


| Basic Information | |
|---|---|
| Family ID | F037653 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 37 residues |
| Representative Sequence | LSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.80 % |
| % of genes near scaffold ends (potentially truncated) | 95.21 % |
| % of genes from short scaffolds (< 2000 bps) | 68.86 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.066 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.347 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.102 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.44% β-sheet: 0.00% Coil/Unstructured: 76.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01548 | DEDD_Tnp_IS110 | 1.80 |
| PF07238 | PilZ | 1.80 |
| PF00196 | GerE | 1.20 |
| PF02371 | Transposase_20 | 1.20 |
| PF13426 | PAS_9 | 1.20 |
| PF00072 | Response_reg | 1.20 |
| PF14294 | DUF4372 | 1.20 |
| PF03069 | FmdA_AmdA | 1.20 |
| PF00383 | dCMP_cyt_deam_1 | 1.20 |
| PF13751 | DDE_Tnp_1_6 | 1.20 |
| PF00145 | DNA_methylase | 0.60 |
| PF11741 | AMIN | 0.60 |
| PF01165 | Ribosomal_S21 | 0.60 |
| PF08327 | AHSA1 | 0.60 |
| PF02666 | PS_Dcarbxylase | 0.60 |
| PF04389 | Peptidase_M28 | 0.60 |
| PF01833 | TIG | 0.60 |
| PF02518 | HATPase_c | 0.60 |
| PF09994 | DUF2235 | 0.60 |
| PF04326 | AlbA_2 | 0.60 |
| PF07508 | Recombinase | 0.60 |
| PF00857 | Isochorismatase | 0.60 |
| PF13193 | AMP-binding_C | 0.60 |
| PF01915 | Glyco_hydro_3_C | 0.60 |
| PF00561 | Abhydrolase_1 | 0.60 |
| PF09579 | Spore_YtfJ | 0.60 |
| PF03693 | ParD_antitoxin | 0.60 |
| PF02566 | OsmC | 0.60 |
| PF13517 | FG-GAP_3 | 0.60 |
| PF13606 | Ank_3 | 0.60 |
| PF14534 | DUF4440 | 0.60 |
| PF05569 | Peptidase_M56 | 0.60 |
| PF00089 | Trypsin | 0.60 |
| PF02482 | Ribosomal_S30AE | 0.60 |
| PF13519 | VWA_2 | 0.60 |
| PF06202 | GDE_C | 0.60 |
| PF14403 | CP_ATPgrasp_2 | 0.60 |
| PF13462 | Thioredoxin_4 | 0.60 |
| PF07228 | SpoIIE | 0.60 |
| PF00440 | TetR_N | 0.60 |
| PF02163 | Peptidase_M50 | 0.60 |
| PF02901 | PFL-like | 0.60 |
| PF03481 | Sua5_C | 0.60 |
| PF13620 | CarboxypepD_reg | 0.60 |
| PF04986 | Y2_Tnp | 0.60 |
| PF09836 | DUF2063 | 0.60 |
| PF11154 | DUF2934 | 0.60 |
| PF04972 | BON | 0.60 |
| PF02954 | HTH_8 | 0.60 |
| PF13360 | PQQ_2 | 0.60 |
| PF01566 | Nramp | 0.60 |
| PF13401 | AAA_22 | 0.60 |
| PF13692 | Glyco_trans_1_4 | 0.60 |
| PF00239 | Resolvase | 0.60 |
| PF13181 | TPR_8 | 0.60 |
| PF06964 | Alpha-L-AF_C | 0.60 |
| PF13424 | TPR_12 | 0.60 |
| PF07690 | MFS_1 | 0.60 |
| PF12663 | DUF3788 | 0.60 |
| PF01391 | Collagen | 0.60 |
| PF09118 | GO-like_E_set | 0.60 |
| PF00106 | adh_short | 0.60 |
| PF10415 | FumaraseC_C | 0.60 |
| PF05593 | RHS_repeat | 0.60 |
| PF12802 | MarR_2 | 0.60 |
| PF13376 | OmdA | 0.60 |
| PF08013 | GatZ_KbaZ-like | 0.60 |
| PF05598 | DUF772 | 0.60 |
| PF13589 | HATPase_c_3 | 0.60 |
| PF13180 | PDZ_2 | 0.60 |
| PF13701 | DDE_Tnp_1_4 | 0.60 |
| PF00665 | rve | 0.60 |
| PF03237 | Terminase_6N | 0.60 |
| PF02826 | 2-Hacid_dh_C | 0.60 |
| PF00356 | LacI | 0.60 |
| PF00589 | Phage_integrase | 0.60 |
| PF01695 | IstB_IS21 | 0.60 |
| PF01261 | AP_endonuc_2 | 0.60 |
| PF02896 | PEP-utilizers_C | 0.60 |
| PF13524 | Glyco_trans_1_2 | 0.60 |
| PF03073 | TspO_MBR | 0.60 |
| PF13817 | DDE_Tnp_IS66_C | 0.60 |
| PF13561 | adh_short_C2 | 0.60 |
| PF13439 | Glyco_transf_4 | 0.60 |
| PF00578 | AhpC-TSA | 0.60 |
| PF14659 | Phage_int_SAM_3 | 0.60 |
| PF02646 | RmuC | 0.60 |
| PF13624 | SurA_N_3 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.99 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.20 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.20 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.60 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.60 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.60 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.60 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.60 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.60 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.60 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.60 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.60 |
| COG1882 | Pyruvate-formate lyase | Energy production and conversion [C] | 0.60 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.60 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.60 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.60 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.60 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.60 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.60 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.60 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.60 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 0.60 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.60 |
