


| Basic Information | |
|---|---|
| Family ID | F037401 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MHTTILATFFEISRTVVSMCSAGILLFLVALWAAKTDIARA |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.02 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.86 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF03950 | tRNA-synt_1c_C | 7.74 |
| PF01042 | Ribonuc_L-PSP | 2.38 |
| PF13564 | DoxX_2 | 1.19 |
| PF03544 | TonB_C | 1.19 |
| PF11453 | DUF2950 | 1.19 |
| PF02517 | Rce1-like | 1.19 |
| PF07687 | M20_dimer | 1.19 |
| PF08753 | NikR_C | 1.19 |
| PF12833 | HTH_18 | 1.19 |
| PF01039 | Carboxyl_trans | 1.19 |
| PF09957 | VapB_antitoxin | 0.60 |
| PF02635 | DrsE | 0.60 |
| PF13432 | TPR_16 | 0.60 |
| PF13548 | DUF4126 | 0.60 |
| PF13426 | PAS_9 | 0.60 |
| PF00232 | Glyco_hydro_1 | 0.60 |
| PF14022 | DUF4238 | 0.60 |
| PF12680 | SnoaL_2 | 0.60 |
| PF11937 | DUF3455 | 0.60 |
| PF06742 | DUF1214 | 0.60 |
| PF00903 | Glyoxalase | 0.60 |
| PF08818 | DUF1801 | 0.60 |
| PF00676 | E1_dh | 0.60 |
| PF00392 | GntR | 0.60 |
| PF02368 | Big_2 | 0.60 |
| PF01431 | Peptidase_M13 | 0.60 |
| PF14300 | DUF4375 | 0.60 |
| PF03446 | NAD_binding_2 | 0.60 |
| PF00144 | Beta-lactamase | 0.60 |
| PF00076 | RRM_1 | 0.60 |
| PF10137 | TIR-like | 0.60 |
| PF13229 | Beta_helix | 0.60 |
| PF14534 | DUF4440 | 0.60 |
| PF14020 | DUF4236 | 0.60 |
| PF05908 | Gamma_PGA_hydro | 0.60 |
| PF02518 | HATPase_c | 0.60 |
| PF05649 | Peptidase_M13_N | 0.60 |
| PF01548 | DEDD_Tnp_IS110 | 0.60 |
| PF07883 | Cupin_2 | 0.60 |
| PF13601 | HTH_34 | 0.60 |
| PF05973 | Gp49 | 0.60 |
| PF10592 | AIPR | 0.60 |
| PF03061 | 4HBT | 0.60 |
| PF01068 | DNA_ligase_A_M | 0.60 |
| PF03683 | UPF0175 | 0.60 |
| PF00326 | Peptidase_S9 | 0.60 |
| PF03144 | GTP_EFTU_D2 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.74 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.38 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.19 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.19 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.19 |
| COG0864 | Metal-responsive transcriptional regulator, contains CopG/Arc/MetJ DNA-binding domain | Transcription [K] | 1.19 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.19 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.19 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.19 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.19 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.60 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.60 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.60 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.60 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.60 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.60 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.60 |
| COG4195 | Phage-related replication protein YjqB, UPF0714/DUF867 family | Mobilome: prophages, transposons [X] | 0.60 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.60 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.60 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.60 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.60 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.57 % |
| Unclassified | root | N/A | 21.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10002045 | All Organisms → cellular organisms → Bacteria | 14868 | Open in IMG/M |
| 3300004091|Ga0062387_101222022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300004092|Ga0062389_103306897 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300004152|Ga0062386_101302539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300004635|Ga0062388_100202842 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300005334|Ga0068869_101391215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005436|Ga0070713_100264588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1573 | Open in IMG/M |
| 3300005439|Ga0070711_100265176 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300005458|Ga0070681_10977081 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005471|Ga0070698_100777697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300005537|Ga0070730_10950821 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005557|Ga0066704_10455362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300005569|Ga0066705_10878519 | Not Available | 532 | Open in IMG/M |
