_10338232 | Not Available | 773 | Open in IMG/M |
| 3300031719|Ga0306917_10302619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1235 | Open in IMG/M |
| 3300031719|Ga0306917_10852728 | Not Available | 713 | Open in IMG/M |
| 3300031723|Ga0318493_10385560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300031740|Ga0307468_101779408 | Not Available | 583 | Open in IMG/M |
| 3300031744|Ga0306918_10124253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1874 | Open in IMG/M |
| 3300031748|Ga0318492_10020849 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
| 3300031770|Ga0318521_10376794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300031771|Ga0318546_11023646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 581 | Open in IMG/M |
| 3300031778|Ga0318498_10507992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300031792|Ga0318529_10099112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300031795|Ga0318557_10123253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium | 1160 | Open in IMG/M |
| 3300031805|Ga0318497_10880339 | Not Available | 503 | Open in IMG/M |
| 3300031832|Ga0318499_10176570 | Not Available | 833 | Open in IMG/M |
| 3300031845|Ga0318511_10323634 | Not Available | 699 | Open in IMG/M |
| 3300031879|Ga0306919_10493707 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300031879|Ga0306919_11178300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300031880|Ga0318544_10375591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031894|Ga0318522_10382620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300031910|Ga0306923_11201900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300031910|Ga0306923_12228912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031941|Ga0310912_10204670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1509 | Open in IMG/M |
| 3300031941|Ga0310912_11527205 | Not Available | 502 | Open in IMG/M |
| 3300031942|Ga0310916_10624666 | Not Available | 915 | Open in IMG/M |
| 3300031942|Ga0310916_10835073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300031945|Ga0310913_10455543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300031946|Ga0310910_11173008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300031947|Ga0310909_11223217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300031954|Ga0306926_11718704 | Not Available | 715 | Open in IMG/M |
| 3300031954|Ga0306926_12273770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300031959|Ga0318530_10183287 | Not Available | 856 | Open in IMG/M |
| 3300031959|Ga0318530_10481241 | Not Available | 515 | Open in IMG/M |
| 3300031981|Ga0318531_10087969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
