


| Basic Information | |
|---|---|
| Family ID | F037791 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.70 % |
| % of genes near scaffold ends (potentially truncated) | 48.50 % |
| % of genes from short scaffolds (< 2000 bps) | 85.03 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.898 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.784 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.144 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (24.551 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 13.77 |
| PF01268 | FTHFS | 5.99 |
| PF01593 | Amino_oxidase | 2.40 |
| PF13561 | adh_short_C2 | 1.80 |
| PF03631 | Virul_fac_BrkB | 1.80 |
| PF02777 | Sod_Fe_C | 1.20 |
| PF01258 | zf-dskA_traR | 1.20 |
| PF13193 | AMP-binding_C | 1.20 |
| PF02222 | ATP-grasp | 0.60 |
| PF01177 | Asp_Glu_race | 0.60 |
| PF08666 | SAF | 0.60 |
| PF00080 | Sod_Cu | 0.60 |
| PF07724 | AAA_2 | 0.60 |
| PF16916 | ZT_dimer | 0.60 |
| PF01135 | PCMT | 0.60 |
| PF13673 | Acetyltransf_10 | 0.60 |
| PF02897 | Peptidase_S9_N | 0.60 |
| PF07690 | MFS_1 | 0.60 |
| PF00561 | Abhydrolase_1 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 5.99 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.80 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.20 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.20 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.60 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.60 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.60 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.60 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.90 % |
| All Organisms | root | All Organisms | 49.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y01BUU8Z | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 649 | Open in IMG/M |
| 3300001991|JGI24743J22301_10054430 | Not Available | 818 | Open in IMG/M |
| 3300002908|JGI25382J43887_10126132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300004009|Ga0055437_10199130 | Not Available | 641 | Open in IMG/M |
| 3300004051|Ga0055492_10142720 | Not Available | 566 | Open in IMG/M |
| 3300004057|Ga0055496_10146770 | Not Available | 591 | Open in IMG/M |
| 3300004071|Ga0055486_10040814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300004079|Ga0055514_10134617 | Not Available | 655 | Open in IMG/M |
| 3300004463|Ga0063356_106112823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300004781|Ga0062379_10120383 | Not Available | 631 | Open in IMG/M |
| 3300005093|Ga0062594_100964511 | Not Available | 815 | Open in IMG/M |
| 3300005181|Ga0066678_10130958 | Not Available | 1551 | Open in IMG/M |
| 3300005186|Ga0066676_10312467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1043 | Open in IMG/M |
| 3300005347|Ga0070668_100253127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 1463 | Open in IMG/M |
| 3300005367|Ga0070667_100277300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 1505 | Open in IMG/M |
| 3300005438|Ga0070701_10271005 | Not Available | 1033 | Open in IMG/M |
| 3300005441|Ga0070700_101513860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300005445|Ga0070708_100000563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 27746 | Open in IMG/M |
| 3300005451|Ga0066681_10455774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300005454|Ga0066687_10066658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300005558|Ga0066698_10076282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2172 | Open in IMG/M |
| 3300005564|Ga0070664_101473155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 644 | Open in IMG/M |
| 3300005574|Ga0066694_10563509 | Not Available | 530 | Open in IMG/M |
| 3300005577|Ga0068857_101023082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300005598|Ga0066706_10266637 | Not Available | 1337 | Open in IMG/M |
| 3300005719|Ga0068861_100845232 | Not Available | 862 | Open in IMG/M |
| 3300005764|Ga0066903_100122365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3622 | Open in IMG/M |
| 3300005764|Ga0066903_100664244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1826 | Open in IMG/M |
| 3300005764|Ga0066903_104295407 | Not Available | 762 | Open in IMG/M |
| 3300005836|Ga0074470_10606544 | Not Available | 718 | Open in IMG/M |