| 3300005602|Ga0070762_10310728 | Not Available | 996 | Open in IMG/M |
| 3300005602|Ga0070762_11192308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. BCC1644 | 526 | Open in IMG/M |
| 3300005610|Ga0070763_10607863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005712|Ga0070764_10434904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300005841|Ga0068863_100009327 | All Organisms → cellular organisms → Bacteria | 9575 | Open in IMG/M |
| 3300006041|Ga0075023_100601717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300006050|Ga0075028_100475855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006059|Ga0075017_100964138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300006059|Ga0075017_101512875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300006086|Ga0075019_10563661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300006102|Ga0075015_100249450 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006162|Ga0075030_101039315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300006172|Ga0075018_10055997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300006176|Ga0070765_100217188 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300006893|Ga0073928_10034777 | All Organisms → cellular organisms → Bacteria | 4767 | Open in IMG/M |
| 3300006893|Ga0073928_11231544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300006954|Ga0079219_11224139 | Not Available | 653 | Open in IMG/M |
| 3300009143|Ga0099792_10055885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1940 | Open in IMG/M |
| 3300009143|Ga0099792_10205117 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWC2_49_9 | 1124 | Open in IMG/M |
| 3300009521|Ga0116222_1448879 | Not Available | 563 | Open in IMG/M |
| 3300009522|Ga0116218_1495666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300009525|Ga0116220_10001328 | All Organisms → cellular organisms → Bacteria | 9821 | Open in IMG/M |
| 3300009637|Ga0116118_1199007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009839|Ga0116223_10619880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300010159|Ga0099796_10143833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300010379|Ga0136449_102223650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300011120|Ga0150983_13906323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300011271|Ga0137393_10402408 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300011271|Ga0137393_10909307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300011271|Ga0137393_11361708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300011271|Ga0137393_11727334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012189|Ga0137388_10506254 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300012189|Ga0137388_11143450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300012189|Ga0137388_11898174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300012202|Ga0137363_10950963 | Not Available | 729 | Open in IMG/M |
| 3300012203|Ga0137399_10563109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300012205|Ga0137362_10302908 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300012356|Ga0137371_10185803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae | 1628 | Open in IMG/M |
| 3300012357|Ga0137384_10388348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300012359|Ga0137385_10175264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
| 3300012361|Ga0137360_10080953 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300012361|Ga0137360_10108707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2136 | Open in IMG/M |
| 3300012363|Ga0137390_11266155 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012582|Ga0137358_10674756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300012582|Ga0137358_10944696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012917|Ga0137395_10160184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1546 | Open in IMG/M |
| 3300012923|Ga0137359_10214748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300012944|Ga0137410_11963721 | Not Available | 519 | Open in IMG/M |