| COG4573 | Tagatose-1,6-bisphosphate aldolase non-catalytic subunit AgaZ/GatZ | Carbohydrate transport and metabolism [G] | 0.60 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.26 % |
| Unclassified | root | N/A | 31.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10840312 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004152|Ga0062386_101661460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300004478|Ga0068972_1500612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300005174|Ga0066680_10853998 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005467|Ga0070706_101134010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300005540|Ga0066697_10393301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300005555|Ga0066692_10722139 | Not Available | 616 | Open in IMG/M |
| 3300005598|Ga0066706_10368445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter denitrificans | 1141 | Open in IMG/M |
| 3300006046|Ga0066652_100199691 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300006055|Ga0097691_1022497 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300006162|Ga0075030_101549504 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006795|Ga0075520_1310111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300006795|Ga0075520_1327158 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006893|Ga0073928_10002226 | All Organisms → cellular organisms → Bacteria | 34231 | Open in IMG/M |
| 3300006893|Ga0073928_10023368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 146 | 6235 | Open in IMG/M |
| 3300006893|Ga0073928_10687994 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300007265|Ga0099794_10199534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300009012|Ga0066710_100400780 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300009029|Ga0066793_10028587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 3087 | Open in IMG/M |
| 3300009029|Ga0066793_10046523 | Not Available | 2450 | Open in IMG/M |
| 3300009029|Ga0066793_10062241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2128 | Open in IMG/M |
| 3300009029|Ga0066793_10470017 | Not Available | 720 | Open in IMG/M |
| 3300009029|Ga0066793_10862594 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009090|Ga0099827_10124398 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300009137|Ga0066709_100477075 | Not Available | 1751 | Open in IMG/M |
| 3300009137|Ga0066709_104249928 | Not Available | 522 | Open in IMG/M |
| 3300009518|Ga0116128_1002754 | All Organisms → cellular organisms → Bacteria | 7168 | Open in IMG/M |
| 3300009518|Ga0116128_1073286 | Not Available | 1042 | Open in IMG/M |
| 3300009518|Ga0116128_1203011 | Not Available | 556 | Open in IMG/M |
| 3300009519|Ga0116108_1019911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2313 | Open in IMG/M |
| 3300009519|Ga0116108_1023495 | Not Available | 2086 | Open in IMG/M |
| 3300009521|Ga0116222_1455711 | Not Available | 558 | Open in IMG/M |
| 3300009616|Ga0116111_1101821 | Not Available | 725 | Open in IMG/M |
| 3300009618|Ga0116127_1095104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 788 | Open in IMG/M |
| 3300009630|Ga0116114_1002200 | All Organisms → cellular organisms → Bacteria | 9042 | Open in IMG/M |
| 3300009631|Ga0116115_1009044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3125 | Open in IMG/M |
| 3300009633|Ga0116129_1003087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8098 | Open in IMG/M |
| 3300009643|Ga0116110_1078483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata → Desulfosarcina ovata subsp. ovata | 1144 | Open in IMG/M |
| 3300009643|Ga0116110_1223045 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009644|Ga0116121_1314921 | Not Available | 506 | Open in IMG/M |
| 3300010329|Ga0134111_10390316 | Not Available | 594 | Open in IMG/M |
| 3300010339|Ga0074046_10002019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17808 | Open in IMG/M |
| 3300010339|Ga0074046_10012215 | Not Available | 6304 | Open in IMG/M |
| 3300010339|Ga0074046_10255642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
| 3300010339|Ga0074046_10387726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300010360|Ga0126372_13239724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300010379|Ga0136449_100067446 | All Organisms → cellular organisms → Bacteria | 7731 | Open in IMG/M |