| 3300005993|Ga0080027_10110083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium | 1038 | Open in IMG/M |
| 3300006032|Ga0066696_10304440 | Not Available | 1036 | Open in IMG/M |
| 3300006224|Ga0079037_100033222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3844 | Open in IMG/M |
| 3300006224|Ga0079037_100313367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1459 | Open in IMG/M |
| 3300006224|Ga0079037_101382330 | Not Available | 702 | Open in IMG/M |
| 3300006354|Ga0075021_10386102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300006572|Ga0074051_11560716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae | 573 | Open in IMG/M |
| 3300006572|Ga0074051_11633962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 622 | Open in IMG/M |
| 3300006581|Ga0074048_13278626 | Not Available | 656 | Open in IMG/M |
| 3300006603|Ga0074064_11642662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300006604|Ga0074060_11841685 | Not Available | 671 | Open in IMG/M |
| 3300006605|Ga0074057_12048663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 502 | Open in IMG/M |
| 3300006854|Ga0075425_102117646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300006871|Ga0075434_102543508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300006904|Ga0075424_100134903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2612 | Open in IMG/M |
| 3300007004|Ga0079218_10023091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3446 | Open in IMG/M |
| 3300007076|Ga0075435_100871929 | Not Available | 785 | Open in IMG/M |
| 3300009053|Ga0105095_10818442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300009089|Ga0099828_10736106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300009111|Ga0115026_10028244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2853 | Open in IMG/M |
| 3300009111|Ga0115026_10163440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1449 | Open in IMG/M |
| 3300009120|Ga0117941_1046577 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300009131|Ga0115027_10026758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2641 | Open in IMG/M |
| 3300009131|Ga0115027_10994592 | Not Available | 656 | Open in IMG/M |
| 3300009162|Ga0075423_12864838 | Not Available | 528 | Open in IMG/M |
| 3300009167|Ga0113563_10470270 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300009170|Ga0105096_10002931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 7597 | Open in IMG/M |
| 3300009177|Ga0105248_11668685 | Not Available | 722 | Open in IMG/M |
| 3300009179|Ga0115028_12082632 | Not Available | 503 | Open in IMG/M |
| 3300009870|Ga0131092_10917866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300010325|Ga0134064_10440943 | Not Available | 529 | Open in IMG/M |
| 3300010375|Ga0105239_10285548 | Not Available | 1858 | Open in IMG/M |
| 3300011444|Ga0137463_1120493 | Not Available | 987 | Open in IMG/M |
| 3300012133|Ga0137329_1044004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300012203|Ga0137399_10863586 | Not Available | 762 | Open in IMG/M |
| 3300012363|Ga0137390_11096188 | Not Available | 745 | Open in IMG/M |
| 3300012495|Ga0157323_1032499 | Not Available | 561 | Open in IMG/M |
| 3300013297|Ga0157378_11234568 | Not Available | 787 | Open in IMG/M |
| 3300013297|Ga0157378_11668119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300013306|Ga0163162_12975435 | Not Available | 545 | Open in IMG/M |
| 3300013315|Ga0173609_10383017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1320 | Open in IMG/M |
| 3300013769|Ga0119887_1043824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1298 | Open in IMG/M |
| 3300014303|Ga0075358_1046584 | Not Available | 722 | Open in IMG/M |
| 3300014305|Ga0075349_1012552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1511 | Open in IMG/M |
| 3300014315|Ga0075350_1037261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300014322|Ga0075355_1198779 | Not Available | 557 | Open in IMG/M |
| 3300014326|Ga0157380_11000729 | Not Available | 869 | Open in IMG/M |
| 3300014875|Ga0180083_1032133 | Not Available | 1033 | Open in IMG/M |
| 3300014969|Ga0157376_10401795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1325 | Open in IMG/M |
| 3300015075|Ga0167636_1021206 | Not Available | 883 | Open in IMG/M |
