


| Basic Information | |
|---|---|
| Family ID | F037722 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 73.65 % |
| % of genes near scaffold ends (potentially truncated) | 35.33 % |
| % of genes from short scaffolds (< 2000 bps) | 71.86 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (38.922 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (13.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (34.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.74% β-sheet: 0.00% Coil/Unstructured: 40.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF00805 | Pentapeptide | 3.01 |
| PF07460 | NUMOD3 | 1.20 |
| PF02562 | PhoH | 0.60 |
| PF00154 | RecA | 0.60 |
| PF00149 | Metallophos | 0.60 |
| PF08804 | gp32 | 0.60 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.60 |
| PF02086 | MethyltransfD12 | 0.60 |
| PF00085 | Thioredoxin | 0.60 |
| PF13469 | Sulfotransfer_3 | 0.60 |
| PF00383 | dCMP_cyt_deam_1 | 0.60 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 3.01 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.60 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.60 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.60 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.60 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.66 % |
| Unclassified | root | N/A | 32.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10003733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 6096 | Open in IMG/M |
| 3300001282|B570J14230_10061136 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300001335|ML8_10073253 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300001533|MLSed_10238830 | Not Available | 686 | Open in IMG/M |
| 3300001533|MLSed_10241980 | Not Available | 679 | Open in IMG/M |
| 3300001580|Draft_10290781 | Not Available | 705 | Open in IMG/M |
| 3300002402|B570J29627_1001533 | All Organisms → Viruses → Predicted Viral | 2119 | Open in IMG/M |
| 3300004369|Ga0065726_18893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10017 | Open in IMG/M |
| 3300005346|Ga0074242_12046110 | Not Available | 751 | Open in IMG/M |
| 3300005512|Ga0074648_1003372 | Not Available | 13565 | Open in IMG/M |
| 3300005512|Ga0074648_1038337 | All Organisms → Viruses → Predicted Viral | 2267 | Open in IMG/M |
| 3300005512|Ga0074648_1072057 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300005527|Ga0068876_10225705 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300005582|Ga0049080_10149507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 782 | Open in IMG/M |
| 3300005613|Ga0074649_1008707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7564 | Open in IMG/M |
| 3300005613|Ga0074649_1028192 | All Organisms → Viruses → Predicted Viral | 2901 | Open in IMG/M |
| 3300005805|Ga0079957_1059271 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
| 3300005940|Ga0073913_10044650 | Not Available | 695 | Open in IMG/M |
| 3300005941|Ga0070743_10000310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19239 | Open in IMG/M |
| 3300005941|Ga0070743_10004220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5237 | Open in IMG/M |
| 3300005941|Ga0070743_10020785 | All Organisms → Viruses → Predicted Viral | 2287 | Open in IMG/M |
| 3300005943|Ga0073926_10000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17247 | Open in IMG/M |
| 3300005955|Ga0073922_1050469 | Not Available | 531 | Open in IMG/M |
| 3300006484|Ga0070744_10127464 | Not Available | 733 | Open in IMG/M |
| 3300006641|Ga0075471_10121960 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
| 3300006641|Ga0075471_10198642 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300007539|Ga0099849_1131044 | Not Available | 980 | Open in IMG/M |
| 3300007544|Ga0102861_1068806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 929 | Open in IMG/M |
| 3300007549|Ga0102879_1003809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 5687 | Open in IMG/M |
| 3300007554|Ga0102820_1048654 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300007557|Ga0102821_1022848 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300007585|Ga0102916_1092039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 809 | Open in IMG/M |
| 3300007603|Ga0102921_1041835 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
| 3300007622|Ga0102863_1102244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 843 | Open in IMG/M |
| 3300007622|Ga0102863_1147516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 693 | Open in IMG/M |
