


| Basic Information | |
|---|---|
| Family ID | F037335 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LAIIAFGVGFTVHWLFIVAVVLALVWLISLFAGAAGGRSRGAWW |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 54.64 % |
| % of genes near scaffold ends (potentially truncated) | 27.38 % |
| % of genes from short scaffolds (< 2000 bps) | 49.40 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.786 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.381 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF01022 | HTH_5 | 5.36 |
| PF01939 | NucS | 4.76 |
| PF13279 | 4HBT_2 | 4.17 |
| PF13581 | HATPase_c_2 | 3.57 |
| PF08734 | GYD | 2.98 |
| PF02735 | Ku | 2.38 |
| PF13466 | STAS_2 | 1.79 |
| PF01740 | STAS | 1.79 |
| PF04073 | tRNA_edit | 1.79 |
| PF16317 | Glyco_hydro_99 | 1.79 |
| PF04228 | Zn_peptidase | 1.19 |
| PF06032 | DUF917 | 1.19 |
| PF00005 | ABC_tran | 1.19 |
| PF08031 | BBE | 1.19 |
| PF00675 | Peptidase_M16 | 1.19 |
| PF01699 | Na_Ca_ex | 1.19 |
| PF01380 | SIS | 1.19 |
| PF06826 | Asp-Al_Ex | 0.60 |
| PF11755 | DUF3311 | 0.60 |
| PF10417 | 1-cysPrx_C | 0.60 |
| PF00106 | adh_short | 0.60 |
| PF00912 | Transgly | 0.60 |
| PF00501 | AMP-binding | 0.60 |
| PF13561 | adh_short_C2 | 0.60 |
| PF00614 | PLDc | 0.60 |
| PF02878 | PGM_PMM_I | 0.60 |
| PF07498 | Rho_N | 0.60 |
| PF13350 | Y_phosphatase3 | 0.60 |
| PF00440 | TetR_N | 0.60 |
| PF00696 | AA_kinase | 0.60 |
| PF00903 | Glyoxalase | 0.60 |
| PF01451 | LMWPc | 0.60 |
| PF13180 | PDZ_2 | 0.60 |
| PF06071 | YchF-GTPase_C | 0.60 |
| PF02566 | OsmC | 0.60 |
| PF04389 | Peptidase_M28 | 0.60 |
| PF00160 | Pro_isomerase | 0.60 |
| PF00248 | Aldo_ket_red | 0.60 |
| PF00313 | CSD | 0.60 |
| PF01594 | AI-2E_transport | 0.60 |
| PF08241 | Methyltransf_11 | 0.60 |
| PF13539 | Peptidase_M15_4 | 0.60 |
| PF01266 | DAO | 0.60 |
| PF13231 | PMT_2 | 0.60 |
| PF02617 | ClpS | 0.60 |
| PF07690 | MFS_1 | 0.60 |
| PF01068 | DNA_ligase_A_M | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 4.76 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.98 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 2.38 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.19 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.19 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.19 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.19 |
| COG3535 | Uncharacterized conserved protein, DUF917 family | Function unknown [S] | 1.19 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.60 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.60 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 0.60 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.60 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.60 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.60 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.60 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.79 % |
| All Organisms | root | All Organisms | 48.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_10466909 | Not Available | 683 | Open in IMG/M |
| 3300000956|JGI10216J12902_100847945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300000956|JGI10216J12902_101580286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300002568|C688J35102_118292126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300003267|soilL1_10070416 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300003324|soilH2_10263466 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300003992|Ga0055470_10059319 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300004063|Ga0055483_10003401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4128 | Open in IMG/M |
| 3300004479|Ga0062595_100549829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 884 | Open in IMG/M |
| 3300004479|Ga0062595_101972047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300005171|Ga0066677_10007854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4478 | Open in IMG/M |
| 3300005178|Ga0066688_10370868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300005347|Ga0070668_100692618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300005367|Ga0070667_100010280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7734 | Open in IMG/M |
| 3300005434|Ga0070709_10270598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300005435|Ga0070714_100497161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300005436|Ga0070713_101003627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300005445|Ga0070708_101114568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300005529|Ga0070741_10006952 | All Organisms → cellular organisms → Bacteria | 23857 | Open in IMG/M |