| 3300015252|Ga0180075_1034727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 786 | Open in IMG/M |
| 3300015264|Ga0137403_10658558 | Not Available | 909 | Open in IMG/M |
| 3300015371|Ga0132258_10150622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5578 | Open in IMG/M |
| 3300015371|Ga0132258_10974600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2142 | Open in IMG/M |
| 3300015372|Ga0132256_100253466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1830 | Open in IMG/M |
| 3300015372|Ga0132256_100615132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1201 | Open in IMG/M |
| 3300015372|Ga0132256_101628345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300015372|Ga0132256_102559678 | Not Available | 611 | Open in IMG/M |
| 3300015373|Ga0132257_103582849 | Not Available | 565 | Open in IMG/M |
| 3300017959|Ga0187779_11023060 | Not Available | 574 | Open in IMG/M |
| 3300018027|Ga0184605_10025938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2387 | Open in IMG/M |
| 3300018052|Ga0184638_1110981 | Not Available | 1004 | Open in IMG/M |
| 3300018053|Ga0184626_10000848 | All Organisms → cellular organisms → Bacteria | 10099 | Open in IMG/M |
| 3300018056|Ga0184623_10525130 | Not Available | 502 | Open in IMG/M |
| 3300018060|Ga0187765_11204784 | Not Available | 531 | Open in IMG/M |
| 3300018061|Ga0184619_10018571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2836 | Open in IMG/M |
| 3300018429|Ga0190272_11298488 | Not Available | 723 | Open in IMG/M |
| 3300018481|Ga0190271_13835589 | Not Available | 503 | Open in IMG/M |
| 3300018482|Ga0066669_11299974 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300019248|Ga0180117_1066200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300019887|Ga0193729_1196570 | Not Available | 691 | Open in IMG/M |
| 3300021316|Ga0210351_1345352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila | 591 | Open in IMG/M |
| 3300021473|Ga0194043_1248816 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300022185|Ga0079039_1306718 | Not Available | 502 | Open in IMG/M |
| 3300022214|Ga0224505_10265602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300022756|Ga0222622_10714272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300025848|Ga0208005_1166191 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025907|Ga0207645_10026129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3775 | Open in IMG/M |
| 3300025956|Ga0210104_1000973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3765 | Open in IMG/M |
| 3300025956|Ga0210104_1002797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2143 | Open in IMG/M |
| 3300025958|Ga0210069_1005224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1687 | Open in IMG/M |
| 3300025968|Ga0210103_1059293 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026072|Ga0208292_1015803 | Not Available | 946 | Open in IMG/M |
| 3300026075|Ga0207708_10889193 | Not Available | 770 | Open in IMG/M |
| 3300026322|Ga0209687_1222522 | Not Available | 582 | Open in IMG/M |
| 3300026476|Ga0256808_1013001 | Not Available | 1029 | Open in IMG/M |
| 3300026550|Ga0209474_10239992 | Not Available | 1126 | Open in IMG/M |
| 3300026857|Ga0208893_1004348 | Not Available | 541 | Open in IMG/M |
| 3300027871|Ga0209397_10325920 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027871|Ga0209397_10711462 | Not Available | 505 | Open in IMG/M |
| 3300027885|Ga0209450_10743496 | Not Available | 710 | Open in IMG/M |
| 3300027900|Ga0209253_10179194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
| 3300028597|Ga0247820_10554433 | Not Available | 788 | Open in IMG/M |
| 3300028665|Ga0302160_10101353 | Not Available | 634 | Open in IMG/M |
| 3300028741|Ga0302256_10232977 | Not Available | 508 | Open in IMG/M |
| 3300028743|Ga0302262_10199451 | Not Available | 682 | Open in IMG/M |
| 3300029984|Ga0311332_10335362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300029987|Ga0311334_10080141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2375 | Open in IMG/M |
| 3300029990|Ga0311336_10002963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12901 | Open in IMG/M |