| 3300007629|Ga0102895_1009076 | All Organisms → Viruses → Predicted Viral | 2387 | Open in IMG/M |
| 3300007639|Ga0102865_1188482 | Not Available | 616 | Open in IMG/M |
| 3300007661|Ga0102866_1060874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 924 | Open in IMG/M |
| 3300007670|Ga0102862_1192555 | Not Available | 528 | Open in IMG/M |
| 3300007973|Ga0105746_1299664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 557 | Open in IMG/M |
| 3300007973|Ga0105746_1341823 | Not Available | 522 | Open in IMG/M |
| 3300007992|Ga0105748_10194290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 842 | Open in IMG/M |
| 3300008055|Ga0108970_10963015 | Not Available | 650 | Open in IMG/M |
| 3300008107|Ga0114340_1034584 | All Organisms → Viruses → Predicted Viral | 2294 | Open in IMG/M |
| 3300008107|Ga0114340_1042691 | All Organisms → Viruses → Predicted Viral | 3406 | Open in IMG/M |
| 3300008107|Ga0114340_1114960 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300008108|Ga0114341_10080712 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300008108|Ga0114341_10502553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 548 | Open in IMG/M |
| 3300008110|Ga0114343_1138337 | Not Available | 793 | Open in IMG/M |
| 3300008113|Ga0114346_1030325 | All Organisms → Viruses → Predicted Viral | 2837 | Open in IMG/M |
| 3300008116|Ga0114350_1125367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 764 | Open in IMG/M |
| 3300008448|Ga0114876_1175313 | Not Available | 753 | Open in IMG/M |
| 3300009000|Ga0102960_1305178 | Not Available | 562 | Open in IMG/M |
| 3300009001|Ga0102963_1183074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 839 | Open in IMG/M |
| 3300009056|Ga0102860_1011857 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
| 3300009081|Ga0105098_10485201 | Not Available | 627 | Open in IMG/M |
| 3300009085|Ga0105103_10003068 | Not Available | 8565 | Open in IMG/M |
| 3300009085|Ga0105103_10289319 | Not Available | 891 | Open in IMG/M |
| 3300009085|Ga0105103_10756733 | Not Available | 562 | Open in IMG/M |
| 3300009146|Ga0105091_10067416 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300009149|Ga0114918_10645124 | Not Available | 557 | Open in IMG/M |
| 3300009152|Ga0114980_10191591 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300009165|Ga0105102_10057702 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300009168|Ga0105104_10060366 | All Organisms → Viruses → Predicted Viral | 2055 | Open in IMG/M |
| 3300009469|Ga0127401_1012802 | All Organisms → Viruses → Predicted Viral | 2459 | Open in IMG/M |
| 3300009484|Ga0127411_1178774 | Not Available | 565 | Open in IMG/M |
| 3300009529|Ga0114919_10943902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 581 | Open in IMG/M |
| 3300010354|Ga0129333_10041398 | All Organisms → Viruses → Predicted Viral | 4333 | Open in IMG/M |
| 3300010354|Ga0129333_10340030 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300010354|Ga0129333_10786229 | Not Available | 812 | Open in IMG/M |
| 3300010354|Ga0129333_11402669 | Not Available | 574 | Open in IMG/M |
| 3300010354|Ga0129333_11656864 | Not Available | 521 | Open in IMG/M |
| 3300010370|Ga0129336_10302549 | Not Available | 888 | Open in IMG/M |
| 3300010370|Ga0129336_10391652 | Not Available | 760 | Open in IMG/M |
| 3300011268|Ga0151620_1038396 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300011268|Ga0151620_1061630 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300012000|Ga0119951_1100512 | Not Available | 692 | Open in IMG/M |
| 3300014050|Ga0119952_1070300 | Not Available | 883 | Open in IMG/M |
| 3300017778|Ga0181349_1238061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 613 | Open in IMG/M |
| 3300018558|Ga0188836_100209 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300019089|Ga0188876_1000031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7145 | Open in IMG/M |
| 3300019096|Ga0188835_1004001 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300019122|Ga0188839_1007892 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300020141|Ga0211732_1432693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 552 | Open in IMG/M |
| 3300020141|Ga0211732_1588932 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300020141|Ga0211732_1603843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 566 | Open in IMG/M |
| 3300020151|Ga0211736_10128486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax koreense | 659 | Open in IMG/M |