| 3300005529|Ga0070741_10419319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300005530|Ga0070679_101996685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300005538|Ga0070731_10202518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1318 | Open in IMG/M |
| 3300005557|Ga0066704_10789641 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005561|Ga0066699_10743770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300005563|Ga0068855_102423574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300005569|Ga0066705_10835831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300005887|Ga0075292_1054345 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005891|Ga0075283_1012586 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005899|Ga0075271_10051275 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006041|Ga0075023_100207166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300006175|Ga0070712_100775456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300006796|Ga0066665_10530689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
| 3300006800|Ga0066660_10285746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300006800|Ga0066660_10305427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1272 | Open in IMG/M |
| 3300006914|Ga0075436_101301778 | Not Available | 550 | Open in IMG/M |
| 3300009093|Ga0105240_10228634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2163 | Open in IMG/M |
| 3300009137|Ga0066709_103430667 | Not Available | 575 | Open in IMG/M |
| 3300009156|Ga0111538_10003181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22997 | Open in IMG/M |
| 3300009162|Ga0075423_10417535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
| 3300010145|Ga0126321_1444111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300010152|Ga0126318_10529529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300010323|Ga0134086_10278632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012096|Ga0137389_10235002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1536 | Open in IMG/M |
| 3300012096|Ga0137389_10989611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300012096|Ga0137389_11604254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300012189|Ga0137388_10706287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300012198|Ga0137364_10140112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1740 | Open in IMG/M |
| 3300012199|Ga0137383_10136946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1790 | Open in IMG/M |
| 3300012200|Ga0137382_10304249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1113 | Open in IMG/M |
| 3300012201|Ga0137365_10237102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1359 | Open in IMG/M |
| 3300012204|Ga0137374_10911384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012206|Ga0137380_11618403 | Not Available | 532 | Open in IMG/M |
| 3300012207|Ga0137381_10355884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1276 | Open in IMG/M |
| 3300012210|Ga0137378_10623831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300012212|Ga0150985_111437465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1131 | Open in IMG/M |
| 3300012380|Ga0134047_1206928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 759 | Open in IMG/M |
| 3300012410|Ga0134060_1076289 | Not Available | 550 | Open in IMG/M |
| 3300012976|Ga0134076_10459918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300013772|Ga0120158_10020320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5477 | Open in IMG/M |
| 3300014838|Ga0182030_10772122 | Not Available | 885 | Open in IMG/M |
| 3300015053|Ga0137405_1303829 | Not Available | 1960 | Open in IMG/M |
| 3300015356|Ga0134073_10226441 | Not Available | 634 | Open in IMG/M |
| 3300017944|Ga0187786_10066355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1132 | Open in IMG/M |
| 3300017947|Ga0187785_10680395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300018476|Ga0190274_13688391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → unclassified Frankiales → Frankineae bacterium MT45 | 518 | Open in IMG/M |
| 3300019255|Ga0184643_1121541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300019279|Ga0184642_1707532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300020069|Ga0197907_10434666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
| 3300020070|Ga0206356_11767188 | Not Available | 506 | Open in IMG/M |