| 3300030000|Ga0311337_11661643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300030002|Ga0311350_10721618 | Not Available | 894 | Open in IMG/M |
| 3300030294|Ga0311349_10751784 | Not Available | 919 | Open in IMG/M |
| 3300031232|Ga0302323_100785291 | Not Available | 1046 | Open in IMG/M |
| 3300031543|Ga0318516_10531258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300031562|Ga0310886_10933017 | Not Available | 553 | Open in IMG/M |
| 3300031726|Ga0302321_100112037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2749 | Open in IMG/M |
| 3300031726|Ga0302321_102154966 | Not Available | 648 | Open in IMG/M |
| 3300031834|Ga0315290_10822224 | Not Available | 793 | Open in IMG/M |
| 3300031873|Ga0315297_10000283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28850 | Open in IMG/M |
| 3300031873|Ga0315297_10164362 | Not Available | 1812 | Open in IMG/M |
| 3300031918|Ga0311367_12088285 | Not Available | 545 | Open in IMG/M |
| 3300031940|Ga0310901_10603678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300032013|Ga0310906_10590393 | Not Available | 764 | Open in IMG/M |
| 3300032018|Ga0315272_10545357 | Not Available | 581 | Open in IMG/M |
| 3300032068|Ga0318553_10215736 | Not Available | 1001 | Open in IMG/M |
| 3300032177|Ga0315276_11216622 | Not Available | 793 | Open in IMG/M |
| 3300032180|Ga0307471_104192050 | Not Available | 509 | Open in IMG/M |
| 3300032256|Ga0315271_10705147 | Not Available | 867 | Open in IMG/M |
| 3300032256|Ga0315271_11302464 | Not Available | 627 | Open in IMG/M |
| 3300032256|Ga0315271_11646073 | Not Available | 552 | Open in IMG/M |
| 3300032261|Ga0306920_103635902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300032275|Ga0315270_10104185 | Not Available | 1664 | Open in IMG/M |
| 3300032397|Ga0315287_10056461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4334 | Open in IMG/M |
| 3300032397|Ga0315287_10701574 | Not Available | 1195 | Open in IMG/M |
| 3300032782|Ga0335082_10042000 | Not Available | 4789 | Open in IMG/M |
| 3300032828|Ga0335080_11142081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300033004|Ga0335084_12224206 | Not Available | 531 | Open in IMG/M |
| 3300033408|Ga0316605_10192774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1705 | Open in IMG/M |
| 3300033408|Ga0316605_10194009 | Not Available | 1700 | Open in IMG/M |
| 3300033408|Ga0316605_10314794 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300033481|Ga0316600_10570206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300033482|Ga0316627_100081871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2130 | Open in IMG/M |
| 3300033482|Ga0316627_101022120 | Not Available | 803 | Open in IMG/M |
| 3300033483|Ga0316629_10531503 | Not Available | 861 | Open in IMG/M |
| 3300033483|Ga0316629_10726012 | Not Available | 754 | Open in IMG/M |
| 3300034195|Ga0370501_0063731 | Not Available | 1193 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.99% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.19% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.40% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.20% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.60% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.60% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.60% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.60% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.60% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.60% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.60% |
| Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.60% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300013769 | Sewage treatment plant microbial communities from Vermont, USA - Sand_B | Engineered | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026072 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026857 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_01905810 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VSAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL |
| JGI24743J22301_100544301 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAYLVLLRMEVAAFTRSGHGLTRTGAIVSVALFLAFIHRASGDLW |
| JGI25382J43887_101261322 | 3300002908 | Grasslands Soil | MSAYLVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL* |