| 3300010379|Ga0136449_101075122 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300011084|Ga0138562_1165125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300011269|Ga0137392_10477517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1035 | Open in IMG/M |
| 3300011271|Ga0137393_11026219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300012199|Ga0137383_10235339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1342 | Open in IMG/M |
| 3300012202|Ga0137363_10000732 | All Organisms → cellular organisms → Bacteria | 18311 | Open in IMG/M |
| 3300012202|Ga0137363_10002275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11380 | Open in IMG/M |
| 3300012204|Ga0137374_10115007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2491 | Open in IMG/M |
| 3300012209|Ga0137379_10619389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300012210|Ga0137378_11693167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012211|Ga0137377_10403975 | Not Available | 1304 | Open in IMG/M |
| 3300012349|Ga0137387_10806808 | Not Available | 679 | Open in IMG/M |
| 3300012357|Ga0137384_10146293 | Not Available | 1978 | Open in IMG/M |
| 3300012359|Ga0137385_11174469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300012917|Ga0137395_10668325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 751 | Open in IMG/M |
| 3300012927|Ga0137416_10142919 | Not Available | 1862 | Open in IMG/M |
| 3300012929|Ga0137404_10275013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1453 | Open in IMG/M |
| 3300014489|Ga0182018_10022340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4146 | Open in IMG/M |
| 3300014489|Ga0182018_10183012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cronobacter → Cronobacter sakazakii → Cronobacter sakazakii 701 | 1180 | Open in IMG/M |
| 3300014489|Ga0182018_10309246 | Not Available | 858 | Open in IMG/M |
| 3300014495|Ga0182015_10000030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 175198 | Open in IMG/M |
| 3300014495|Ga0182015_10114583 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
| 3300014495|Ga0182015_10297937 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_54_9 | 1055 | Open in IMG/M |
| 3300014501|Ga0182024_10115216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3864 | Open in IMG/M |
| 3300014501|Ga0182024_10562626 | Not Available | 1436 | Open in IMG/M |
| 3300014501|Ga0182024_11564070 | Not Available | 749 | Open in IMG/M |
| 3300014501|Ga0182024_11879373 | Not Available | 667 | Open in IMG/M |
| 3300014501|Ga0182024_11966694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300014501|Ga0182024_12420998 | Not Available | 568 | Open in IMG/M |
| 3300014838|Ga0182030_10218141 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300014839|Ga0182027_10484782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300016357|Ga0182032_10035356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3101 | Open in IMG/M |
| 3300016404|Ga0182037_10235273 | Not Available | 1441 | Open in IMG/M |
| 3300016445|Ga0182038_10049125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2804 | Open in IMG/M |
| 3300016750|Ga0181505_10066870 | Not Available | 551 | Open in IMG/M |
| 3300017938|Ga0187854_10011695 | All Organisms → cellular organisms → Bacteria | 5407 | Open in IMG/M |
| 3300017938|Ga0187854_10244242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300017946|Ga0187879_10003050 | All Organisms → cellular organisms → Bacteria | 11287 | Open in IMG/M |
| 3300017955|Ga0187817_10129895 | Not Available | 1596 | Open in IMG/M |
| 3300017955|Ga0187817_10268023 | Not Available | 1088 | Open in IMG/M |
| 3300017955|Ga0187817_10368623 | Not Available | 916 | Open in IMG/M |
| 3300017955|Ga0187817_10938574 | Not Available | 554 | Open in IMG/M |
| 3300017955|Ga0187817_11044954 | Not Available | 524 | Open in IMG/M |
| 3300018003|Ga0187876_1006417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6928 | Open in IMG/M |
| 3300018009|Ga0187884_10105090 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300018012|Ga0187810_10153069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300018013|Ga0187873_1020712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3377 | Open in IMG/M |
| 3300018022|Ga0187864_10015819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4828 | Open in IMG/M |