| 3300020151|Ga0211736_10152903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 628 | Open in IMG/M |
| 3300020151|Ga0211736_10170710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 828 | Open in IMG/M |
| 3300020151|Ga0211736_10183989 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300020151|Ga0211736_10391647 | Not Available | 713 | Open in IMG/M |
| 3300020151|Ga0211736_10962991 | All Organisms → Viruses → Predicted Viral | 2166 | Open in IMG/M |
| 3300020159|Ga0211734_10103103 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300020159|Ga0211734_10410497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 504 | Open in IMG/M |
| 3300020159|Ga0211734_10761071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 640 | Open in IMG/M |
| 3300020159|Ga0211734_10974479 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
| 3300020159|Ga0211734_11291889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 828 | Open in IMG/M |
| 3300020160|Ga0211733_10306334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 726 | Open in IMG/M |
| 3300020172|Ga0211729_10258582 | All Organisms → Viruses → Predicted Viral | 3320 | Open in IMG/M |
| 3300020172|Ga0211729_10815812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax koreense | 713 | Open in IMG/M |
| 3300020205|Ga0211731_10241114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 973 | Open in IMG/M |
| 3300020205|Ga0211731_10291359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 640 | Open in IMG/M |
| 3300020205|Ga0211731_10917826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 536 | Open in IMG/M |
| 3300020551|Ga0208360_1012727 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300020566|Ga0208222_1000349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13307 | Open in IMG/M |
| 3300020569|Ga0208229_1013283 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300021141|Ga0214163_1150000 | Not Available | 503 | Open in IMG/M |
| 3300021425|Ga0213866_10164687 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300021960|Ga0222715_10168656 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
| 3300021962|Ga0222713_10197585 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300022407|Ga0181351_1042488 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300022752|Ga0214917_10067567 | All Organisms → Viruses → Predicted Viral | 2273 | Open in IMG/M |
| 3300024262|Ga0210003_1336973 | Not Available | 566 | Open in IMG/M |
| 3300024343|Ga0244777_10000886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 22537 | Open in IMG/M |
| 3300024343|Ga0244777_10000886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 22537 | Open in IMG/M |
| 3300024346|Ga0244775_10761857 | Not Available | 776 | Open in IMG/M |
| 3300024346|Ga0244775_10966814 | Not Available | 673 | Open in IMG/M |
| 3300024849|Ga0255230_1105902 | Not Available | 513 | Open in IMG/M |
| 3300025674|Ga0208162_1074339 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300025732|Ga0208784_1003013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6566 | Open in IMG/M |
| 3300025732|Ga0208784_1003684 | Not Available | 5819 | Open in IMG/M |
| 3300027210|Ga0208802_1022632 | Not Available | 865 | Open in IMG/M |
| 3300027213|Ga0208555_1063013 | Not Available | 568 | Open in IMG/M |
| 3300027237|Ga0208930_1038507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 660 | Open in IMG/M |
| 3300027247|Ga0208679_1004123 | All Organisms → Viruses → Predicted Viral | 3389 | Open in IMG/M |
| 3300027255|Ga0208681_1035760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 926 | Open in IMG/M |
| 3300027525|Ga0208437_1013434 | All Organisms → Viruses → Predicted Viral | 2116 | Open in IMG/M |
| 3300027525|Ga0208437_1127323 | Not Available | 577 | Open in IMG/M |
| 3300027659|Ga0208975_1069852 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300027659|Ga0208975_1139636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 682 | Open in IMG/M |
| 3300027675|Ga0209077_1179682 | Not Available | 591 | Open in IMG/M |
| 3300027683|Ga0209392_1073465 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300027683|Ga0209392_1093018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 963 | Open in IMG/M |
| 3300027693|Ga0209704_1012273 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300027721|Ga0209492_1244282 | Not Available | 609 | Open in IMG/M |
| 3300027733|Ga0209297_1033186 | All Organisms → Viruses → Predicted Viral | 2398 | Open in IMG/M |
| 3300027743|Ga0209593_10113295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 991 | Open in IMG/M |