| Ga0055437_101991302 | 3300004009 | Natural And Restored Wetlands | LVLLRMEVAAFHPLPDRFDPARQRLVSVALFIAFIGRANGDL |
| Ga0055492_101427202 | 3300004051 | Natural And Restored Wetlands | NCASAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL* |
| Ga0055496_101467701 | 3300004057 | Natural And Restored Wetlands | CASAYLVLLRMEVAAFHPPSRRFDPERKRLVSVALFIAFIGRANGDL* |
| Ga0055486_100408142 | 3300004071 | Natural And Restored Wetlands | LVLLRMEVAAFHPPSRRFDPERKRLVSVALFIAFIGRANGDL* |
| Ga0055514_101346172 | 3300004079 | Natural And Restored Wetlands | ASMSAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFIGRANGDL* |
| Ga0063356_1061128232 | 3300004463 | Arabidopsis Thaliana Rhizosphere | CLVLLRMEVAAFHPHRIGVTLRLVSVALFIAFIHRANGDL* |
| Ga0062379_101203832 | 3300004781 | Wetland Sediment | MSAYLVLLRMEVAAFHPPRGLTPGRLVSVALFLAFVIRASGDL* |
| Ga0062594_1009645112 | 3300005093 | Soil | VSAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL* |
| Ga0066678_101309582 | 3300005181 | Soil | YLVLLRMEVAAFHPLPRSFTCAVRLVSVALFLAFTRRASGGL* |
| Ga0066676_103124672 | 3300005186 | Soil | MSAYLVLLRMEVAAFHPLQFDRKRLVSVALFLAFARRASGGL* |
| Ga0070668_1002531272 | 3300005347 | Switchgrass Rhizosphere | MEVAAFHPPPIRCDPDRGRLVSVALFLAFVSRASGDLLRPG |
| Ga0070667_1002773001 | 3300005367 | Switchgrass Rhizosphere | MEVAAFHPPPIRYDPARGRLVSVALFLAFVSRASGDLLRPG |
| Ga0070701_102710051 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | YLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL* |
| Ga0070700_1015138602 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVAAFHPPRTRCEPDPRRLVSVALFLAFVSRASGDLLRPG |
| Ga0070708_1000005632 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAYLVLLRMEVAAFHPLAFDGKRLVSVALFLAFIGRANGDL* |
| Ga0066681_104557742 | 3300005451 | Soil | MSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFTRRASGGL* |
| Ga0066687_100666583 | 3300005454 | Soil | MSAYLVLLRMEVAASPASAQFYVRGKRLVSVALFLAFTRRASGGL* |
| Ga0070706_1003699402 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIVRYLVLLRMEVAAFHPHPLDRMRLVSVALFLAFTAARANGL* |
| Ga0066698_100762822 | 3300005558 | Soil | MSAYLVLLRMEVAAFHPLPAKEAIVSVALFLAFVARFRGDL* |
| Ga0070664_1014731552 | 3300005564 | Corn Rhizosphere | LVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL* |
| Ga0066694_105635091 | 3300005574 | Soil | MSAYLVLLRMEVAAFTRFRAVYLRGKRLVSVALFLAFTRRASGGL* |
| Ga0068857_1010230822 | 3300005577 | Corn Rhizosphere | LVLLRMEVAAFHPKRYDPLRLVSVALFLAFVGRANGDL* |
| Ga0066706_102666372 | 3300005598 | Soil | MSAYLVLLRMEVAAFHPLPAKKAIVSVALFLAFVARFRGDL* |
| Ga0068861_1008452321 | 3300005719 | Switchgrass Rhizosphere | LVLLRMEVAAFHPKRYDPLRLVSVALFLAFVGRAGGDL* |
| Ga0066903_1001223652 | 3300005764 | Tropical Forest Soil | LVLLRMEVAAFHPSAFDGRRLVSVALFLAFVHRASGDL* |
| Ga0066903_1006642443 | 3300005764 | Tropical Forest Soil | LVLLRMEVAAFHPPAFDRRRLVSVALFLAFIHRASGDL* |
| Ga0066903_1042954072 | 3300005764 | Tropical Forest Soil | SAYLVLLRMEVAAFHPPRCYPQRLVSVALFHAFVCRANGDL* |
| Ga0074470_106065442 | 3300005836 | Sediment (Intertidal) | MEVAAFHPLPDRFDPEWPRLVSVALFIAFIGRANGDL* |
| Ga0080027_101100831 | 3300005993 | Prmafrost Soil | VSAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRANGDL* |
| Ga0066696_103044402 | 3300006032 | Soil | MSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFVHRASGDL* |
| Ga0079037_1000332223 | 3300006224 | Freshwater Wetlands | LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFIGRANGDL* |
| Ga0079037_1003133672 | 3300006224 | Freshwater Wetlands | MLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL* |
| Ga0079037_1013823302 | 3300006224 | Freshwater Wetlands | MEVAAFHPPPARFDPDPRRLVSVALFLAFVGRASGDLLRPGVTR |
| Ga0075021_103861022 | 3300006354 | Watersheds | VSAYLVLLRMEVTAFHPPPFDRRRLVSVALFLAFIGRANGDL* |
| Ga0074051_115607162 | 3300006572 | Soil | LVLLRMEVAAFHPLPRRYDPERTRLVSVALFIAFIGRANGDL* |
| Ga0074051_116339622 | 3300006572 | Soil | LVLLRMEVAAFHPLSREGKRLVSVALFLAFIGRANGDL* |
| Ga0074048_132786262 | 3300006581 | Soil | SAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL* |
| Ga0074064_116426622 | 3300006603 | Soil | MSAYLVLLRMEVAAFHPPRFDPWRLVSVALFLTFVVRASGDL* |
| Ga0074060_118416851 | 3300006604 | Soil | SSAYLVLLRMEVAAFHPLPSRFDPSRQRLVSVALFIAFIGRANGDL* |
| Ga0074057_120486631 | 3300006605 | Soil | MSAYLVLLRMEVAAFHPPRFDPRRLVSVALFLTFVVRASGDL* |