| 3300018022|Ga0187864_10186712 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300018030|Ga0187869_10141611 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300018057|Ga0187858_10586344 | Not Available | 674 | Open in IMG/M |
| 3300018086|Ga0187769_10014344 | All Organisms → cellular organisms → Bacteria | 5135 | Open in IMG/M |
| 3300018482|Ga0066669_10440420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300018482|Ga0066669_10869392 | Not Available | 804 | Open in IMG/M |
| 3300019887|Ga0193729_1260797 | Not Available | 541 | Open in IMG/M |
| 3300020170|Ga0179594_10299049 | Not Available | 609 | Open in IMG/M |
| 3300020199|Ga0179592_10379683 | Not Available | 619 | Open in IMG/M |
| 3300021086|Ga0179596_10306955 | Not Available | 792 | Open in IMG/M |
| 3300021180|Ga0210396_10899992 | Not Available | 754 | Open in IMG/M |
| 3300021401|Ga0210393_10446961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300021407|Ga0210383_10127521 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300021474|Ga0210390_11607610 | Not Available | 511 | Open in IMG/M |
| 3300022524|Ga0224534_1005164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4908 | Open in IMG/M |
| 3300022557|Ga0212123_10003458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 33027 | Open in IMG/M |
| 3300022557|Ga0212123_10026198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6232 | Open in IMG/M |
| 3300022557|Ga0212123_10121911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2071 | Open in IMG/M |
| 3300023090|Ga0224558_1009162 | All Organisms → cellular organisms → Bacteria | 6269 | Open in IMG/M |
| 3300023259|Ga0224551_1088932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300024271|Ga0224564_1047050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300025432|Ga0208821_1009118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2544 | Open in IMG/M |
| 3300025459|Ga0208689_1003335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 7155 | Open in IMG/M |
| 3300025612|Ga0208691_1000668 | All Organisms → cellular organisms → Bacteria | 12535 | Open in IMG/M |
| 3300025612|Ga0208691_1042408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300025650|Ga0209385_1131942 | Not Available | 765 | Open in IMG/M |
| 3300025878|Ga0209584_10023235 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300025878|Ga0209584_10423735 | Not Available | 514 | Open in IMG/M |
| 3300025888|Ga0209540_10339330 | Not Available | 840 | Open in IMG/M |
| 3300025939|Ga0207665_10125665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1816 | Open in IMG/M |
| 3300026223|Ga0209840_1059215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300026273|Ga0209881_1083128 | Not Available | 794 | Open in IMG/M |
| 3300026296|Ga0209235_1113078 | Not Available | 1152 | Open in IMG/M |
| 3300026304|Ga0209240_1058245 | Not Available | 1448 | Open in IMG/M |
| 3300026304|Ga0209240_1151923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300026323|Ga0209472_1268703 | Not Available | 543 | Open in IMG/M |
| 3300026481|Ga0257155_1090690 | Not Available | 502 | Open in IMG/M |
| 3300027011|Ga0207740_1001089 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
| 3300027011|Ga0207740_1019989 | Not Available | 891 | Open in IMG/M |
| 3300027575|Ga0209525_1033170 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300027652|Ga0209007_1028980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1422 | Open in IMG/M |
| 3300027657|Ga0256865_1184706 | Not Available | 552 | Open in IMG/M |
| 3300027812|Ga0209656_10074687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1838 | Open in IMG/M |
| 3300027846|Ga0209180_10392261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300027854|Ga0209517_10164305 | Not Available | 1407 | Open in IMG/M |
| 3300027875|Ga0209283_10080737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2107 | Open in IMG/M |
| 3300027894|Ga0209068_10032537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2589 | Open in IMG/M |
| 3300027894|Ga0209068_10043485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2264 | Open in IMG/M |
| 3300027895|Ga0209624_10100578 | Not Available | 1888 | Open in IMG/M |
| 3300028780|Ga0302225_10588595 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300029889|Ga0246001_1034517 | Not Available | 1247 | Open in IMG/M |
| 3300030007|Ga0311338_10831968 | Not Available | 916 | Open in IMG/M |
| 3300030007|Ga0311338_11121511 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300030058|Ga0302179_10381381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300030114|Ga0311333_10139600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1843 | Open in IMG/M |