| 3300012976|Ga0134076_10165772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300013306|Ga0163162_11343567 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300014169|Ga0181531_10161946 | Not Available | 1355 | Open in IMG/M |
| 3300014200|Ga0181526_10325199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300014654|Ga0181525_10225664 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300015054|Ga0137420_1174416 | Not Available | 1262 | Open in IMG/M |
| 3300015241|Ga0137418_10085644 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300015241|Ga0137418_10638875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300015245|Ga0137409_10657839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300015245|Ga0137409_11501012 | Not Available | 522 | Open in IMG/M |
| 3300015264|Ga0137403_10473756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300017933|Ga0187801_10340007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300017943|Ga0187819_10270907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300017955|Ga0187817_10713063 | Not Available | 640 | Open in IMG/M |
| 3300017959|Ga0187779_11236619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300017995|Ga0187816_10006866 | All Organisms → cellular organisms → Bacteria | 4053 | Open in IMG/M |
| 3300018008|Ga0187888_1329173 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300018009|Ga0187884_10337929 | Not Available | 607 | Open in IMG/M |
| 3300018030|Ga0187869_10584827 | Not Available | 529 | Open in IMG/M |
| 3300018042|Ga0187871_10319304 | Not Available | 859 | Open in IMG/M |
| 3300018047|Ga0187859_10190478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300018047|Ga0187859_10759910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300020140|Ga0179590_1171881 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300020579|Ga0210407_10501264 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300020579|Ga0210407_11190674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300020579|Ga0210407_11259110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300020580|Ga0210403_10894568 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300020580|Ga0210403_11120332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300020582|Ga0210395_10472514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300021046|Ga0215015_10501813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300021170|Ga0210400_10062505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2904 | Open in IMG/M |
| 3300021402|Ga0210385_10864266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300021405|Ga0210387_11746496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021407|Ga0210383_11281681 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300021420|Ga0210394_10496114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300021420|Ga0210394_11268359 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021420|Ga0210394_11341675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300021433|Ga0210391_11299387 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 561 | Open in IMG/M |
| 3300021433|Ga0210391_11560385 | Not Available | 505 | Open in IMG/M |
| 3300021477|Ga0210398_10496292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300021478|Ga0210402_11078368 | Not Available | 730 | Open in IMG/M |
| 3300021478|Ga0210402_11423834 | Not Available | 620 | Open in IMG/M |
| 3300021479|Ga0210410_10142773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2131 | Open in IMG/M |
| 3300021479|Ga0210410_10522969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1058 | Open in IMG/M |
| 3300021559|Ga0210409_10244380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300021559|Ga0210409_11299804 | Not Available | 603 | Open in IMG/M |
| 3300021559|Ga0210409_11590107 | Not Available | 530 | Open in IMG/M |
| 3300022724|Ga0242665_10149402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300025320|Ga0209171_10313024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300025414|Ga0208935_1051187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300025576|Ga0208820_1038171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1418 | Open in IMG/M |