| Ga0075425_1021176462 | 3300006854 | Populus Rhizosphere | MSAYLVLLRMEVAAFHPLPAHLCATGRLVSVALFLAFVARVSGDL* |
| Ga0075434_1025435082 | 3300006871 | Populus Rhizosphere | SSSAYLVLLRMEVAAFHPLPEQFDPCRMRLVSVALFIAFVDRASGDL* |
| Ga0075424_1001349032 | 3300006904 | Populus Rhizosphere | MSAYLVLLRMEVAAFHPLPCEGKRLVSVALFLAFVGRASGDL* |
| Ga0079218_100230916 | 3300007004 | Agricultural Soil | SAYLVLLRMEVAAFHPLPRFDPRRRLVSVALFLAFINRASGDL* |
| Ga0075435_1008719292 | 3300007076 | Populus Rhizosphere | MSAYLVLLRMEVAAFHPLPAHVCNRKRLVSVALFLAFVARVSGDL* |
| Ga0105095_108184421 | 3300009053 | Freshwater Sediment | MEVAAFHPPPVRFDPDPRRLVSVALFLAFVGRASGDLLRP |
| Ga0099828_107361061 | 3300009089 | Vadose Zone Soil | ASSSAYLVLLRMEVAAFHPHPLDRMRLVSVALFLAFTAARANGL* |
| Ga0115026_100282442 | 3300009111 | Wetland | LVLLRMEVAAFHPPPRRYDPERMRLVSVAAFIVFIGRANGDL* |
| Ga0115026_101634402 | 3300009111 | Wetland | MLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL* |
| Ga0117941_10465771 | 3300009120 | Lake Sediment | MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRANGDL* |
| Ga0115027_100267582 | 3300009131 | Wetland | LVLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL* |
| Ga0115027_109945921 | 3300009131 | Wetland | LVLLRMEVAAFHPLPNRFDPGRPRLVSVALFIAFINRANGDL |
| Ga0075423_128648382 | 3300009162 | Populus Rhizosphere | AASMSAYLVLLRMEVAAFHPLPRGKRLVSVALFLAFVTRSRGDL* |
| Ga0113563_104702701 | 3300009167 | Freshwater Wetlands | MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL* |
| Ga0105096_100029315 | 3300009170 | Freshwater Sediment | MLLRMEVAAFHPLPFDRKRLVSVALFLAFIHRANGDL* |
| Ga0105248_116686851 | 3300009177 | Switchgrass Rhizosphere | LVLLRMEVAAFHPPRGRFDPFRGRLVSVALFIAFVGRV |
| Ga0115028_120826321 | 3300009179 | Wetland | TSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL* |
| Ga0131092_109178662 | 3300009870 | Activated Sludge | LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRANGDL* |
| Ga0134064_104409431 | 3300010325 | Grasslands Soil | MSAYLVLLRMEVAAFHPLQFDRKRLVSVALFLAFARRASGDL* |
| Ga0105239_102855483 | 3300010375 | Corn Rhizosphere | AASSFAYLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL* |
| Ga0137463_11204932 | 3300011444 | Soil | VSAYLVLLRMEVTAFHPLPFDGKRLVSVALFLAFIGRANGDL* |
| Ga0137329_10440042 | 3300012133 | Soil | LVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL* |
| Ga0137399_108635862 | 3300012203 | Vadose Zone Soil | LVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL* |
| Ga0137390_110961881 | 3300012363 | Vadose Zone Soil | LVLLRMEVAAFHPLRTWHNARPGRLVSVALFLAFDDRSRDRLIAA |
| Ga0157323_10324991 | 3300012495 | Arabidopsis Rhizosphere | LVLLRMEVAAFHPPAFDARRLVSVALFLAFVGRASGDL* |
| Ga0157378_112345682 | 3300013297 | Miscanthus Rhizosphere | MEVAAFHPLPVEGKRLVSVALFLAFAETARLRLVR |
| Ga0157378_116681192 | 3300013297 | Miscanthus Rhizosphere | SYLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL* |
| Ga0163162_129754351 | 3300013306 | Switchgrass Rhizosphere | ACDAIASAYLVLLRMEVAAFHPPPCNRGRLVSVALFLTFVHRASGDL* |
| Ga0173609_103830172 | 3300013315 | Sediment | MSAYLVLLRMEVAAFHPPGRSPGRLVSVALFLAFVIRASGDL* |
| Ga0119887_10438242 | 3300013769 | Sewage Treatment Plant | LVLLRMEVAAFHPPAFDGRRLVSVALFLAFIDRANGDL* |
| Ga0075358_10465842 | 3300014303 | Natural And Restored Wetlands | MEVAAFHPPPGRFDPAWLRLVSVALFIAFIGRANGDL* |
| Ga0075349_10125521 | 3300014305 | Natural And Restored Wetlands | LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL* |
| Ga0075350_10372612 | 3300014315 | Natural And Restored Wetlands | LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL* |
| Ga0075355_11987791 | 3300014322 | Natural And Restored Wetlands | MSAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFVGRANGDL* |
| Ga0157380_110007291 | 3300014326 | Switchgrass Rhizosphere | MARAASWSAYLVLLRMEVAAFHPLPCNRKRLVSVALFLAF |
| Ga0180083_10321332 | 3300014875 | Soil | VSAYLVLLRMEVAAFHPPAFDGKRLVSVALFLAFIGRANGDL* |
| Ga0157376_104017952 | 3300014969 | Miscanthus Rhizosphere | MEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL* |
| Ga0167636_10212061 | 3300015075 | Glacier Forefield Soils | LVLLRMEVAAFHPLRTWRTARPERLVSVALFLAFVDR |
| Ga0180075_10347272 | 3300015252 | Soil | LVLLRMEVAAFHPLSREGKRLVSVALFLALIDRASGDL* |
| Ga0137403_106585582 | 3300015264 | Vadose Zone Soil | MSAYLVLLRMEVAAFHPLPVAGQRLVSVALFLAFVHRASGDL* |