| 3300032001|Ga0306922_10537433 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300032001|Ga0306922_10700001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300032035|Ga0310911_10376656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300032042|Ga0318545_10093646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300032060|Ga0318505_10230356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300032066|Ga0318514_10405542 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032160|Ga0311301_10213421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3274 | Open in IMG/M |
| 3300032261|Ga0306920_100692318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1502 | Open in IMG/M |
| 3300032261|Ga0306920_103461435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300033290|Ga0318519_10069067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1827 | Open in IMG/M |
| 3300034148|Ga0364927_0132264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.19% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.20% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.60% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.60% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012137 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10598472 | 3300000580 | Forest Soil | MASKTQETSQKEEMLEKEGPETLPDSPLLDVSDPA |
| AF_2010_repII_A100DRAFT_10054541 | 3300000655 | Forest Soil | MASKTQETPQKEPEKEGPETLPDSPRLDLSDAAIKELIRSAK |
| JGIcombinedJ13530_1092043741 | 3300001213 | Wetland | MATKTDKTPQEDELPEKRGPESPPDSPLLDLSDAAVK |
| Ga0062595_1021876111 | 3300004479 | Soil | MTSNTEVMPQKEEVPETEGLETPPDRPVLDLSGAAIKALIRSASTR |
| Ga0062595_1022890832 | 3300004479 | Soil | VERLMASKTNATPQQEEVPNKEGSETPPDSPLLDLSGAAV |
| Ga0066388_1062638682 | 3300005332 | Tropical Forest Soil | VWRLMASTTEETPQKEEMPEKEGPETLPDSPLLDLSDAAV |
| Ga0066388_1068793322 | 3300005332 | Tropical Forest Soil | MASHTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRSA |
| Ga0066388_1085215771 | 3300005332 | Tropical Forest Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRS |
| Ga0066707_109137132 | 3300005556 | Soil | MARKTRVTPQKVQLPEKEGPETPSESPLLDLSDAAVKK |
| Ga0066704_100724824 | 3300005557 | Soil | MASKTKETPQKQEMPEKEGPETLPDSPLLDLSDAAVKK |
| Ga0066905_1002888881 | 3300005713 | Tropical Forest Soil | MASKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVK |
| Ga0066905_1013735273 | 3300005713 | Tropical Forest Soil | MASKTEETPQKEEMPEKAGPETPPDDLSDAAIAKL |
| Ga0066905_1021264281 | 3300005713 | Tropical Forest Soil | MASKTEETPQKEEMLETEGPLLSLSDGAVRELARFGKKHGYVTSDQINSVLP |
| Ga0066903_1006372311 | 3300005764 | Tropical Forest Soil | MASKTEKTPQKEEMPEKAGPETLPHDLSDAAITKLIRS |
| Ga0066903_1022758821 | 3300005764 | Tropical Forest Soil | MASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAVRE |
| Ga0066696_103271913 | 3300006032 | Soil | MASNTKMTPLKEEVLEKEGSEIRPDSPLLDLSDAAIKKL |
| Ga0066652_1011310511 | 3300006046 | Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAA |
| Ga0075017_1003004612 | 3300006059 | Watersheds | MASKIKVMPQKEEMLEKEDPETQSDRPLLDLSAAAVKELI |
| Ga0075015_1001025071 | 3300006102 | Watersheds | MASKTKVTPQKEEMPEKEGPETSPDGPLLDLLENRTVRLRRGGAH |
| Ga0070765_1002166953 | 3300006176 | Soil | MAGKIVVTPLKEEMLEKEGPEAPPDSPLLDLSDMAV |
| Ga0070765_1021313361 | 3300006176 | Soil | MASKIKVMPQKEEMLEKDGPETQSDRPLLDLSAVAVKELIRNA |
| Ga0066665_108224041 | 3300006796 | Soil | MASKTEKTPQKEEMLEKDGPETLPDSPLLELSDPAVKELIRSLQAR* |
| Ga0066665_116373792 | 3300006796 | Soil | MAGKTKATPRKDEVPDKEGPDTSPDSPLLDLSDAAVK |
| Ga0066660_111481841 | 3300006800 | Soil | MTSKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVKE |
| Ga0075431_1007341253 | 3300006847 | Populus Rhizosphere | MAIKAKGTPQTEPVPATEGPETPPDRPLLDLLDAAVKKLIRTAK |
| Ga0075435_1007106794 | 3300007076 | Populus Rhizosphere | MANSTEATPQQNETEKEASETPDSPLPLLDLSDAAVKKLI |
| Ga0111538_120531183 | 3300009156 | Populus Rhizosphere | MAIKAKGTPQTEPVPATEGPETPPDRPLLDLLDAA |
| Ga0105248_121203602 | 3300009177 | Switchgrass Rhizosphere | MASNNMTPLKKEVLEKEGHEIRPDSSLLDLSDAAIEKLIRSAKKS |
| Ga0116218_12602781 | 3300009522 | Peatlands Soil | MASKTKVKPQKEGIPEKEGSGTPLDRPLFDLSDAA |
| Ga0116218_13257522 | 3300009522 | Peatlands Soil | MTSKINVTSQKEEMREKEGPETQSDRPLLDLSAVA |
| Ga0116220_102812821 | 3300009525 | Peatlands Soil | MASKTEVKGQKHATPEREGHETPPDGPLLDLSDAAIKK |
| Ga0116216_102071611 | 3300009698 | Peatlands Soil | MASKIKVMPQKEEMLEQEDPETQSDRPVLDLSAAVK |
| Ga0105071_10855111 | 3300009808 | Groundwater Sand | MASKTEVTPRKEEVPEKEGPETPPDSPLVDLSNAA |
| Ga0126370_121419901 | 3300010358 | Tropical Forest Soil | MASNIKATPQKEEVPEKEGPETLPDSPLLDLFDAAV |
| Ga0126378_124331221 | 3300010361 | Tropical Forest Soil | MASKTEETPQKEEMLEIEGPETLPESPLLGISDGAVREL |
| Ga0126378_128123342 | 3300010361 | Tropical Forest Soil | MASNIRATSQKEDAPEKEGPETLPDSPLLLDPSDAAVKKLI |
| Ga0126379_108203382 | 3300010366 | Tropical Forest Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAI |
| Ga0126381_1045586621 | 3300010376 | Tropical Forest Soil | MASKIQETPQKGEIPEKEGPETLPDSPLLGLSDGAVRE |
| Ga0126383_126056062 | 3300010398 | Tropical Forest Soil | MASKSKPTLQKDEVPEKEDPEAPPDSPLLDLPGAAIRTLN* |
| Ga0126383_134790091 | 3300010398 | Tropical Forest Soil | MASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVR |
| Ga0126350_100631611 | 3300010880 | Boreal Forest Soil | MTSKTKVTPQKEEMLEKECLEGPPDSPPIDRLNDSVKALVRTAV |
| Ga0137393_105586233 | 3300011271 | Vadose Zone Soil | MASKTKVTRQKEEVPEKGGPETPPDSPLLDLSNAAVEVLI |
| Ga0137393_110621061 | 3300011271 | Vadose Zone Soil | MASSPKVTPQKDKVPEKGGSETPPDSPLLGLSDAAV |
| Ga0137314_11639591 | 3300011420 | Soil | MASKTKVTPQKEEMLEKEGPETLPGSPLLDLSNAAVKALI |
| Ga0120118_10503231 | 3300012010 | Permafrost | MASKTNATPQKEEVPKKEGPETPPDSPLLDLSDAAVKK |
| Ga0137389_104301382 | 3300012096 | Vadose Zone Soil | MARKTKVTPQKEEVPEKAGPETPPESSLLDLSAAAVKKLIR |