| 3300025916|Ga0207663_11545351 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025924|Ga0207694_11328785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300025929|Ga0207664_10371968 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300025929|Ga0207664_10676244 | Not Available | 928 | Open in IMG/M |
| 3300025939|Ga0207665_10450680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 987 | Open in IMG/M |
| 3300026334|Ga0209377_1319830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300026529|Ga0209806_1233888 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026557|Ga0179587_10090172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300026557|Ga0179587_10451046 | Not Available | 841 | Open in IMG/M |
| 3300026557|Ga0179587_10690552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300027029|Ga0208731_1012078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 894 | Open in IMG/M |
| 3300027505|Ga0209218_1072297 | Not Available | 709 | Open in IMG/M |
| 3300027548|Ga0209523_1068035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300027570|Ga0208043_1032889 | Not Available | 1590 | Open in IMG/M |
| 3300027605|Ga0209329_1096779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. BCC1644 | 645 | Open in IMG/M |
| 3300027609|Ga0209221_1084249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 826 | Open in IMG/M |
| 3300027625|Ga0208044_1073794 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027795|Ga0209139_10226901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300027854|Ga0209517_10423487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027855|Ga0209693_10208113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300027855|Ga0209693_10488204 | Not Available | 590 | Open in IMG/M |
| 3300027867|Ga0209167_10782887 | Not Available | 520 | Open in IMG/M |
| 3300027889|Ga0209380_10431182 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027895|Ga0209624_10115418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1760 | Open in IMG/M |
| 3300027895|Ga0209624_10568177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300027903|Ga0209488_10137963 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300027903|Ga0209488_10248044 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300027905|Ga0209415_10218468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1768 | Open in IMG/M |
| 3300027905|Ga0209415_11041350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300028020|Ga0265351_1009234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300028748|Ga0302156_10173211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300028788|Ga0302189_10389669 | Not Available | 548 | Open in IMG/M |
| 3300028806|Ga0302221_10322468 | Not Available | 673 | Open in IMG/M |
| 3300028863|Ga0302218_10040190 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300028873|Ga0302197_10247208 | Not Available | 817 | Open in IMG/M |
| 3300028906|Ga0308309_10068028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2643 | Open in IMG/M |
| 3300028906|Ga0308309_11334341 | Not Available | 616 | Open in IMG/M |
| 3300029889|Ga0246001_1087895 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300029944|Ga0311352_11106503 | Not Available | 605 | Open in IMG/M |
| 3300030054|Ga0302182_10129179 | Not Available | 1100 | Open in IMG/M |
| 3300030058|Ga0302179_10264213 | Not Available | 759 | Open in IMG/M |
| 3300030580|Ga0311355_10955675 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300030617|Ga0311356_10953619 | Not Available | 804 | Open in IMG/M |
| 3300030659|Ga0316363_10198182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300030879|Ga0265765_1016709 | Not Available | 861 | Open in IMG/M |
| 3300031708|Ga0310686_102026792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031715|Ga0307476_10360859 | Not Available | 1070 | Open in IMG/M |
| 3300031715|Ga0307476_11279037 | Not Available | 536 | Open in IMG/M |
| 3300031754|Ga0307475_11022208 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031962|Ga0307479_10562371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300032180|Ga0307471_100142103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2289 | Open in IMG/M |