| Ga0132258_101506221 | 3300015371 | Arabidopsis Rhizosphere | LVLLRMEVAAFHPPACDRRRLVSVALFLALVDRAS |
| Ga0132258_109746003 | 3300015371 | Arabidopsis Rhizosphere | LVLLRMEVAAFHPPPIRYDPDRGRLVSVALFLAFVSRASGDL |
| Ga0132256_1002534661 | 3300015372 | Arabidopsis Rhizosphere | CASAYLVLLRMEVAAFHPPACDRRRLVSVALFLALVGRASGDL* |
| Ga0132256_1006151322 | 3300015372 | Arabidopsis Rhizosphere | LVLLRMEVAAFPPPAFDGRRLVSVALFLAFVGRASGDL* |
| Ga0132256_1016283452 | 3300015372 | Arabidopsis Rhizosphere | VSAYLVLLRMEVTAFHPLAFNRKRLVSVALFLAFIDRASGDL* |
| Ga0132256_1025596782 | 3300015372 | Arabidopsis Rhizosphere | LVLLRMEVAAFHPPPVRHARIRRRLVSVALFIAFVHRASGDL |
| Ga0132257_1035828491 | 3300015373 | Arabidopsis Rhizosphere | LVLLRMEVAAFHPPAFDGRRLVSVALFLAFVGRASGDL* |
| Ga0187779_110230601 | 3300017959 | Tropical Peatland | MSAYLVLLRMEVAAFHPPRFEPRRLVSVALFLAFVGRASGDL |
| Ga0184605_100259382 | 3300018027 | Groundwater Sediment | MSAYLVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL |
| Ga0184638_11109812 | 3300018052 | Groundwater Sediment | AKCASAYLVLLRMEVAAFHPLAFDSKRLVSVALFLAFIGRANGDL |
| Ga0184626_100008481 | 3300018053 | Groundwater Sediment | LVLLRMEVAAFHPLAFDGKRLVSVALFLAFIGRANGDL |
| Ga0184623_105251302 | 3300018056 | Groundwater Sediment | SSSAYLVLLRMEVAAFHPLSREGKRLVSVAQFLVFISHASGDL |
| Ga0187765_112047841 | 3300018060 | Tropical Peatland | LVLLRMEVAAFHPPAFDRRRLVSVALFLAFVDRASGDL |
| Ga0184619_100185712 | 3300018061 | Groundwater Sediment | MSAYLVLLRMEVAALHPLPYDGKRLVSVALFIAFIHRASGDL |
| Ga0190272_112984882 | 3300018429 | Soil | LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL |
| Ga0190271_138355891 | 3300018481 | Soil | ASAYLVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL |
| Ga0066669_112999741 | 3300018482 | Grasslands Soil | LVLLRMEVAAFHPPACDRRRLVSVALFLALVDRASGDL |
| Ga0180117_10662001 | 3300019248 | Groundwater Sediment | MSAYLVLLRMEVAAFHPPRFDPRRLVSVALFLTFVVRASGDL |
| Ga0193729_11965702 | 3300019887 | Soil | MEVAAFHPLRTWRDARPGRLVSVALFLAFVDRSRDRLI |
| Ga0210351_13453523 | 3300021316 | Estuarine | MEVAAFHPPPDRFDPLRRRLVSVALFIAFINRVNGDL |
| Ga0194043_12488161 | 3300021473 | Anoxic Zone Freshwater | LVLLRMEVAAFHPLPRRYDPERKRLVSVALFIAFIGRANGDL |
| Ga0079039_13067181 | 3300022185 | Freshwater Wetlands | MEVAAFHPLPRRFDPERTRLVSVALFIAFIGRANGDL |
| Ga0224505_102656021 | 3300022214 | Sediment | AKCASAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFINRASGDL |
| Ga0222622_107142722 | 3300022756 | Groundwater Sediment | VSAYLVLLRMEVAAFHPLAFDSKRLVSVALFLAFIGRANGDL |
| Ga0208005_11661912 | 3300025848 | Aqueous | LVLLRMEVAAFHPPRFDPRRLVSVALFLAFVIRASGDL |
| Ga0207645_100261292 | 3300025907 | Miscanthus Rhizosphere | LVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL |
| Ga0210104_10009731 | 3300025956 | Natural And Restored Wetlands | YLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL |
| Ga0210104_10027973 | 3300025956 | Natural And Restored Wetlands | YLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL |
| Ga0210069_10052242 | 3300025958 | Natural And Restored Wetlands | LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL |
| Ga0210103_10592932 | 3300025968 | Natural And Restored Wetlands | ANCASAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL |
| Ga0208292_10158032 | 3300026072 | Natural And Restored Wetlands | LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL |
| Ga0207708_108891931 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLRMEVAAFHPLAREGKRLVSVSLFLVFIGRASGDL |
| Ga0209687_12225222 | 3300026322 | Soil | YLVLLRMEVAAFHPLPFDWKRLVSVALFLAFTRRASGGL |
| Ga0256808_10130012 | 3300026476 | Sediment | RATLAYLVLLRMEVAAFHPLPDEGQRLVSVALFLAFVGRANGDL |
| Ga0209474_102399922 | 3300026550 | Soil | ADVTRAASMSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFVHRASGDL |
| Ga0208893_10043481 | 3300026857 | Soil | VSAYLVLLRMEVTAFHPPPFDRRRLVSVALFLAFIGRANGDL |
| Ga0209397_103259202 | 3300027871 | Wetland | MSAYLVLLRMEVAAFHPPGRSPGRLVSVALFLAFVIRASGDL |
| Ga0209397_107114621 | 3300027871 | Wetland | MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL |
| Ga0209450_107434961 | 3300027885 | Freshwater Lake Sediment | MLLRMEVAAFHPPPFEGKRLVSVALFLAFIHRANGDL |
| Ga0209253_101791942 | 3300027900 | Freshwater Lake Sediment | LVLLRMEVAAFHPLPCDGKRLVSVALFLAFIGRANGDL |