| 3300031234|Ga0302325_10244378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3001 | Open in IMG/M |
| 3300031236|Ga0302324_101745677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 794 | Open in IMG/M |
| 3300031668|Ga0318542_10032680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2255 | Open in IMG/M |
| 3300031708|Ga0310686_110507265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300031753|Ga0307477_10000148 | All Organisms → cellular organisms → Bacteria | 98532 | Open in IMG/M |
| 3300031754|Ga0307475_11112222 | Not Available | 618 | Open in IMG/M |
| 3300031879|Ga0306919_11264948 | Not Available | 559 | Open in IMG/M |
| 3300031902|Ga0302322_101463653 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031941|Ga0310912_10506264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum → Ralstonia solanacearum UW551 | 941 | Open in IMG/M |
| 3300032001|Ga0306922_12199716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300032044|Ga0318558_10100759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1352 | Open in IMG/M |
| 3300032160|Ga0311301_11342233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300032782|Ga0335082_10278096 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300032829|Ga0335070_10034847 | All Organisms → cellular organisms → Bacteria | 5678 | Open in IMG/M |
| 3300032829|Ga0335070_10332358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300032893|Ga0335069_10006888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16465 | Open in IMG/M |
| 3300032893|Ga0335069_10077981 | All Organisms → cellular organisms → Bacteria | 4241 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 10.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.19% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.59% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 3.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.20% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.60% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.60% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_108403121 | 3300001593 | Forest Soil | SVTLFEKTPILCALQALDADADFAENVNQLILFDL* |
| Ga0062386_1016614601 | 3300004152 | Bog Forest Soil | ILQILSLTLFEKTPILCALQGIDEDANFTENLNQLILFDF* |
| Ga0068972_15006122 | 3300004478 | Peatlands Soil | YQILQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF* |
| Ga0066680_108539982 | 3300005174 | Soil | LQILSVTLFEKTPILCALQAIDVEANFAENVNQLILFDF* |
| Ga0070706_1011340102 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TLQILSVTLFEKTPILCALQVPHADAEFADNVNQLILFDI* |
| Ga0066697_103933012 | 3300005540 | Soil | VTLFEKTPILCALQAIGVEANFAENVNQLILFDF* |
| Ga0066692_107221391 | 3300005555 | Soil | VTLFEKTPILCALQAIDVEANFAENVNQLILFDF* |
| Ga0066706_103684451 | 3300005598 | Soil | VTLFEKTPILCALQAPEADAEFAENVNQLILFDI* |
| Ga0066652_1001996915 | 3300006046 | Soil | QILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI* |
| Ga0097691_10224976 | 3300006055 | Arctic Peat Soil | SLTLFEKTPILCVLQSIEEDANFAENANQLILFDF* |
| Ga0075030_1015495041 | 3300006162 | Watersheds | LTLFEKTPILCALQAIDRDANFVDNPNQLILFDF* |
| Ga0075520_13101112 | 3300006795 | Arctic Peat Soil | SLTLFEKTPILCALQGIDEDTNLAENANQLILFDF* |
| Ga0075520_13271582 | 3300006795 | Arctic Peat Soil | YQILQILSLTLFEKTPILCALQGIDEDANFTENVNQLILFEF* |
| Ga0073928_100022264 | 3300006893 | Iron-Sulfur Acid Spring | VKTQIWILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF* |
| Ga0073928_100233687 | 3300006893 | Iron-Sulfur Acid Spring | LTLFEKTPILCVLQAIDQDANFAENVNQLILFDF* |
| Ga0073928_106879943 | 3300006893 | Iron-Sulfur Acid Spring | SVTLFEKAPILCALQAPEADAEFAENVNQLILFDI* |
| Ga0099794_101995342 | 3300007265 | Vadose Zone Soil | VTLFEKTPILCALQAPDADAEFAENVNQLILFDI* |
| Ga0066710_1004007803 | 3300009012 | Grasslands Soil | SVTLFEKTPILCALQALDAGADFAENVNQLILFDL |
| Ga0066793_100285871 | 3300009029 | Prmafrost Soil | SLTLFEKTPILCALQAIEEDANFTENANQLILFDF* |
| Ga0066793_100465232 | 3300009029 | Prmafrost Soil | SLTLFEKTPILCALQGIEEDANFTANANQLILFDF* |
| Ga0066793_100622412 | 3300009029 | Prmafrost Soil | LQILSLTLFEKTPILCALQSIDLDSNFTENANQLILFDF* |
| Ga0066793_104700171 | 3300009029 | Prmafrost Soil | LQILSLTLFEKTPILCALQAIEENANFIENANQLILFDF* |
| Ga0066793_108625941 | 3300009029 | Prmafrost Soil | TLQILSVTLFEKTPILRALRALDAGANFAENVNQLILFDF* |
| Ga0099827_101243982 | 3300009090 | Vadose Zone Soil | SVTLFEKTPILCALQAIDMEANFGENVNQLILFDF* |