| 3300027793|Ga0209972_10475409 | Not Available | 517 | Open in IMG/M |
| 3300027797|Ga0209107_10251989 | Not Available | 849 | Open in IMG/M |
| 3300027972|Ga0209079_10162318 | Not Available | 766 | Open in IMG/M |
| 3300031539|Ga0307380_10442016 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300031539|Ga0307380_11398586 | Not Available | 528 | Open in IMG/M |
| 3300031565|Ga0307379_10800743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 830 | Open in IMG/M |
| 3300031578|Ga0307376_10341226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 994 | Open in IMG/M |
| 3300031578|Ga0307376_10346612 | Not Available | 985 | Open in IMG/M |
| 3300031673|Ga0307377_10021199 | Not Available | 5957 | Open in IMG/M |
| 3300031746|Ga0315293_10124245 | All Organisms → Viruses → Predicted Viral | 2171 | Open in IMG/M |
| 3300031784|Ga0315899_11439277 | Not Available | 581 | Open in IMG/M |
| 3300031857|Ga0315909_10296584 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300031951|Ga0315904_10125699 | All Organisms → Viruses → Predicted Viral | 2644 | Open in IMG/M |
| 3300031963|Ga0315901_11039835 | Not Available | 568 | Open in IMG/M |
| 3300032050|Ga0315906_10268102 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300032053|Ga0315284_10391360 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
| 3300032093|Ga0315902_10065281 | All Organisms → Viruses → Predicted Viral | 4103 | Open in IMG/M |
| 3300032173|Ga0315268_12525673 | Not Available | 527 | Open in IMG/M |
| 3300033816|Ga0334980_0054913 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300033816|Ga0334980_0073090 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
| 3300033816|Ga0334980_0203106 | Not Available | 794 | Open in IMG/M |
| 3300033994|Ga0334996_0014276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5237 | Open in IMG/M |
| 3300034020|Ga0335002_0000020 | Not Available | 146030 | Open in IMG/M |
| 3300034020|Ga0335002_0000068 | Not Available | 90967 | Open in IMG/M |
| 3300034063|Ga0335000_0283257 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300034072|Ga0310127_041501 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
| 3300034073|Ga0310130_0000323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39026 | Open in IMG/M |
| 3300034082|Ga0335020_0000056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 91892 | Open in IMG/M |
| 3300034082|Ga0335020_0071398 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
| 3300034118|Ga0335053_0838923 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 13.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.79% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.59% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.40% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.80% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.80% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.80% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.80% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.20% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.20% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 1.20% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.20% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.20% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.60% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.60% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.60% |
| Wetlands Benthic | Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic | 0.60% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.60% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.60% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.60% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001335 | Wetlands benthic microbial communities from British Columbia, Canada - ML8 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002402 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009484 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018558 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p8 | Environmental | Open in IMG/M |
| 3300019089 | Metatranscriptome of marine microbial communities from Baltic Sea - GS853_ls4 | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027237 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027255 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100037336 | 3300000756 | Freshwater And Sediment | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| B570J14230_100611361 | 3300001282 | Freshwater | MTNEEIGETIGFYIFVGVLGWALVSFFSLTWAQALTIS |