| 3300032205|Ga0307472_100788565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300032515|Ga0348332_13198460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300033158|Ga0335077_11268676 | Not Available | 717 | Open in IMG/M |
| 3300033561|Ga0371490_1124127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300034091|Ga0326724_0098118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.19% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100020451 | 3300000567 | Peatlands Soil | MHTTILAAFFAFSRTVPSMCSAGILLFLIALWAAKTDIARARG |
| Ga0062387_1012220222 | 3300004091 | Bog Forest Soil | MHPTILTAFFELSPIPVSMCAAGILLFLIALWAAKADLAQARGLDK |
| Ga0062389_1033068972 | 3300004092 | Bog Forest Soil | MNTTILATFFEISRTAVSMCGAGVVLLVVAAWAAKTDVARASGLDKIV |
| Ga0062386_1013025393 | 3300004152 | Bog Forest Soil | MHTTILAAFFEISRTVVSMCTAGILLFLIALWAAKAGIARARGLDKIV |
| Ga0062388_1002028421 | 3300004635 | Bog Forest Soil | MHATILATFFEISPAAVSMCCAGILLFLVALWAAKTDIAR |
| Ga0068869_1013912151 | 3300005334 | Miscanthus Rhizosphere | MHITILAAFFEISPTVVSMCSAGILLFLVALWAAKTDITRTHG |
| Ga0070713_1002645881 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTTILAVFLETSRTPVSMCSAGILIFLIALWAAKTDIAR |
| Ga0070711_1002651761 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLTASSTVVAMCSAGILAFLVALWAAKTDITRTHGLDKIVAL |
| Ga0070681_109770811 | 3300005458 | Corn Rhizosphere | MHTNIPAAFLESRTPVSMCSAAIVTLLIALWAAKADIARARGLE |
| Ga0070698_1007776972 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAVHMQLTILATFFEISRTVLSMCGAGILIFFVALWAARDDIAQAHGL |
| Ga0070730_109508212 | 3300005537 | Surface Soil | MHTTTLAAFFEFSPTVPSMCTAGILLPLIALWAAKADIAQARGLD |
| Ga0066704_104553621 | 3300005557 | Soil | MHTIILAALLEFSRTPVSMCTAGILLFLIALWAAKADIAGARGLDKIV |
| Ga0066705_108785192 | 3300005569 | Soil | VPQIEHASFLVIHMHTTILAIFLEISRTAVSMCSAGILLFFVALWAAKTDIARA |
| Ga0070762_103107281 | 3300005602 | Soil | VHLDILATFVPISRTVISMCGAGILLLLIASWAARTDIAQA |
| Ga0070762_111923081 | 3300005602 | Soil | MLAAHMQLTILVTFFGISHTVVSMCGAGILIFFVALWAARDDI |
| Ga0070763_106078631 | 3300005610 | Soil | MHTTILVTFFEISRTAVSMCAAGILLFLVALWAAKTD |
| Ga0070764_104349041 | 3300005712 | Soil | MHPTNLATFLEISRTVVSMCSAGILLFLVALWAGKNDVAQARGLNKV |
| Ga0068863_10000932720 | 3300005841 | Switchgrass Rhizosphere | MIRRFIKLGIHMHTNIPAAFLESRTPVSMCSAAIVTLLIALWAAKAD |
| Ga0075023_1006017171 | 3300006041 | Watersheds | MHITILATVFEFSRTAVSMSSAGILLFLIALWAAKTDIARAGGLDKIV |
| Ga0075028_1004758551 | 3300006050 | Watersheds | MHTTILASFSEISRTTVSMCSAGILLFLVALWAAKTEFA |
| Ga0075017_1009641382 | 3300006059 | Watersheds | MHTTILAAFFETSRTVVSMCGAAILLFLIALWSAKTDVAR |
| Ga0075017_1015128752 | 3300006059 | Watersheds | MRGIQIHTTILATFLEISRTAVSMCSAGILLFLVALWAAK |
| Ga0075019_105636611 | 3300006086 | Watersheds | MHILILAGFLEFSRTVVSMCGAGILLFVIALWASKADIARARGLDKIV |
| Ga0075015_1002494502 | 3300006102 | Watersheds | MHIAILATFLEISRTVVSMSSAGILLFLIALWAAKADLARAGGLDK |
| Ga0075030_1010393152 | 3300006162 | Watersheds | MYTTILDTFLEISRTVVSMCCAGILLFLVALWAAKTD |
| Ga0075018_100559971 | 3300006172 | Watersheds | MMHTTILATFFEISRTAVSMGSAGILLFLVALWAAKTEFARASGLDK |
| Ga0070765_1002171883 | 3300006176 | Soil | MHPTILALFLEFSRTAASMSVAAILLFLIALWAAKTEIARASG |
| Ga0073928_100347776 | 3300006893 | Iron-Sulfur Acid Spring | MHTTILATFFEISRTAVSMCSAGILLFFVALWAAKTDL |
| Ga0073928_112315441 | 3300006893 | Iron-Sulfur Acid Spring | MHTTILATFFEISRTAVAMCSAGILLFFVALWAAKTDLTRTSGLD |
| Ga0079219_112241391 | 3300006954 | Agricultural Soil | MHLHMRATILVAFFEISRTAISMCIAGLALFLLALWFARTEIARAA |
| Ga0099792_100558851 | 3300009143 | Vadose Zone Soil | MPGIHMHTTILATFLEISRPAVSMCGAGIVLFLVALWAAKSDIARARG |
| Ga0099792_102051172 | 3300009143 | Vadose Zone Soil | MHTTILATFFEISGPAVSMCGAGIVLFLVALWAAKSDIAGARGLDKI |
| Ga0116222_14488791 | 3300009521 | Peatlands Soil | MHPSILIAFFEFSPIPVSMCVAGILVPLIALWAVKSDIAQARGL |
| Ga0116218_14956662 | 3300009522 | Peatlands Soil | MHATILATLFEVSRTVVSMCTAVLLLFLIALWAAKTDIARARGLDKIVA |
| Ga0116220_100013281 | 3300009525 | Peatlands Soil | MHTTILAAFFEISRTVVSMCSAGILLFLVALWAAKTDIARA |
| Ga0116118_11990071 | 3300009637 | Peatland | MHTIIFAAFLEISRTAVSMCSAGILLFLVALWAAKTDIPRA |
| Ga0116223_106198801 | 3300009839 | Peatlands Soil | MHTTILAAFFEISRTVVSMCSAGILLFLVALWAAKSDIARA |