| Ga0066709_1004770753 | 3300009137 | Grasslands Soil | SVTLFEKTPILCALQAIGVEANFAENVNQLILFDF* |
| Ga0066709_1042499281 | 3300009137 | Grasslands Soil | SVTLFEKTPILCALQAPEADAEFAENVNQLILFDI* |
| Ga0116128_10027541 | 3300009518 | Peatland | ILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL* |
| Ga0116128_10732861 | 3300009518 | Peatland | SVTLFEKTPILYALQPLEVGADFAENVNQLILFDL* |
| Ga0116128_12030111 | 3300009518 | Peatland | SVTLFEKTPILCALQVPEAGAEFAETVNQLILFDI* |
| Ga0116108_10199111 | 3300009519 | Peatland | VTLFEKTPILYALQPLEVGADFAENVNQLILFDL* |
| Ga0116108_10234953 | 3300009519 | Peatland | LSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI* |
| Ga0116222_14557111 | 3300009521 | Peatlands Soil | LQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF* |
| Ga0116111_11018212 | 3300009616 | Peatland | SLTLFEKTPILCALQPIDPDANFAEHANQLILFDF* |
| Ga0116127_10951043 | 3300009618 | Peatland | ILSLTLFEKTPILCALQAIDQDANSPQNANQLILFDLLTGQQ* |
| Ga0116114_100220016 | 3300009630 | Peatland | SVTLFEKTLILCALQAPEADAEFAENVNQLILFDI* |
| Ga0116115_10090445 | 3300009631 | Peatland | TLFEKTPILCALQAIDQDANSPQNANQLILFDLLTGQQ* |
| Ga0116129_100308710 | 3300009633 | Peatland | SVTLFEKTPILCALQASDAEAEFTENVNQLILFDI* |
| Ga0116110_10784831 | 3300009643 | Peatland | SLTLFEKTPILCALQAIDRDANFAENANQLILFDF* |
| Ga0116110_12230451 | 3300009643 | Peatland | ILQILSLTLFEKTPILCALQAIDRDANFAENANQLILFDF* |
| Ga0116121_13149213 | 3300009644 | Peatland | VTLFEKTPILCALQVPEAGAEFAETVNQLILFDI* |
| Ga0134111_103903161 | 3300010329 | Grasslands Soil | YQILQILSLTLFEKTPILCALRPIDQDASSENVNQLILFEF* |
| Ga0074046_1000201918 | 3300010339 | Bog Forest Soil | ILQILSVSLFEKTPILCALQAIDEDGNSTDNVNQLILFDF* |
| Ga0074046_100122155 | 3300010339 | Bog Forest Soil | SVSLFEKTPILCALQSIDQDSNFTENANQLILFDF* |
| Ga0074046_102556421 | 3300010339 | Bog Forest Soil | QILQILSVSLFEKTPILCALQAIDEDGNSTDNVNQLILFDS* |
| Ga0074046_103877261 | 3300010339 | Bog Forest Soil | SVTLFEKTPILCALQTPEADAEFAESVNQLILFDI* |
| Ga0126372_132397242 | 3300010360 | Tropical Forest Soil | SLTLFEKTPISCALQAIDTDANFAENANQLILFEF* |
| Ga0136449_10006744610 | 3300010379 | Peatlands Soil | SVTLFEKTPILCALQAFDTDADFAENVNQLILFDL* |
| Ga0136449_1010751221 | 3300010379 | Peatlands Soil | QILQILSLTLFEKTPILCALQAIDRDANFTENVNQLILFNF* |
| Ga0138562_11651251 | 3300011084 | Peatlands Soil | LTLFEKTPILCALQAIDQDANFAENVNQLILFDF* |
| Ga0137392_104775172 | 3300011269 | Vadose Zone Soil | SVTLFEKTPILCALQAIDVEANFAENVNQLILFDF* |
| Ga0137393_110262191 | 3300011271 | Vadose Zone Soil | ILSVTLFEKRPILCALQAIGVEANFAENVNHLILFDF* |
| Ga0137383_102353391 | 3300012199 | Vadose Zone Soil | SLYQILQSLSLTLIEKTPILCVLQAIDQNANCAENANQLILFDF* |
| Ga0137363_1000073223 | 3300012202 | Vadose Zone Soil | SITLFEKTPILCALQTIDPDANFAESANQLILFDF* |
| Ga0137363_100022751 | 3300012202 | Vadose Zone Soil | ITLFEKTPILCALQTIDPDANFAESANQLILFDF* |
| Ga0137374_101150075 | 3300012204 | Vadose Zone Soil | SLTLFEKTPILCVLQAIDQNANFAENANQLILFDF* |
| Ga0137379_106193892 | 3300012209 | Vadose Zone Soil | SVTLFEKTPILCALQTPEADAEFAENVNQLILFDI* |
| Ga0137378_116931672 | 3300012210 | Vadose Zone Soil | LQILSLTLFEKTPILCVLQAIDQNANFAENANQLILFHF* |
| Ga0137377_104039752 | 3300012211 | Vadose Zone Soil | LSVTLFEKTPILCALQAIDMEANFGENVNQLILFDF* |
| Ga0137387_108068081 | 3300012349 | Vadose Zone Soil | MNVLSVTLFEKTPISCALQAIDVEANFAENVNQLILFDF* |
| Ga0137384_101462933 | 3300012357 | Vadose Zone Soil | YQALQILSVTLFEKTPILCALQTPEADAEFAENVNQLILFDI* |
| Ga0137385_111744691 | 3300012359 | Vadose Zone Soil | ILSLTLFEKTPILCALQAIDQDANLAENANQLILFDF* |
| Ga0137395_106683252 | 3300012917 | Vadose Zone Soil | SVTLFEKTPILCALQALDTGADFTENVNQLILFDL* |
| Ga0137416_101429192 | 3300012927 | Vadose Zone Soil | SVTLFEKTPISCALQALDVGADFAENVNQLILFDL* |
| Ga0137404_102750134 | 3300012929 | Vadose Zone Soil | QILQILSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF* |
| Ga0182018_100223408 | 3300014489 | Palsa | SVTLFEKTPILCALQAPDADAEFAENVNQLILFDI* |
| Ga0182018_101830121 | 3300014489 | Palsa | ILSVTLFEKTPILCALQAPDADAEFAENVNQLILFDI* |
| Ga0182018_103092462 | 3300014489 | Palsa | LSITLFEKTPILCALQAIDVEANFAENVNQLILFDF* |
| Ga0182015_10000030164 | 3300014495 | Palsa | SVTLFEKTTILCALQTPEADAEFAESVNQLILFDI* |
| Ga0182015_101145834 | 3300014495 | Palsa | SVTLFEKIPILCALQAPDADAEFTENVNQLILFDI* |
| Ga0182015_102979373 | 3300014495 | Palsa | SITLFEKTPILCALQAIDVEANFAENVNQLILFDF* |
| Ga0182024_101152164 | 3300014501 | Permafrost | SLTLFEKTPILYALQAIDADANFAENVNQLILFDF* |
| Ga0182024_105626261 | 3300014501 | Permafrost | SLTLFERTPILCALQPIEPDANSAENVKQLILFDF* |