| Ga0137346_10413011 | 3300012137 | Soil | MASKSKVMPQKEEMLEKEGPETPPDSPLLDLSNAAVKAL |
| Ga0137388_106138953 | 3300012189 | Vadose Zone Soil | MASKTKMTRQKEEVPEKGGPETPPDSPLLDLSNAAV |
| Ga0137365_108048912 | 3300012201 | Vadose Zone Soil | MASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVREL |
| Ga0137379_113184941 | 3300012209 | Vadose Zone Soil | MASNTNMPPQNEDVPEKVGPDTSPDSPLLDLSDAAVKTL |
| Ga0137370_103865112 | 3300012285 | Vadose Zone Soil | MASKTEETPQKEEMPEMEGPETLPDSPLLGLADGAVRELVRC |
| Ga0137368_101812271 | 3300012358 | Vadose Zone Soil | MASKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVKE |
| Ga0137360_108170631 | 3300012361 | Vadose Zone Soil | MASKTKATPPHEEVLAKEGHESPPDRPLLDLSDAAV |
| Ga0150984_1011521491 | 3300012469 | Avena Fatua Rhizosphere | MASKTEVTPQKEEVPEKEGPETPPDSPLLDLSDVAIKK |
| Ga0137397_113385022 | 3300012685 | Vadose Zone Soil | MASKTEETPQKEEMPEKEGPETLSDSSLLDLSDAAVK |
| Ga0137394_107070122 | 3300012922 | Vadose Zone Soil | MATKINATPQKEEVPKKEGPETSPDNPPLDLSDSAVKKHI |
| Ga0137359_116282461 | 3300012923 | Vadose Zone Soil | MASSPKVTPPEDKVPEKGGSETPPDSPLLGLSDAAVKKLIRTAKK |
| Ga0137419_115197492 | 3300012925 | Vadose Zone Soil | MASKTEVTPQKEEVPEKEGPETPPDSPLLDLSDAAIKK |
| Ga0137410_102028344 | 3300012944 | Vadose Zone Soil | MASKTNATPRKEEVPNKEGPETPPDSPLLDLSGAA |
| Ga0164304_109691151 | 3300012986 | Soil | MASKTEETPQKEEMMEKDGPETLPDSTLLDPSDPAVKELIRS |
| Ga0164305_108900562 | 3300012989 | Soil | MASEIEETPQKEEMLEKDGPETLPDSPLLDLSDPAV |
| Ga0163163_112109122 | 3300014325 | Switchgrass Rhizosphere | MASKTEVAPQKEEVPEKEGPETPPDSPLLDLSDVAINKLV |
| Ga0132258_115680434 | 3300015371 | Arabidopsis Rhizosphere | MPSKTKVTPQKEPVLAKEGHETLPDRPLLDLLDAAVKKLIRTAK |
| Ga0132256_1032101871 | 3300015372 | Arabidopsis Rhizosphere | MPSKTKVTPQKEPVLAKEGPETLPDRPLLDLLDAAV |
| Ga0132257_1031482121 | 3300015373 | Arabidopsis Rhizosphere | MASKTNVTPQKEELEMEGPATPPDSPQLGLSNAAIKALIRTA* |
| Ga0182041_108471352 | 3300016294 | Soil | MASNTKRTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRS |
| Ga0182033_121085501 | 3300016319 | Soil | MASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAV |
| Ga0182035_111997411 | 3300016341 | Soil | MASKTKVTPQKEGAPEKEGADTLPDCPLLDLCDVAVK |
| Ga0182035_121325231 | 3300016341 | Soil | MASNTKMSPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLI |
| Ga0182034_113997242 | 3300016371 | Soil | MASKTKVTPQEGEVPETAGPKTPPDSPLLDLPDAAV |
| Ga0182040_118245621 | 3300016387 | Soil | MASKTEETPQKEKMPEKEGPDTLPDSPLLDPSDAAVK |
| Ga0182037_113965601 | 3300016404 | Soil | MASKTEETPQKEEMPEKDGPETLSDSPLRDLSDPAVKD |
| Ga0182039_108680661 | 3300016422 | Soil | MASNTKRTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIR |
| Ga0182039_116229561 | 3300016422 | Soil | MAKTEETPQKQEMLEKEGPETLPDSPLLDLSDPAV |
| Ga0182039_116756741 | 3300016422 | Soil | MASTSKVTPQKEEVPEKEGADTLPDCPLLDLSDAAVKK |