| ML8_100732532 | 3300001335 | Wetlands Benthic | MTKQEIGETIGFYIAIGLVGWALVSFFPLTWIQALIISWMYNKLIDVLE* |
| MLSed_102388301 | 3300001533 | Benthic | MTKQEIGETIGFYIAIGLVGWALVSFFPLTWIQALIISW |
| MLSed_102419801 | 3300001533 | Benthic | MTKQEIGATIGFYIAIGLVGWALVSFFPLTWAQALIISWMYNKLIDVLE* |
| Draft_102907811 | 3300001580 | Hydrocarbon Resource Environments | MTNKEIGETIGFYIVVGVLGWALVSFFPLTWAQALIISWM |
| B570J29627_10015339 | 3300002402 | Freshwater | MTKHEIVETIGFYIFVGLMGWALVSFFSLTWAQALIISWMYNKLIDVLQ* |
| Ga0065726_1889328 | 3300004369 | Saline | MTKHEIGATIGFYLIVGLMGWALVSFFPLTWGQALIISWMYNKFVDELK* |
| Ga0074242_120461102 | 3300005346 | Saline Water And Sediment | MTEMTNLAIGETIGFFLVVGLLGWALVSFFPLTWGQALIISWAINKLFVDIRYIGK* |
| Ga0074648_100337235 | 3300005512 | Saline Water And Sediment | MTNEAIGETIGFLIVVGLIGWALVSFFPLTWGQALIISWMFNKLINVLEQYK* |
| Ga0074648_10383374 | 3300005512 | Saline Water And Sediment | MTNHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNRLIDVLE* |
| Ga0074648_10720576 | 3300005512 | Saline Water And Sediment | MTKHEIGEAIGFYIFMGLLCWALVSFFPLTWGQALIISWISNWMYNKFVDELK* |
| Ga0068876_102257052 | 3300005527 | Freshwater Lake | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0049080_101495073 | 3300005582 | Freshwater Lentic | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0074649_100870720 | 3300005613 | Saline Water And Sediment | MTNHEIGETIGFFLVVGLLGWALVSFFPLTWGQALIISWMFNKLSNVLG* |
| Ga0074649_10281929 | 3300005613 | Saline Water And Sediment | MTKHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLG* |
| Ga0079957_10592718 | 3300005805 | Lake | MTKHEIGATIGFYIIVGLLGWALVSFFPLTWGEALIISWMFNKLIDVLE* |
| Ga0073913_100446501 | 3300005940 | Sand | MTNQEIGETIGFYIVVGVLGWALVSFFPLTWAQALIISWMFNKLIDVLE* |
| Ga0070743_100003101 | 3300005941 | Estuarine | VGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0070743_100042201 | 3300005941 | Estuarine | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0070743_1002078510 | 3300005941 | Estuarine | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0073926_1000011148 | 3300005943 | Sand | MTKHEIGTTIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0073922_10504692 | 3300005955 | Sand | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWAQALIISWMYSKLIDILQ* |
| Ga0070744_101274643 | 3300006484 | Estuarine | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0075471_101219604 | 3300006641 | Aqueous | MTKQEIGATIGFYIVIGLLGWALVSFFPLTWAQALIISWMYNKLIDVLE* |
| Ga0075471_101986423 | 3300006641 | Aqueous | MTKHEIGATIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ* |
| Ga0099849_11310442 | 3300007539 | Aqueous | MTKQEIGETIGFYIAIGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0102861_10688064 | 3300007544 | Estuarine | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0102879_100380921 | 3300007549 | Estuarine | MTKHEIGETIGFYIFVGLMGWALVSFFPLTLGQALIISWMYNKLTDVLE* |
| Ga0102820_10486542 | 3300007554 | Estuarine | MTKHEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0102821_10228484 | 3300007557 | Estuarine | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0102916_10920391 | 3300007585 | Estuarine | HKMTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0102921_10418358 | 3300007603 | Estuarine | GFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0102863_11022441 | 3300007622 | Estuarine | EIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0102863_11475161 | 3300007622 | Estuarine | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLI |
| Ga0102895_10090761 | 3300007629 | Estuarine | MTKQEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0102865_11884823 | 3300007639 | Estuarine | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMFNKLID |
| Ga0102866_10608743 | 3300007661 | Estuarine | ETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0102862_11925552 | 3300007670 | Estuarine | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKLTDILE* |
| Ga0105746_12996642 | 3300007973 | Estuary Water | MTKHEIGTTIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE* |
| Ga0105746_13418231 | 3300007973 | Estuary Water | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIIS |
| Ga0105748_101942904 | 3300007992 | Estuary Water | FVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0108970_109630152 | 3300008055 | Estuary | MTKHEIGETIGFYIFVGLMGWALVSLFPLTWGQALIISWMFNKLIDVLE* |
| Ga0114340_10345846 | 3300008107 | Freshwater, Plankton | MTNQEIGETIGFYIIVGLLGWALVSFFPLTWGQALIISWMYNKFIDELK* |