| Ga0182024_115640701 | 3300014501 | Permafrost | ILSVTLFEKTPILCALQAPDADAEFTENVNQLILFDI* |
| Ga0182024_118793731 | 3300014501 | Permafrost | LTLFEKTPILCALQAIDPDANFAENVNQLILFNF* |
| Ga0182024_119666942 | 3300014501 | Permafrost | SLTLFEKTPILCALQAIDPDANFAENVNQLILFNF* |
| Ga0182024_124209982 | 3300014501 | Permafrost | SVTLFEKTPISCALQAIDVEANFAENVNQLILFDF* |
| Ga0182030_102181411 | 3300014838 | Bog | LSLTLFEKTPILRALQTFDVDKDLAENHNQLILFDF* |
| Ga0182027_104847821 | 3300014839 | Fen | SLTLFEKTPILCALQTIDLDANFTENVNQLILFEF* |
| Ga0182032_100353568 | 3300016357 | Soil | MADTIPQILSLTVFKKTPISCALQAIDEDANFTQNVNQLILFEF |
| Ga0182037_102352732 | 3300016404 | Soil | SVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF |
| Ga0182038_100491256 | 3300016445 | Soil | MADTILQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF |
| Ga0181505_100668702 | 3300016750 | Peatland | ASLSNQILQILSPTLFEKTPILCALQTDDAHSNFTHDANQLILFNF |
| Ga0187854_1001169511 | 3300017938 | Peatland | SVTLFEKTLILCALQAPEADAEFAENVNQLILFDI |
| Ga0187854_102442422 | 3300017938 | Peatland | LSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI |
| Ga0187879_100030501 | 3300017946 | Peatland | SVTLFEKTPILCALQVPEAGAEFAETVNQLILFDI |
| Ga0187817_101298952 | 3300017955 | Freshwater Sediment | SLTLFEKTPILCALQAIDQDANFAENVNQLILFDF |
| Ga0187817_102680233 | 3300017955 | Freshwater Sediment | LQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF |
| Ga0187817_103686231 | 3300017955 | Freshwater Sediment | LSLTLFEKTPILCALQAIDQDANFAENANQLILFDF |
| Ga0187817_109385742 | 3300017955 | Freshwater Sediment | SLTLFEKTPILCALQAIDPDANFAENVNQLILFDF |
| Ga0187817_110449542 | 3300017955 | Freshwater Sediment | SLTLFEKTPILCALQAIDQDANFAQNVNQLILFDF |
| Ga0187876_100641710 | 3300018003 | Peatland | SVSLFEKTPILCTLQAIGGDANFAENVNQLILFDF |
| Ga0187884_101050904 | 3300018009 | Peatland | LSVTLFEKTPILCALQAPESDAKFAENVNQLILFDI |
| Ga0187810_101530693 | 3300018012 | Freshwater Sediment | QIFSLTLFEKTPILCALEAIDADANFSENVNQLILFNF |
| Ga0187873_10207121 | 3300018013 | Peatland | ILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL |
| Ga0187864_100158191 | 3300018022 | Peatland | ILQILSLTLFEKTPILCALQAIDRDANFAENANQLILFDF |
| Ga0187864_101867121 | 3300018022 | Peatland | SLTLFEKTPILCALQAIDRDANFAENANQLILFDF |
| Ga0187869_101416112 | 3300018030 | Peatland | YQTLQILSVTLFEKIPILCALQTREADAEFVESVNRLILFDI |
| Ga0187858_105863442 | 3300018057 | Peatland | ILQILSLTLFEKTPILCALQAIDRDANFAENANHLILFYF |
| Ga0187769_100143441 | 3300018086 | Tropical Peatland | LEILSVSLFEKTPILCALQAIDADANFTENANQLILFQLLTEQQ |
| Ga0066669_104404202 | 3300018482 | Grasslands Soil | LQILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI |
| Ga0066669_108693921 | 3300018482 | Grasslands Soil | SLTLFEKTPILCALRPIDQDASSTENVNQLILFEF |
| Ga0193729_12607971 | 3300019887 | Soil | LSLTLFEKTPILCALQAIDQDANFPENVNQLILFDF |
| Ga0179594_102990492 | 3300020170 | Vadose Zone Soil | LSLTLFEKTPILCTLQTIDEGANFAKNLNQLILFEF |
| Ga0179592_103796832 | 3300020199 | Vadose Zone Soil | LSLTLFEKTPILCALQAIDPDANFAENANQLILFDF |
| Ga0179596_103069551 | 3300021086 | Vadose Zone Soil | LSVTLFEKTPILCALQTPEADAEFAENVNQLILFDI |
| Ga0210396_108999922 | 3300021180 | Soil | LSLTLFEKTPILCALQAPEADAEFAENVNQLILFDI |
| Ga0210393_104469611 | 3300021401 | Soil | SVTLFEKTPILCALDAPDADAEFTENVNQLILFDI |
| Ga0210383_101275213 | 3300021407 | Soil | LSVTLFEKTPILCALQAPDADAEFAENVNQLILFDI |
| Ga0210390_116076102 | 3300021474 | Soil | ILSVPLFEKTPILCALQAPDAEAEFSEKVNQLILFDI |
| Ga0224534_10051645 | 3300022524 | Soil | LSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL |
| Ga0212123_100034583 | 3300022557 | Iron-Sulfur Acid Spring | VKTQIWILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF |
| Ga0212123_100261981 | 3300022557 | Iron-Sulfur Acid Spring | SLTLFEKTPILCVLQAIDQDANFAENVNQLILFDF |
| Ga0212123_101219112 | 3300022557 | Iron-Sulfur Acid Spring | SVTLFEKAPILCALQAPEADAEFAENVNQLILFDI |
| Ga0224558_10091627 | 3300023090 | Soil | LSLTLFEKTPILCALQAIDRDANFAENANQLILFDF |
| Ga0224551_10889321 | 3300023259 | Soil | LSITLFEKTPILCALQAIDVEANFAENVNQLILFDF |
| Ga0224564_10470501 | 3300024271 | Soil | LSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI |
| Ga0208821_10091181 | 3300025432 | Peatland | QILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL |
| Ga0208689_10033358 | 3300025459 | Peatland | SVTLFEKTPILYALQPLEVGADFAENVNQLILFDL |
| Ga0208691_10006681 | 3300025612 | Peatland | YQALQILSVTLFEKTLILCALQAPEADAEFAENVNQLILFDI |