| Ga0099796_101438333 | 3300010159 | Vadose Zone Soil | MHTTILATFLEISRPAVSMCGAGIVLFLVALWAAKSDI |
| Ga0136449_1022236501 | 3300010379 | Peatlands Soil | MHTTILAAFFEISRTVVSMCSAGILLFLVALWAAKTDIARARGLDKIVAL |
| Ga0150983_139063231 | 3300011120 | Forest Soil | MHSTIVAAFLAISRTVVSMCGAGILLFLIASWAAKTD |
| Ga0137393_104024081 | 3300011271 | Vadose Zone Soil | MHTTILATFFEISRTAVSTWSAGILLFLVALWAAKSDIAGARGLDKI |
| Ga0137393_109093071 | 3300011271 | Vadose Zone Soil | MHTTILATFFEISRTVVSMCSAGILLFLVALWAAKTDIARA |
| Ga0137393_113617082 | 3300011271 | Vadose Zone Soil | MHTTILATFFQISRTVVSMCGAGILLFLVRLWTAKTDIAR |
| Ga0137393_117273341 | 3300011271 | Vadose Zone Soil | MHTIILATFFEISRPAVSMCGAGIVLFLVALWAAKSDIAGARGLDKI |
| Ga0137388_105062541 | 3300012189 | Vadose Zone Soil | MHTTILATFFEISRTAVSTWSAGILLFLVALWAAKSDIA |
| Ga0137388_111434501 | 3300012189 | Vadose Zone Soil | MHTTILATFFEISRTAVSMCSAGIVLFLVALWAAKTDIARAGGLDKI |
| Ga0137388_118981741 | 3300012189 | Vadose Zone Soil | MHTTILATFFEISRTAVSMCSAGILLFVVALWAAKSDIAGASGL |
| Ga0137363_109509631 | 3300012202 | Vadose Zone Soil | MHTTLLAAFFALHRTPLSMCSAGILVFLIALWAAK |
| Ga0137399_105631091 | 3300012203 | Vadose Zone Soil | MHTTILAVFLEISRTAVSMCGAGILLFLVALWAAKADIARAGGL |
| Ga0137362_103029082 | 3300012205 | Vadose Zone Soil | MHTTLLATFFEISRTVVSMCGGGILLFLVALWAAKTDIARA |
| Ga0137371_101858031 | 3300012356 | Vadose Zone Soil | MHTTILGTFLEFPRTAVSMCSAGILIFLIGLWAAKTDIAQACGLDK |
| Ga0137384_103883482 | 3300012357 | Vadose Zone Soil | MHTTILATFFEISRPVISMCGAGILLFLVALWTAKADIA |
| Ga0137385_101752641 | 3300012359 | Vadose Zone Soil | MHTTILATFFEISRTVVSMCSAGILLFLVALWAAKTDMARAGGLGK |
| Ga0137360_100809535 | 3300012361 | Vadose Zone Soil | MPGLHMHTTILATFFEISRTAVSMCGAGILIFLVALWAAKSDIARASGL |
| Ga0137360_101087073 | 3300012361 | Vadose Zone Soil | MHTTILATFFEISRTVVSTCSAGIVLFLVALWAAKTDIARAGGLD |
| Ga0137390_112661551 | 3300012363 | Vadose Zone Soil | MHTTILATFFPVSRTVVSMCGAGILLFLVALWAAKTDIARAGGLDKIVAL |
| Ga0137358_106747561 | 3300012582 | Vadose Zone Soil | MHTTILATFLEISRTVVSMCSAGILLFLAALWAAKAD |
| Ga0137358_109446961 | 3300012582 | Vadose Zone Soil | MHTTILVAFSEISRSAVSMCTAGILLFLVALWAAKTDFARARGLDKI |
| Ga0137395_101601844 | 3300012917 | Vadose Zone Soil | MHTIILATFFEISRPAVSMCGAGIVLFLVALWAAKSDIAGA |
| Ga0137359_102147483 | 3300012923 | Vadose Zone Soil | MHTTILATFFEISRTVVSMCSAGILLFLVALWAAKTDIARAGGLDKI |
| Ga0137410_119637211 | 3300012944 | Vadose Zone Soil | MHTTILAAFLEFSRTALSMCSTGILLFLIALWAAKADIA |
| Ga0134076_101657722 | 3300012976 | Grasslands Soil | MHTTILGTFFEISRTVLSMCSAGIVLFLVALWAAKTDIARAGGRVPQ |
| Ga0163162_113435671 | 3300013306 | Switchgrass Rhizosphere | MHTNIPAAFLESRTPVSMCSAAIVTLLIALWAAKADI |
| Ga0181531_101619462 | 3300014169 | Bog | MHPISLALFLEFSRTAASMSVAAILLFPIALWAAKTDIARAS |
| Ga0181526_103251991 | 3300014200 | Bog | MHPAILLAFLEFSRTAVSMSAAAILLFPVALLAARADIAEARGL |
| Ga0181525_102256642 | 3300014654 | Bog | MHTTILATFLETSRPAVSMCGAGILLFLIALWAAKSDIAPARGLDKIVA |
| Ga0137420_11744162 | 3300015054 | Vadose Zone Soil | MHTTILAAFLEISRTVVSLCSAGILLFLVALWAAKA |
| Ga0137418_100856441 | 3300015241 | Vadose Zone Soil | MHTTILATFFEISPPAVSMCGAGIVLFLVALWAAKSDIAGARGLDK |
| Ga0137418_106388751 | 3300015241 | Vadose Zone Soil | MHTTILATFLEISRTVVSMCSAGILLFLVALWAAKSDISRAAGLDKIVALS |
| Ga0137409_106578392 | 3300015245 | Vadose Zone Soil | MPGIHMYTSMLAIFLEISRTVVSTCSAGILLFLVALW |
| Ga0137409_115010121 | 3300015245 | Vadose Zone Soil | MHTTILAAFLEFSRTALSMCSTGILLFLIALWAAKADIAR |
| Ga0137403_104737563 | 3300015264 | Vadose Zone Soil | MHTTILATFLEISRTAVSMCTAGVLLGLVALWAAKTDVAR |
| Ga0187801_103400072 | 3300017933 | Freshwater Sediment | MQTTILAAFVGFSRTVVSMCSAGVLIFLVALWAAKTDIE |
| Ga0187819_102709071 | 3300017943 | Freshwater Sediment | MHTTILAAFFEISRTVVLMCSAGILLFLVALWAAKTDIARAG |
| Ga0187817_107130633 | 3300017955 | Freshwater Sediment | MHTIILATFFGISRTVVSMCGAGIVLFLVALWAAKTELVRA |
| Ga0187779_112366192 | 3300017959 | Tropical Peatland | MHTTIFAVFLEISRTVVSMCTAGILLFLIGLLAARTDIVRAR |
| Ga0187816_100068665 | 3300017995 | Freshwater Sediment | MHTTILAAFFEFSRVPLSMCTAGILVFLIALWAAKTDIAQAPGL |
| Ga0187888_13291732 | 3300018008 | Peatland | MLGIHMHTTIFAAFLEISRTAVSMCSAGILLFLVALWAAKTD |