| Ga0182039_121125931 | 3300016422 | Soil | MASKVKMPPLKEEVLEKEGPEIRPDSPLLDLSDAAIK |
| Ga0182038_102225901 | 3300016445 | Soil | MASKTKVTPPEVEVPETAGPETPPDSPLLDLPDAAVKKLI |
| Ga0182038_121275821 | 3300016445 | Soil | MASKTKVTPQKEEVPEKVGADTLPDCPLLDLSDAAVKK |
| Ga0187802_103675591 | 3300017822 | Freshwater Sediment | MASKINVMPKEEMLEKEGPETQSDRPLLDLSAVAVKELI |
| Ga0184623_104404031 | 3300018056 | Groundwater Sediment | MASKTEVTPQKEEVLEKEGPETPPDSPLLDLSDVAIKKL |
| Ga0190265_138069511 | 3300018422 | Soil | MASKTKAMPQKEEAPEKEAGDSPDSPLLDLSDAAV |
| Ga0066667_109964821 | 3300018433 | Grasslands Soil | MASKTKITPQKEEMLEKEEGPETPPDRPLFDLWNASVKALIRTTKERG |
| Ga0066662_107591792 | 3300018468 | Grasslands Soil | MASNTNMPPQNEDVPEKVGPDTSPDSPLLDLSDAAV |
| Ga0193734_10809941 | 3300020015 | Soil | MASKAEVTPQKEEVLEKEGPETPPDSPLLDLSDAAI |
| Ga0193719_100369044 | 3300021344 | Soil | MANKTIATPQKEELPKKEGPETPPDSPPLDLSDAA |
| Ga0210393_102495721 | 3300021401 | Soil | MASKTKVTVQEEAVPPETEGATTLPDSPLLDVADGAV |
| Ga0210385_101042401 | 3300021402 | Soil | MASKTVVTPLKGEMLEKEGPEAPPDSPLLDLSDMA |
| Ga0193709_11017641 | 3300021411 | Soil | MASKTEVTPQKEEVAEKEGPETPPDSPLLDLSDVAI |
| Ga0210391_102070171 | 3300021433 | Soil | MASKTKVTPQKEVMLEKEGRETPPGSPLLDLSDAAVKKLI |
| Ga0209538_12092651 | 3300025846 | Arctic Peat Soil | MASKTNATPQKEEVPKKEGPETSPDSPLLDLSDAA |
| Ga0209483_10774501 | 3300025862 | Arctic Peat Soil | MASKTNATPKQEDVPKKEGTETPPDSPLLDLSDAAVKK |
| Ga0209540_101480681 | 3300025888 | Arctic Peat Soil | MASKTNATPQKEEVPKKEGPETSPGSPLLDLSDAAVKK |
| Ga0207693_102665672 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MASDTKATSQKEDLPEKETPESAPDSPLLDLSDAAVKKLI |
| Ga0207700_116467151 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MASKTDETPQGEEVLEKPLETPSDIPLLDLSDPAVGN |
| Ga0209350_10865952 | 3300026277 | Grasslands Soil | MASKTKETPQKEEMPEKEGRETLPDSPLLDLSDAAVKK |
| Ga0209055_11232922 | 3300026309 | Soil | MATKTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVKKLI |
| Ga0209160_10771623 | 3300026532 | Soil | MASKTKETPQKQEMPEKEGPETLPDSPLLDLSDAAVKKF |
| Ga0207763_10050003 | 3300026879 | Tropical Forest Soil | MASKAKMTRQKENVSEEGPETPPDNPLLDLSDAAVKKFIRAV |
| Ga0207780_10826901 | 3300027313 | Tropical Forest Soil | MASNTKMTPLKEEVLEKECPEIRPDSPLLDLSDAAIK |
| Ga0209117_11353172 | 3300027645 | Forest Soil | MASKTKVTPQKEEMLEKEGPETPPDSPLIDRSNASVKA |
| Ga0209283_108032431 | 3300027875 | Vadose Zone Soil | MANKTKVTPQKDKVPEKEGQETPSDSPLLDLSDAA |
| Ga0209590_109330301 | 3300027882 | Vadose Zone Soil | MASKTEETPQKEEMPEKEGPETLPDDLSDAAITKLIR |
| Ga0207428_106207131 | 3300027907 | Populus Rhizosphere | MANKTKVTPQKDKVPEKGGSETPPDSPLLDLVADLRAS |
| Ga0307293_101921401 | 3300028711 | Soil | MASKTEVTRQTQEASERDGRETPSDGPLLDLSDAAVKKLIHSA |
| Ga0307298_101911771 | 3300028717 | Soil | MANKTIATPEKEEVPKKEGPETPPDSPLLDLSDAAIKK |
| Ga0307282_103419262 | 3300028784 | Soil | VRAQRRLWRFMASNTDVTPQKEEVSKNEGPETPPDSPLL |