| Ga0247820_105544332 | 3300028597 | Soil | SAYLVLLRMEVAAFHPLSRSCLPGKRLVSVALFLAFTCRASGGL |
| Ga0302160_101013532 | 3300028665 | Fen | VSAYLVLLRMEVTAFHPPPFYRRRLVSVALFLAFIDRANGDL |
| Ga0302256_102329773 | 3300028741 | Fen | MEVAAFHPLPDQFDPEWQRLVSVALFIAFIGRANGDL |
| Ga0302262_101994512 | 3300028743 | Fen | AYLVLLRMEVTAFHPPPCNGRRLVSVALFLAFVGRANGDL |
| Ga0311332_103353622 | 3300029984 | Fen | MSAYLVLLRMEVAAFHPLSCDRKRLVSVALFLAFIGRANGDL |
| Ga0311334_100801413 | 3300029987 | Fen | VSAYLVLLRMEVTAFHPLPCDRKRLVSVALFLAFIGRANGDL |
| Ga0311336_100029631 | 3300029990 | Fen | VSAYLVLLRMEVTAFHPPPFKGRRLVSVALFLAFIGRANGD |
| Ga0311337_116616431 | 3300030000 | Fen | SAYLVLLRMEVAAFHPPRFDARRLVSVALFLAFIGRANGDL |
| Ga0311350_107216182 | 3300030002 | Fen | SAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRANGDL |
| Ga0311349_107517841 | 3300030294 | Fen | LVLLRMEVAAFHPLAREGKRLVSVALFLTFIHRANGDL |
| Ga0302323_1007852913 | 3300031232 | Fen | MEVAAFHPLPDQFDPERQRLVSVALFIAFIGRANGDL |
| Ga0318516_105312582 | 3300031543 | Soil | ASSSAYLVLLRMEVAAFHPPRCYPRRLVSVALFLAFVGRANGDL |
| Ga0310886_109330172 | 3300031562 | Soil | CVAKCTSAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL |
| Ga0302321_1001120375 | 3300031726 | Fen | SVSAYLVLLRMEVTAFHPPPFKGRRLVSVALFLAFIGRANGDL |
| Ga0302321_1021549662 | 3300031726 | Fen | VSAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRA |
| Ga0315290_108222242 | 3300031834 | Sediment | LVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL |
| Ga0315297_1000028315 | 3300031873 | Sediment | VSAYLVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL |
| Ga0315297_101643623 | 3300031873 | Sediment | VSAYLVLLRMEVTSFHPLACEGKRLVSVALFLAFIGRANGDL |
| Ga0311367_120882851 | 3300031918 | Fen | MEVAAFHPLPDQFDPEWQRLVSVALFIAFIGRANG |
| Ga0310901_106036782 | 3300031940 | Soil | AKCTSAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL |
| Ga0310906_105903931 | 3300032013 | Soil | AYLVLLRMEVAAFHPPRCDPRRLVSVALFLAFVGRASGDL |
| Ga0315272_105453571 | 3300032018 | Sediment | LLRMEVTAFHPPPFNGRRLVSVALFLAFVGRANGDL |
| Ga0318553_102157362 | 3300032068 | Soil | RRAASSSAYLVLLRMEVAAFHPPRCYPQRLVSVALFLAFVRRANGDL |
| Ga0315276_112166222 | 3300032177 | Sediment | MEVAAFHPPRFDPRRLVSVALFLAFVSRANGDLLR |
| Ga0307471_1041920501 | 3300032180 | Hardwood Forest Soil | ADVTRAASMSAYLVLLRMEVAAFHPLPVAGQRLVSVALFLAFIHRASGDL |
| Ga0315271_107051471 | 3300032256 | Sediment | LRMEVAAFHPLPDRFDPERPRLVSVALFIAFIGRANGDL |
| Ga0315271_113024641 | 3300032256 | Sediment | LVLLRMEVAAFHPPRFDPRRLVSVALFLAFVNRANGDL |
| Ga0315271_116460731 | 3300032256 | Sediment | VAAFHPLPRRYDPERTRLVSVALFIAFIGRANGDL |
| Ga0306920_1036359021 | 3300032261 | Soil | LVLLRMEVAAFHPPRCYPRRLVSVALFLAFVGRANGDL |
| Ga0315270_101041852 | 3300032275 | Sediment | MEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL |
| Ga0315287_100564611 | 3300032397 | Sediment | VSAYLVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIG |
| Ga0315287_107015742 | 3300032397 | Sediment | SAYLVLLRMEVAAFHPLPFDGKRLVSVALFLAFVGRASGDL |
| Ga0335082_100420004 | 3300032782 | Soil | MSAYLVLLRMEVAAFHPPRYDPWRLVSVALFLAFVGRASGDL |
| Ga0335080_111420812 | 3300032828 | Soil | LVLLRMEVAAFHPPAFDGRRLVSVALFLAFIDRASGDL |
| Ga0335084_122242062 | 3300033004 | Soil | LVLLRMEVAAFHPPAFDGRRLVSVALFLAFAGRASGDL |
| Ga0316605_101927742 | 3300033408 | Soil | LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFIGRANGDL |
| Ga0316605_101940093 | 3300033408 | Soil | MLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL |
| Ga0316605_103147942 | 3300033408 | Soil | MLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL |
| Ga0316600_105702062 | 3300033481 | Soil | LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFVGRANGDL |
| Ga0316627_1000818712 | 3300033482 | Soil | MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRVSGDL |
| Ga0316627_1010221202 | 3300033482 | Soil | CVAKCTSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL |
| Ga0316629_105315031 | 3300033483 | Soil | LVLLRMEVAAFHPLPFDGKRLVSVALFRAFIGRASGDL |
| Ga0316629_107260121 | 3300033483 | Soil | RAACVAKCTSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL |
| Ga0370501_0063731_2_121 | 3300034195 | Untreated Peat Soil | YLVLLRMEVTAFHPPACDSRRLVSVALFLAFVGRANGDL |
| ⦗Top⦘ |