| Ga0208691_10424083 | 3300025612 | Peatland | ILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI |
| Ga0209385_11319421 | 3300025650 | Arctic Peat Soil | LSLTLFEKTPILCALQGIDEDTNLAENANQLILFDF |
| Ga0209584_100232353 | 3300025878 | Arctic Peat Soil | LSLTLFEKTPILCVLQGIDEDTNLAENANQLILFDF |
| Ga0209584_104237352 | 3300025878 | Arctic Peat Soil | LSLTLFEKTPILCALQSIEEDASFAENANQLILFDF |
| Ga0209540_103393303 | 3300025888 | Arctic Peat Soil | LSLTLFEKTPILCALQAIDQDAHFAENVNQLILFDF |
| Ga0207665_101256651 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LQILSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI |
| Ga0209840_10592152 | 3300026223 | Soil | LSLTLFEKTPILCALQGIEEDANFTANANQLILFDF |
| Ga0209881_10831281 | 3300026273 | Soil | TSTRLFEKTPILCALQALDADANFTENVNQLILFNS |
| Ga0209235_11130782 | 3300026296 | Grasslands Soil | LSVTLFEKTPILCALQAIGVEANFAENVNQLILFDF |
| Ga0209240_10582453 | 3300026304 | Grasslands Soil | ILSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF |
| Ga0209240_11519231 | 3300026304 | Grasslands Soil | LSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF |
| Ga0209472_12687032 | 3300026323 | Soil | LSLTLFEKTPILCALRPIDQDASSTENVNQLILFEF |
| Ga0257155_10906901 | 3300026481 | Soil | LSVTLFEKTPILCALQAPDADAEFTENVNQLILFDI |
| Ga0207740_10010897 | 3300027011 | Tropical Forest Soil | ILSVSLFEKTPISCALQAIDEDANFAKNVNQLIFFDF |
| Ga0207740_10199891 | 3300027011 | Tropical Forest Soil | ILSVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF |
| Ga0209525_10331701 | 3300027575 | Forest Soil | QILSVTLFEKTPILCALQTSEADVEFAESVNQLILFDI |
| Ga0209007_10289804 | 3300027652 | Forest Soil | YQTLQILSVTLFEKTPILCALQASDAEAEFTKNVNQLILFDI |
| Ga0256865_11847061 | 3300027657 | Soil | LSLTLFEKTPILCALQAIDADANFTENVNQLILFNF |
| Ga0209656_100746874 | 3300027812 | Bog Forest Soil | LSLTLFEKAPILCALQGIEEDASFTGNANQLILFDF |
| Ga0209180_103922612 | 3300027846 | Vadose Zone Soil | LSVTLFEKTPILCALQAIDVEANFAENVNQLILFDF |
| Ga0209517_101643051 | 3300027854 | Peatlands Soil | LSVTLFEKTPILCALQAFDTDADFAENVNQLILFDL |
| Ga0209283_100807373 | 3300027875 | Vadose Zone Soil | LQVLSVTLFEKTPISYALQTIDPDANFATNVNQLILFEF |
| Ga0209068_100325375 | 3300027894 | Watersheds | SLTLFEKTPILCALQMIDPKANFAKNVNQLILFDF |
| Ga0209068_100434853 | 3300027894 | Watersheds | SVTLFEKTPILCALQAPDAGANFAENVNQLILFDL |
| Ga0209624_101005782 | 3300027895 | Forest Soil | LSVTLFEKTPILCALQVPEADAEFAENVNQLILFDI |
| Ga0302225_105885953 | 3300028780 | Palsa | ILSVTLFEKTPILCALQPLHAGADLAENVNQLILFDL |
| Ga0246001_10345171 | 3300029889 | Peat | SVTLFEKTPILCALQAPEADAEFAENVNQLILFDI |
| Ga0311338_108319681 | 3300030007 | Palsa | LQTLSVTLFEKTPISCALQAIDMEADFSENINQLILFDF |
| Ga0311338_111215111 | 3300030007 | Palsa | SVTLFEKTPISCALQASDVEADFTENVNQLILFDF |
| Ga0302179_103813811 | 3300030058 | Palsa | YQALQILSVTHFEKTALLSALQDPEAGAELAENVNQLILFDI |
| Ga0311333_101396002 | 3300030114 | Fen | SITLFEKTPILCALQTIEEDANLAEDANQLILFDF |
| Ga0302325_102443781 | 3300031234 | Palsa | ILSVTLFEKTPISCALQASDVEADFTENVNQLILFDF |
| Ga0302324_1017456771 | 3300031236 | Palsa | LSLTLFEKTPILCALQAIDEDANFVENVNQLILFEF |
| Ga0318542_100326801 | 3300031668 | Soil | LTDVQPHLFSMADTIPQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF |
| Ga0310686_1105072653 | 3300031708 | Soil | LVPLSLTLFEKTPILCALQAIERDADIAEDVNQLMLFDF |
| Ga0307477_1000014841 | 3300031753 | Hardwood Forest Soil | LEDPETLSVTLFEKTPILCALQTPEADAEFAESVNQLIRFDI |
| Ga0307475_111122222 | 3300031754 | Hardwood Forest Soil | ADSPILSITLFEKTPILCALQAINQDASFAESANQLILFDF |
| Ga0306919_112649482 | 3300031879 | Soil | MADTIPQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF |
| Ga0302322_1014636531 | 3300031902 | Fen | LSLTLFEKTPILCALQSLEQDANFTENANQLILFDF |
| Ga0310912_105062641 | 3300031941 | Soil | LSVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF |
| Ga0306922_121997161 | 3300032001 | Soil | QILSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI |
| Ga0318558_101007592 | 3300032044 | Soil | LSLTLFEKTPISCALQVSDEGPNFTDNVNQLILFEF |
| Ga0311301_113422331 | 3300032160 | Peatlands Soil | LSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF |
| Ga0335082_102780963 | 3300032782 | Soil | LSLTLFEKTPISCALRAIDRQANFAENANQLILFEF |
| Ga0335070_100348479 | 3300032829 | Soil | LSLTLFEKTPILCALQAIDPDANFSENANQLILFEF |
| Ga0335070_103323582 | 3300032829 | Soil | SLTLFEKTPISCALRAIDRQANFAENANQLILFDF |
| Ga0335069_1000688816 | 3300032893 | Soil | VLSLTLFEKTPISCALRAIDRQANFAENANQLILFEF |
| Ga0335069_100779811 | 3300032893 | Soil | ILQVLSLTLFEKTPILCALQSVDPDFHLTENANQLILFEF |
| ⦗Top⦘ |