| Ga0187884_103379292 | 3300018009 | Peatland | MHPAILLAFLEFSRTAVSMSAAAILLFPVALLAARADIAEASRLDKFV |
| Ga0187869_105848272 | 3300018030 | Peatland | MHMIILATFLGTSRTAVSMCGAGLLLLFIALWAARTDIA |
| Ga0187871_103193042 | 3300018042 | Peatland | MHIIILATFLGTSRTPVSMCGAGLLLLFIALWAARTDIAQA |
| Ga0187859_101904781 | 3300018047 | Peatland | MHPTILAIFFEFSRTAASMCAAAILLFLIALWAAKTDLARARGLDKIV |
| Ga0187859_107599101 | 3300018047 | Peatland | MHLPILLAFFEFSRTVVSMCTAGILLFLIALWAARTDLAQA |
| Ga0179590_11718812 | 3300020140 | Vadose Zone Soil | MSGIHMHTTLLATFFEISRPAVSMCSAGVLLFLVALWASKTDIARAGGL |
| Ga0210407_105012643 | 3300020579 | Soil | MHQIMHATILHATILAAFLVFSRTPVSMCSAAILLFLIALWAAKTD |
| Ga0210407_111906741 | 3300020579 | Soil | MLGIHMHTTILATFFEISRTAISMCSAGILLFLVALWAAKTD |
| Ga0210407_112591102 | 3300020579 | Soil | MQTTILAAFFEFPRTAVSMCSAGILLFLIALWAAK |
| Ga0210403_108945681 | 3300020580 | Soil | MLAVHMQLTILATFFEISHTVLSMCGAGILIFFVALWAARDD |
| Ga0210403_111203321 | 3300020580 | Soil | MHTTILATFLEISRTAVAMCSAGILLFLVALWAAKSDIARASCLDKI |
| Ga0210395_104725141 | 3300020582 | Soil | MHTTILALFLGVSRTVVSMCSAGILIILIAVWAAKTDVARA |
| Ga0215015_105018132 | 3300021046 | Soil | MHTTILAIFFEISRTVVSTCSAGILLFLIALWAAKTDIARAGGLD |
| Ga0210400_100625052 | 3300021170 | Soil | MHSTTLLAFFEFSRTAVSMSGAAILLFLIALWAAKTDIAQARGLDK |
| Ga0210385_108642661 | 3300021402 | Soil | MHTTILATFFEISRTAVSMCSAGILLFLVALWAAKSDIARA |
| Ga0210387_117464962 | 3300021405 | Soil | MHTTILATFFEISRTAVSMCIAGILIFFVALWVAKTDLARTGGLDK |
| Ga0210383_112816811 | 3300021407 | Soil | MLGIQIHMHTTILAAFVVISRTVVSMCAAGIVLFLVAVWAAKNDIARA |
| Ga0210394_104961142 | 3300021420 | Soil | MQTTILIAFLEISHTVVSMCCAGVLLFLVALWAAKTDIARSRGLD |
| Ga0210394_112683592 | 3300021420 | Soil | MHTTILATFFEILRPVVLMCSAGILLLLVALWAAKTDIARAGG |
| Ga0210394_113416751 | 3300021420 | Soil | MRTAVLMHITILATFLEISRTAVSMCGAGILLFLVALWAA |
| Ga0210391_112993872 | 3300021433 | Soil | MLAVHMQLTLLATFFETSPTVLSMCGAGILIFFVALWA |
| Ga0210391_115603851 | 3300021433 | Soil | VHLVILATFLGISGTVVSMCGAGIGLFLIAFWAAKTD |
| Ga0210398_104962923 | 3300021477 | Soil | MHITLATFFGIDRTVVSMCGAGIIVFVIALWAARTDIAQA |
| Ga0210402_110783681 | 3300021478 | Soil | MHTTILAAFLQISRTVVSMCSAGILLIMVALWAAKIDIARARGLDKIV |
| Ga0210402_114238342 | 3300021478 | Soil | MNTTVLATFFEISRTAVSMCGAGIVLLVIAAWAAKTDIAR |
| Ga0210410_101427735 | 3300021479 | Soil | MHTAFLATLFEISRTVVSMCSAGILLFLVALWAAKTDIARAHGLDKIVAL |
| Ga0210410_105229691 | 3300021479 | Soil | MHATILATFFEISRTAISMSGAGILLFLVALWAAKTDIARAGGLDK |
| Ga0210409_102443803 | 3300021559 | Soil | MLAVHMQLTILATFFEISRTVLAMCGAGILIFFVALWAARDDIAQA |
| Ga0210409_112998041 | 3300021559 | Soil | MHSIIPAFFEISRTVVSMCSAGVALFLIALLVAKTDFVQ |
| Ga0210409_115901073 | 3300021559 | Soil | MHTTILATFLEISRTAVSMCSAGILLFVVALWAAKSEI |
| Ga0242665_101494021 | 3300022724 | Soil | MHTTILAAFLEFSRAPVSMCIAAILVFMIALWAAKADIAGARGLDKI |
| Ga0209171_103130243 | 3300025320 | Iron-Sulfur Acid Spring | MHTTILATFFEISRTAVSMCSAGILLFFVALWAAKTDLARTG |
| Ga0208935_10511872 | 3300025414 | Peatland | MHPTILAIFFEFSRTAASMCAAAILLFLIALWAAK |
| Ga0208820_10381711 | 3300025576 | Peatland | MHTTIFAAFLEISRTAVSMCSAGILLFLVALWAAKTD |
| Ga0207663_115453511 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTTILAALLEISRTPVSMCSAGVLIFLIALWVAKADVARGRGLDKTV |
| Ga0207694_113287851 | 3300025924 | Corn Rhizosphere | MHTTILATFVEISRTAVSMCSAGILLFLIALWAAKSDIARA |
| Ga0207664_103719683 | 3300025929 | Agricultural Soil | MHQTILLAFFEVSRTAVSMCSAGVILFLVGILAAKNDIAQAH |
| Ga0207664_106762442 | 3300025929 | Agricultural Soil | MHTTILVTFFEFSRTAISMCSAGILLFLIALWAAKSDIAR |
| Ga0207665_104506802 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTAILAVFLEISRTAVSMCSAGILLFLVALWAAKADIARAGGL |
| Ga0209377_13198301 | 3300026334 | Soil | MHTTLLVAFLEFSRTPVSMCTAGILLFLIALWAAKA |
| Ga0209806_12338881 | 3300026529 | Soil | MHTTILATFFEISRTAASMCSAGILLFLVALWAAKTDIAR |
| Ga0179587_100901723 | 3300026557 | Vadose Zone Soil | MHTNILATFVEISRPAVSMCGAGIVLFLVALWAAKSDIAGARG |
| Ga0179587_104510461 | 3300026557 | Vadose Zone Soil | MHTTILATFFEISPPAVSMCGAGIVLFLVALWAAKS |
| Ga0179587_106905521 | 3300026557 | Vadose Zone Soil | MLAIHMHTTILAAFFEISRTVVSMCSAGILVFFVALWA |
| Ga0208731_10120783 | 3300027029 | Forest Soil | MHSLILGTFLEISSAVLSMCSAAILLSLVALWASKTDIARA |