| Ga0114340_10426915 | 3300008107 | Freshwater, Plankton | MTKHEIEATIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ* |
| Ga0114340_11149603 | 3300008107 | Freshwater, Plankton | MTKQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMYSKLIDVLQ* |
| Ga0114341_100807122 | 3300008108 | Freshwater, Plankton | MTKHEIEATIGFYIVVGLLGWALVSFFPLTWGQALIISWMYSKLIDVLQ* |
| Ga0114341_105025531 | 3300008108 | Freshwater, Plankton | ETIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0114343_11383373 | 3300008110 | Freshwater, Plankton | MTKHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKFVDELK* |
| Ga0114346_10303258 | 3300008113 | Freshwater, Plankton | MTKQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0114350_11253672 | 3300008116 | Freshwater, Plankton | MTKQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKFIDELK* |
| Ga0114876_11753132 | 3300008448 | Freshwater Lake | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMYSKLIDVSE* |
| Ga0102960_13051782 | 3300009000 | Pond Water | MTNQEIGETIGFYIVLGLLGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0102963_11830742 | 3300009001 | Pond Water | MTNQEIGETIGFYIVLGLLGWALVSFFPLTWGQALIISWMYNKLIDVLG* |
| Ga0102860_101185710 | 3300009056 | Estuarine | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQAL |
| Ga0105098_104852012 | 3300009081 | Freshwater Sediment | MTKQEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0105103_100030682 | 3300009085 | Freshwater Sediment | MTKQEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWVYNKLIDVLE* |
| Ga0105103_102893191 | 3300009085 | Freshwater Sediment | IGIIGSCEMTKQEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0105103_107567333 | 3300009085 | Freshwater Sediment | TKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0105091_100674164 | 3300009146 | Freshwater Sediment | MTKQEIGETIGFYFIVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0114918_106451243 | 3300009149 | Deep Subsurface | MTKHEIGATIGLYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0114980_101915912 | 3300009152 | Freshwater Lake | MTNQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0105102_100577023 | 3300009165 | Freshwater Sediment | MTKQEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0105104_100603669 | 3300009168 | Freshwater Sediment | MTKQEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWVYNKLIDVLE* |
| Ga0127401_10128028 | 3300009469 | Meromictic Pond | MTKQEIGETIGFYIAIGLVGWALVSFFSLTWGQALIISWMYNKLIDVLE* |
| Ga0127411_11787743 | 3300009484 | Meromictic Pond | ETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0114919_109439022 | 3300009529 | Deep Subsurface | MMTKHEIGATLGFYIIVGLMGWALVSFFPLTWGQALIISWMYNKPVSHLLMNLND* |
| Ga0129333_1004139810 | 3300010354 | Freshwater To Marine Saline Gradient | MQMTYKEIGETIGFYIIVGVLGWALVSFFPLTWAQALTISWMYSKLIDVLQ* |
| Ga0129333_103400304 | 3300010354 | Freshwater To Marine Saline Gradient | MTKQEIGETIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE* |
| Ga0129333_107862291 | 3300010354 | Freshwater To Marine Saline Gradient | MTKHEIGATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDV |
| Ga0129333_114026693 | 3300010354 | Freshwater To Marine Saline Gradient | ATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0129333_116568642 | 3300010354 | Freshwater To Marine Saline Gradient | ATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVL* |
| Ga0129336_103025493 | 3300010370 | Freshwater To Marine Saline Gradient | MTKHEIEATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLE* |
| Ga0129336_103916522 | 3300010370 | Freshwater To Marine Saline Gradient | MTKQEIGETIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ* |
| Ga0151620_10383963 | 3300011268 | Freshwater | MTNQEIGETIGFYIVVGLLGWALVSFFPLTWAQALVISWMYNKLIDVLE* |
| Ga0151620_10616305 | 3300011268 | Freshwater | MTKQEIGETIGFYIVIGLLGWALVSFFPLTWAQALIISWMYNKLIDVLE* |
| Ga0119951_11005123 | 3300012000 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINILE* |
| Ga0119952_10703004 | 3300014050 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQAL |
| Ga0181349_12380613 | 3300017778 | Freshwater Lake | QMTKHEIGATIGFYIVVGLLGWALVSFFPLTWGQALIISWMYSKLIDVLQ |
| Ga0188836_1002092 | 3300018558 | Freshwater Lake | MTKHEIGETIGLYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0188876_10000312 | 3300019089 | Freshwater Lake | MTNQEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0188835_10040014 | 3300019096 | Freshwater Lake | MTKHEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0188839_10078921 | 3300019122 | Freshwater Lake | MTKHEIREAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDELK |
| Ga0211732_14326933 | 3300020141 | Freshwater | VVGLMGLALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0211732_15889321 | 3300020141 | Freshwater | MTKHEIGETIGLYIFVGLMGWALVSFFPLTWGQALIISWMFNKL |
| Ga0211732_16038431 | 3300020141 | Freshwater | YIFVGLMGLALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0211736_101284861 | 3300020151 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWM |
| Ga0211736_101529034 | 3300020151 | Freshwater | YIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0211736_101707101 | 3300020151 | Freshwater | MTKQEIGATIGFYIFVGLMGWALVSFFPLTWGQALII |
| Ga0211736_101839896 | 3300020151 | Freshwater | MTKHEIGATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVL |
| Ga0211736_103916471 | 3300020151 | Freshwater | MTKHEIGATIGFYIFVGLMGWALVSFFPLTWGQALII |
| Ga0211736_109629918 | 3300020151 | Freshwater | GFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDGLE |
| Ga0211734_101031031 | 3300020159 | Freshwater | MTKHEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWM |
| Ga0211734_104104972 | 3300020159 | Freshwater | MTKHEIGATIGFYIIVGLMGWALVSFFPLTWGQALIISWMYNKFVDE |
| Ga0211734_107610714 | 3300020159 | Freshwater | FVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0211734_109744791 | 3300020159 | Freshwater | TIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDGLE |
| Ga0211734_112918895 | 3300020159 | Freshwater | FVGLMGWALVSFFPLTWGQALIISWMYNKFIDELK |
| Ga0211733_103063343 | 3300020160 | Freshwater | MTKHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKFVDELK |
| Ga0211729_102585822 | 3300020172 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0211729_108158122 | 3300020172 | Freshwater | MTKHEIGETIGFYIFVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0211731_102411144 | 3300020205 | Freshwater | MTKHEIGATIGFYIVVGLMGLALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0211731_102913591 | 3300020205 | Freshwater | KRIQRIYYEEPQMTKHEIGATIGFYIFVGLMGLALVSFFPLTWGQALIISWMFNKLINVL |
| Ga0211731_109178262 | 3300020205 | Freshwater | MTKHEIRATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0208360_10127275 | 3300020551 | Freshwater | MTNEEIGETIGFYIFVGVLGWALVSFFSLTWAQALIISWMYNKLIDVLQ |
| Ga0208222_100034942 | 3300020566 | Freshwater | MTKHEIVETIGFYIFVGLMGWALVSFFSLTWAQALIISWMYNKLIDVLQ |
| Ga0208229_10132836 | 3300020569 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0214163_11500003 | 3300021141 | Freshwater | GFYIAVGLVGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0213866_101646874 | 3300021425 | Seawater | MTKQEIGEAIGFYIAIGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0222715_101686565 | 3300021960 | Estuarine Water | MTKQEIGETIGFYIVIGLLGWALVSFFPLTWAQALIISWMYNKLIDVLE |
| Ga0222713_101975854 | 3300021962 | Estuarine Water | MTKHEIGATIGFYIVVGLVGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0181351_10424882 | 3300022407 | Freshwater Lake | MTKHEIGATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLQ |
| Ga0214917_100675674 | 3300022752 | Freshwater | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINILE |
| Ga0210003_13369733 | 3300024262 | Deep Subsurface | MTKHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKL |
| Ga0244777_1000088639 | 3300024343 | Estuarine | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE |
| Ga0244777_1000088658 | 3300024343 | Estuarine | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE |
| Ga0244775_107618573 | 3300024346 | Estuarine | MTNEEIGETIGFYIFVGLMGQALIISWMFNKLIDVLE |
| Ga0244775_109668141 | 3300024346 | Estuarine | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0255230_11059021 | 3300024849 | Freshwater | EMTKHEIGETIGFYIFVGLMGWALVSLFPLTWGQALIISWMFNKLIDVLE |
| Ga0208162_10743392 | 3300025674 | Aqueous | MTKQEIGETIGFYIAIGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0208784_10030134 | 3300025732 | Aqueous | MTKHEIGATIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ |
| Ga0208784_10036847 | 3300025732 | Aqueous | MTKQEIGATIGFYIVIGLLGWALVSFFPLTWAQALIISWMYNKLIDVLE |
| Ga0208802_10226322 | 3300027210 | Estuarine | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0208555_10630132 | 3300027213 | Estuarine | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE |
| Ga0208930_10385071 | 3300027237 | Estuarine | GEHKMTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE |
| Ga0208679_10041231 | 3300027247 | Estuarine | IGFYIVVGLMGWALVSFFPLTWGQALIISWMYNKLTDVLE |