| Ga0307284_104473291 | 3300028799 | Soil | MANKTIATPQKEEVPKKEGPETPPDSPPLDLSDAAVKKLIR |
| Ga0307277_100292534 | 3300028881 | Soil | MATNTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVK |
| Ga0307308_101926343 | 3300028884 | Soil | MERLIATNATPQKKEAPKKEGPETPPDSPPLDLSDAAV |
| Ga0222749_106874711 | 3300029636 | Soil | MATNTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVKKLIRSAKK |
| Ga0307482_11620011 | 3300030730 | Hardwood Forest Soil | MASKIKVIPQKEEILEKEGPETQSDRTLLDLSAAAVKE |
| Ga0308200_10642432 | 3300030905 | Soil | MATKTNATPQKEEVPKKEGPETPPDSPPLYLSDSAVKKLI |
| Ga0308196_10306801 | 3300030989 | Soil | QPRLWRLMASKTEVTPQTEEVPEKEGLETPPDSPLLDLSDAAIK |
| Ga0265760_102835811 | 3300031090 | Soil | MASKIKVMPQKEEMLEKEGPETQSDRPLLDLSAAAVKVADPQRQ |
| Ga0318528_104026701 | 3300031561 | Soil | MASKIKVTPQKVEVPETAGLETPPDSPLLDLLDAAV |
| Ga0310915_108702391 | 3300031573 | Soil | MASKTEETPQKEEMPEMEGPETLPDSPLLGLSDGAV |
| Ga0310915_112499041 | 3300031573 | Soil | MVSKTGEMPQKEEMPEKEGPETLPDSPLLDLSDAAVK |
| Ga0318555_102968733 | 3300031640 | Soil | MASKTEETPQKEEMLEIEGPETLTDSPLLGLSDGAVRE |
| Ga0318542_103382321 | 3300031668 | Soil | MASKTEETSQKEEMPEMEGPETLPDSPLLGLSDGAVREL |
| Ga0306917_103026192 | 3300031719 | Soil | MASKTEETPQKEEMLEIEGPETLPESPLLGISDGAVRELVRSAKK |
| Ga0306917_108527281 | 3300031719 | Soil | MASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKKL |
| Ga0318493_103855601 | 3300031723 | Soil | MASKTQETPQKEPEKEGPETLPDSPRLDLSDAAIKELIR |
| Ga0307468_1017794081 | 3300031740 | Hardwood Forest Soil | MASKTEQTPQKQEMLEMEGPETLPDSPLLGLSDGAVRELVRFA |
| Ga0306918_101242534 | 3300031744 | Soil | MVSKTGEMPQKEEMPEKEGPETLPDSPLLDLSDAAVKK |
| Ga0318492_100208491 | 3300031748 | Soil | MASKTEETPQKEEMLEIKGPETLPESPLLGLSDGAVRELVRSAKKR |
| Ga0318521_103767942 | 3300031770 | Soil | MASKNEETPQKEEILEMEGAETLPERPLLGLSDGAVR |
| Ga0318546_110236462 | 3300031771 | Soil | MASKIKVTPQKVEVPETAGLETPPDSPLLDLLDAAVKNLIRSAEK |
| Ga0318498_105079921 | 3300031778 | Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAINK |
| Ga0318529_100991122 | 3300031792 | Soil | MASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVRELVRSAK |
| Ga0318557_101232532 | 3300031795 | Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDASIKKLIG |
| Ga0318576_103940593 | 3300031796 | Soil | MASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHR |
| Ga0318550_101159993 | 3300031797 | Soil | MASDTKATSHKEDLPEKETPESAPDRPLLDLSDAAVKKLIS |
| Ga0318497_108803391 | 3300031805 | Soil | MASKTKVTPQKEGAPEKEGADTLPDCPLLDLSDAVVKKLIR |
| Ga0318499_101765702 | 3300031832 | Soil | MASNIKTTPQKEEMKEGPETLPDSPLLELSDAAVKKL |
| Ga0318511_103236341 | 3300031845 | Soil | MASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAV |
| Ga0306919_104937073 | 3300031879 | Soil | MASHTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRSANK |
| Ga0306919_111783001 | 3300031879 | Soil | MASKTEETPQKEEMQEKEGPETLPDSPLLDLSDAAVKKL |
| Ga0318544_103755912 | 3300031880 | Soil | MASKTGETPQKEEMLEMEGPETLTDSPLPGLSDGAVRELVRSAKKRG |
| Ga0318522_103826201 | 3300031894 | Soil | MASKAKMTRQKENVSEEGPETPPDNPLLDLSDAAVKKHPRC |
| Ga0306923_112019001 | 3300031910 | Soil | MASKTEETPQKEEMLEMEGPETLPDSPLLGLSDRAVRELV |
| Ga0306923_122289121 | 3300031910 | Soil | MASKTEETPQKEEMPEKEGPETLPDSPLLGLSGGAVRELARSAK |
| Ga0310912_102046703 | 3300031941 | Soil | MASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKK |
| Ga0310912_115272051 | 3300031941 | Soil | MASKTEETPQKEEMPEKDGPETLSDSPLRDLSDPAVKDLIHS |
| Ga0310916_106246663 | 3300031942 | Soil | MASKAKLTLQKENVPEQEGPETPPDNPLLDLSDAAVKKFIRAV |
| Ga0310916_108350732 | 3300031942 | Soil | MASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIK |
| Ga0310913_104555432 | 3300031945 | Soil | MASKAKMTRQKENVSEEGPETPPDNPLLDLSDAVK |
| Ga0310910_111730082 | 3300031946 | Soil | MASKTEETPQKEEMLEMEGPETLPESPLLGLSDGA |
| Ga0310909_112232172 | 3300031947 | Soil | MASKTEETPQKEEMLEMEGPETLPDSPLLGLSDRAVREL |
| Ga0306926_117187041 | 3300031954 | Soil | MTSKTETPQKEEMLKKDGSETLPDSPLLDLSDPAVKELIRSAKK |
| Ga0306926_122737701 | 3300031954 | Soil | MASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAVREL |
| Ga0318530_101832871 | 3300031959 | Soil | MASKTEETSQKEEMPEKEGPETLPDSPLLDLSDAAVKK |
| Ga0318530_104812412 | 3300031959 | Soil | MASKTGETPQKEEMLEMEGPETLTDSPLPGLSDGAVRELVR |
| Ga0318531_100879693 | 3300031981 | Soil | MASKNEETPQKEEILEMEGAETLPERPLLGLSDGAV |
| Ga0306922_105374334 | 3300032001 | Soil | MASKTEETPQKEEMPEKEGPETLPDSPLLGPSDAAVKKL |
| Ga0306922_107000011 | 3300032001 | Soil | MAKTEETPQKQEMLEKEGPETLPDSPLLDLSDPAVPELIRSAK |
| Ga0310911_103766561 | 3300032035 | Soil | MASKTEETPQKEEMPEKGGPETLPHDLSGAAITKLIRS |
| Ga0318545_100936462 | 3300032042 | Soil | MASKTEETPQKEEMPEMEGPETLPDSPLLGLSDGAI |
| Ga0318505_102303562 | 3300032060 | Soil | MASKTEKTPQKEEMLEIEGPETLPESPLLGISDGAV |
| Ga0318514_104055421 | 3300032066 | Soil | MASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAVRELVRS |
| Ga0318553_102632933 | 3300032068 | Soil | MASDTKATSHKEDLPEKETPESAPDRPLLDLSDAA |
| Ga0318553_107376722 | 3300032068 | Soil | MASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHRQE |
| Ga0318540_105195221 | 3300032094 | Soil | MASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHRQET |
| Ga0311301_102134211 | 3300032160 | Peatlands Soil | MASKTKVTPQKEVMLEKEGRETPPGSPLLDLSDAAVKK |
| Ga0306920_1006923181 | 3300032261 | Soil | MASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAV |
| Ga0306920_1034614352 | 3300032261 | Soil | MASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAVRELVRSAK |
| Ga0318519_100690671 | 3300033290 | Soil | MASKTGETPQKEEMLEMEGPEALTDSPLLDLSDAAVR |
| Ga0364927_0132264_3_107 | 3300034148 | Sediment | MTSKTNVTPQKEEVPEKEGPETPPDGPLLDLSDAA |
| ⦗Top⦘ |