| Ga0209218_10722972 | 3300027505 | Forest Soil | MLATHMQTIILVAYFEISRTVVSMCGAGIVLLLVAL |
| Ga0209523_10680353 | 3300027548 | Forest Soil | MHTTILATFFEISRTAVSMCTAGILLFLIALWAAKTDIARA |
| Ga0208043_10328893 | 3300027570 | Peatlands Soil | MHTTILATFLEISRTVVSMCSAGILLFLVALLAAKTDIAR |
| Ga0209329_10967791 | 3300027605 | Forest Soil | MLAVHMQLTILATFFGISRTVVSMCGAGILIFFVALWAARNDIA |
| Ga0209221_10842491 | 3300027609 | Forest Soil | MHPTILALFLEFSRTAASMSVAAILLFLIALWAAKTDIAR |
| Ga0208044_10737941 | 3300027625 | Peatlands Soil | MHFTMFLVFFEFSRTAASMSSAGILLFLIALWAAKTDIARASGLDKV |
| Ga0209139_102269011 | 3300027795 | Bog Forest Soil | MNTTILATFFEISRTAVSMCGAGVVLLVVAAWAAKTDVARASGL |
| Ga0209517_104234872 | 3300027854 | Peatlands Soil | MYATILAAFLEISRTVVSMCSAGILLFLVALWAAKTDVAR |
| Ga0209693_102081132 | 3300027855 | Soil | MILATFLEVSRTVVSMSGAAIVLFLVALWASRTDI |
| Ga0209693_104882041 | 3300027855 | Soil | MPGIHMHTMILAAFLEISRTVVSMCSASILLFIIALLAAR |
| Ga0209167_107828871 | 3300027867 | Surface Soil | MQTIILATLWGIDRTAVAMCGAGIVVFFIALWAAKNDIAQA |
| Ga0209380_104311821 | 3300027889 | Soil | MLAVHMQLTILATFFEISRTVISMGTAGILIFFVALWAARDDIAQARG |
| Ga0209624_101154184 | 3300027895 | Forest Soil | LESPLLLGIHMHSTILAAFLAISRTVVSMCGAGILLFLIASWAA |
| Ga0209624_105681772 | 3300027895 | Forest Soil | MHTTILATFLEISRTVVSMCSAGVLLFLVALWAAKTD |
| Ga0209488_101379631 | 3300027903 | Vadose Zone Soil | MHTTILATFLEISRPAVSMCGAGIVLSLVALWAAK |
| Ga0209488_102480441 | 3300027903 | Vadose Zone Soil | MHTTILAAFVEFSRTALSMCSAGILLLLIALWAARA |
| Ga0209415_102184682 | 3300027905 | Peatlands Soil | MHTTILAAFFEISHTVVSMCSAGILLFLVALWAAKTDIA |
| Ga0209415_110413502 | 3300027905 | Peatlands Soil | MHTTILAAFLEISRTVVSMCSAGILLFLVALWAAKTDIA |
| Ga0265351_10092343 | 3300028020 | Soil | MHTTILAAFFEISRTAVSMCSTGILLFLIATWAAKADIARDRGLDKV |
| Ga0302156_101732111 | 3300028748 | Bog | MHTTILAAFLEISRTVVSMCGAGILLFLVALWAAK |
| Ga0302189_103896691 | 3300028788 | Bog | MRTMSLATFLEFQRTPVSMCVAGVLLFFIALWADRAD |
| Ga0302221_103224682 | 3300028806 | Palsa | MHATILATFFGISRTVVSMCAAGILVFLIALWAAKTDIARAS |
| Ga0302218_100401903 | 3300028863 | Palsa | MHTTILATFLETSRPAVSMCGAGILLFLIALWAAK |
| Ga0302197_102472081 | 3300028873 | Bog | MRTMSLATFLEFQRTPVSMCVAGVLLFFIALWADRADFAG |
| Ga0308309_100680283 | 3300028906 | Soil | MNTTVLATFFEISRTAVSMCGAGIVLLVIAAWAAKTDIARASGL |
| Ga0308309_113343412 | 3300028906 | Soil | MHATLLATFLEFSRTAVSMCVAGIFVFLVAAWASRTD |
| Ga0246001_10878952 | 3300029889 | Peat | MLGIHMHTTIFAAFLEISRTAVSMCSAGILLFLVALW |
| Ga0311352_111065031 | 3300029944 | Palsa | MHATILATFFGISRTVVSMCAAGILVFLIALWAAKTDIA |
| Ga0302182_101291791 | 3300030054 | Palsa | MHSTILATFLEISRTAVSMCSAGLLLFLIALWTAKTDI |
| Ga0302179_102642131 | 3300030058 | Palsa | MHTPILAAFLEISRTPVSMCSAGLLLFLIALWAAKT |
| Ga0311355_109556752 | 3300030580 | Palsa | MHTTILATFLETSRPAVSMCGAGILLFLIALWAAKSDIARAR |
| Ga0311356_109536192 | 3300030617 | Palsa | MHSTILATFLEISRTAVSMCSAGILLFLIALWTAKTDIARAGGL |
| Ga0316363_101981822 | 3300030659 | Peatlands Soil | MHTTILAAFFEISRTVVSMCSAGILLFLVALWAAKTD |
| Ga0265765_10167091 | 3300030879 | Soil | MHTTILATFLEISRTAVSMCSVGVLLFLVALWAAKADITRAGGLDK |
| Ga0310686_1020267922 | 3300031708 | Soil | MHFTILLAFFEFSRTVDSMCAAGILLFLIALWSARTD |
| Ga0307476_103608592 | 3300031715 | Hardwood Forest Soil | MHSTILATFLEISRTPVSMCAAGILLLLIGLWAAK |
| Ga0307476_112790371 | 3300031715 | Hardwood Forest Soil | MHTTILATFLEPSLAAVSMCIAGILLFPIGLWAAKADIAS |
| Ga0307475_110222081 | 3300031754 | Hardwood Forest Soil | MHTTILAAFFQISRTVSSMCGAGILLILIALWAAKTDIARAPGLEKIVA |
| Ga0307479_105623711 | 3300031962 | Hardwood Forest Soil | MQINILAAFFAISRTVVSMCSAGILLFLVALWAAKTDIAR |
| Ga0307471_1001421034 | 3300032180 | Hardwood Forest Soil | MHTTILATFFEISRTAISMCVAGILLFLVALWAAKTDIP |
| Ga0307472_1007885651 | 3300032205 | Hardwood Forest Soil | MHITILAAFLLMSRTVVSMCGAGILLFLVALWAAKTDIAR |
| Ga0348332_131984602 | 3300032515 | Plant Litter | MHTTILATFLEVSRTAVSMCTAGVLLFLVALWALKSDIA |
| Ga0335077_112686762 | 3300033158 | Soil | MQLTILAMLFEVSRTVVSMCGAGILVIFIALWAAKDDIARARGLDKVVA |
| Ga0371490_11241271 | 3300033561 | Peat Soil | MHTTILVTFLGIPGIVVSMCSAGILIFLIALWAAKTKIAQARGL |
| Ga0326724_0098118_3_116 | 3300034091 | Peat Soil | MHTTILVTFLGIPGIVVSMCSAGILIFLIALWAAKTKI |
| ⦗Top⦘ |