| Ga0208681_10357603 | 3300027255 | Estuarine | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0208437_101343410 | 3300027525 | Estuarine | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMY |
| Ga0208437_11273231 | 3300027525 | Estuarine | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLID |
| Ga0208975_10698525 | 3300027659 | Freshwater Lentic | MTNEEIGETIGFYIFVGVLGWALVSFFSLTWAQALTISWM |
| Ga0208975_11396364 | 3300027659 | Freshwater Lentic | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNK |
| Ga0209077_11796822 | 3300027675 | Freshwater Sediment | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0209392_10734654 | 3300027683 | Freshwater Sediment | MTKQEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMFNKLID |
| Ga0209392_10930181 | 3300027683 | Freshwater Sediment | CEMTKHEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0209704_10122733 | 3300027693 | Freshwater Sediment | MTKQEIGVTIGFYIFVGLMGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0209492_12442822 | 3300027721 | Freshwater Sediment | MTKQEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0209297_10331867 | 3300027733 | Freshwater Lake | MTNQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0209593_101132952 | 3300027743 | Freshwater Sediment | MTKQEIGATIGFYIAIGLVGWALVSFFPLTWGQALIISWVYNKLIDVLE |
| Ga0209972_104754093 | 3300027793 | Freshwater Lake | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWMFNKLID |
| Ga0209107_102519895 | 3300027797 | Freshwater And Sediment | MTKHEIGETIGFYIFVGLMGWALVSFFPLTWGQALI |
| Ga0209079_101623181 | 3300027972 | Freshwater Sediment | MTKHEIGATIGFYIAVGLVGWALVSFFPLTWGQALIISWMYNKLIDVLE |
| Ga0307380_104420161 | 3300031539 | Soil | MTKQEIGATIGFYVFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0307380_113985862 | 3300031539 | Soil | MTKHEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0307379_108007431 | 3300031565 | Soil | AIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0307376_103412261 | 3300031578 | Soil | MTKHEIGETIGFYVFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0307376_103466121 | 3300031578 | Soil | MTKHEIGATIGFYIIVGLLGWALVSFFPLTWGQALIISWMF |
| Ga0307377_100211994 | 3300031673 | Soil | MTKHEIGATIGFYIIVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| Ga0315293_101242458 | 3300031746 | Sediment | MTKQEIGATIGFYIFVGLVGWALVSFFPLTWGQALIISWMFNKLTDVLE |
| Ga0315899_114392772 | 3300031784 | Freshwater | MTKHEIEATIGFYIVVGLLGWALVSFFPLTWGQALIISWMYSKLIDVLQ |
| Ga0315909_102965845 | 3300031857 | Freshwater | MTKQEIGETIGFYIFVGLVGWALVSFFPLTWGQALIISWMYSKLIDVLQ |
| Ga0315904_101256996 | 3300031951 | Freshwater | MTYKEIGATIGFYIIVGVLGWALVSFFPLTWAQALTISWMYSKLIDVLQ |
| Ga0315901_110398352 | 3300031963 | Freshwater | MTKHEIEATIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ |
| Ga0315906_102681021 | 3300032050 | Freshwater | MTKHEIEATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKL |
| Ga0315284_103913605 | 3300032053 | Sediment | MTKQEIGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0315902_100652816 | 3300032093 | Freshwater | MTKHEIEATIGFYIVVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLQ |
| Ga0315268_125256732 | 3300032173 | Sediment | IGATIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLINVLE |
| Ga0334980_0054913_1575_1679 | 3300033816 | Freshwater | MTNEEIGETIGFYIFVGVLGWALVSFFSLTWAQAL |
| Ga0334980_0073090_405_554 | 3300033816 | Freshwater | MTNQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNRLIDVLE |
| Ga0334980_0203106_672_794 | 3300033816 | Freshwater | MTKQEIGETIGFYIFVGLMGWALVSFFPLTWGQALIISWMF |
| Ga0334996_0014276_2728_2877 | 3300033994 | Freshwater | MTNQEIGETIGFYIIVGVLGWALVSFFSLTWAQALIISWMYNKLIDVLQ |
| Ga0335002_0000020_2_109 | 3300034020 | Freshwater | VVGLLGWALVSFFPLTWGQALIISWMFNKLIDVLQ |
| Ga0335002_0000068_2_118 | 3300034020 | Freshwater | MTKHEIGATIGFYIVVGLLGWALVSFFPLTWGQALIISW |
| Ga0335000_0283257_635_784 | 3300034063 | Freshwater | MTKHEIVETIGFYIFVGLMGWALVSLFPLTWGQALIISWMFNKLIDVLE |
| Ga0310127_041501_59_208 | 3300034072 | Fracking Water | MNYKQIGETIGFYIIVGVLGWALVSFFPLTWAQALTISWMYNKLIDVLQ |
| Ga0310130_0000323_1686_1838 | 3300034073 | Fracking Water | MMTKQEIGATIGFYIIVGVLGWALVSFFPLTWAQALTISWMYSKLIDVLQ |
| Ga0335020_0000056_12393_12560 | 3300034082 | Freshwater | MTKMTEKSAEKIGETIGFYVVIGLVGWALVSFFPLTWAQALVISWMYNTFIDALK |
| Ga0335020_0071398_1050_1199 | 3300034082 | Freshwater | MTKHEIGATIGFYIVVGLMGWALVSFFPLTWGQALIISWVYNKLIDVLE |
| Ga0335053_0838923_54_203 | 3300034118 | Freshwater | MTNQEIGEAIGFYIFVGLMGWALVSFFPLTWGQALIISWMFNKLIDVLE |
| ⦗Top⦘ |