| 3300020075|Ga0206349_1394109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300020077|Ga0206351_10542814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300020078|Ga0206352_10484913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300021344|Ga0193719_10006428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4843 | Open in IMG/M |
| 3300021432|Ga0210384_11318201 | Not Available | 627 | Open in IMG/M |
| 3300022195|Ga0222625_1645424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300022467|Ga0224712_10096773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1245 | Open in IMG/M |
| 3300022467|Ga0224712_10136144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300025552|Ga0210142_1054256 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300025913|Ga0207695_10199923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1913 | Open in IMG/M |
| 3300025952|Ga0210077_1007143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 2615 | Open in IMG/M |
| 3300025986|Ga0207658_10006890 | All Organisms → cellular organisms → Bacteria | 7737 | Open in IMG/M |
| 3300025994|Ga0208142_1036414 | Not Available | 553 | Open in IMG/M |
| 3300026035|Ga0207703_10067163 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300026552|Ga0209577_10391976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1004 | Open in IMG/M |
| 3300028577|Ga0265318_10244340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300028884|Ga0307308_10538675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300030612|Ga0257196_1238491 | Not Available | 646 | Open in IMG/M |
| 3300030785|Ga0102757_10024401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300030907|Ga0074013_11370564 | Not Available | 628 | Open in IMG/M |
| 3300030907|Ga0074013_11671782 | Not Available | 643 | Open in IMG/M |
| 3300031058|Ga0308189_10384962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300031094|Ga0308199_1109793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300031544|Ga0318534_10326536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 884 | Open in IMG/M |
| 3300031751|Ga0318494_10423511 | Not Available | 773 | Open in IMG/M |
| 3300032829|Ga0335070_10069542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3788 | Open in IMG/M |
| 3300032892|Ga0335081_12129124 | Not Available | 593 | Open in IMG/M |
| 3300032893|Ga0335069_10095608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3764 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.38% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.19% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.19% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.19% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.60% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030612 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030907 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_10480600 | 2170459003 | Grass Soil | GFTVHWLFVVAVVLALVWLISLFAGGAGGRTRGSWW |
| JGI11643J12802_104669091 | 3300000890 | Soil | MLLLVLLALVTIVAFGVGFTAHWLFVVAVVLAVIWLISLLASGLGGRSRGAWW* |
| JGI10216J12902_1008479451 | 3300000956 | Soil | ALLAIIAFGFGFTIKWLFVVAVVLALVWLISLLAGGIGGRSRGAWW* |
| JGI10216J12902_1015802861 | 3300000956 | Soil | ALLAIIAFGFGFTIKWLFIVAVVLAVIWLISLLSGGVGGRSRGAWW* |
| JGI10216J12902_1068654083 | 3300000956 | Soil | IILFGVGFTVHWLFILAIIAALLFVISFFLSGAGGRSRRAWW* |
| C688J35102_1182921261 | 3300002568 | Soil | IVLALLAIILFGVGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW* |
| soilL1_100704162 | 3300003267 | Sugarcane Root And Bulk Soil | LVALLIILAVLSIVLFGIGFTVHWLFWVAAILALVFLIALFAGGIGGRRRAWW* |
| soilH2_102634662 | 3300003324 | Sugarcane Root And Bulk Soil | VVALLIILAVLSIVLFGIGFTVHWLFWVAAILALVFLIALFAGGIGGRRRAWW* |
| Ga0055470_100593193 | 3300003992 | Natural And Restored Wetlands | VVALLVILAVLSIVLFGIGFTVHWLFWVAAIAALIFLIALFAGGVGGRRRAWW* |
| Ga0055483_100034014 | 3300004063 | Natural And Restored Wetlands | MILLVVLALLAIVAFGVGFTVHWLFVVAVVCALIWLISFFLGGTRGRSRGAWW* |
| Ga0062595_1005498291 | 3300004479 | Soil | ILLALLAIILFGVGFTIHWLFIVAIIAALVFVISFFMGASGGRSRGAWW* |
| Ga0062595_1019720471 | 3300004479 | Soil | MLLLVLLALLAVIAFGVGFTIHWLFIFAVIAALLFVISFFAGGTRGRSRGAWW* |
| Ga0066677_100078548 | 3300005171 | Soil | AIILFGVGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW* |
| Ga0066688_103708683 | 3300005178 | Soil | MALLVLLAILAIIFFGVGFTVHWLFVIAVIAALLFVISLFMGGVRGRSRGAWW* |
| Ga0068868_1006698753 | 3300005338 | Miscanthus Rhizosphere | IILFGVGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW* |
| Ga0070668_1006926181 | 3300005347 | Switchgrass Rhizosphere | LLALLALLTIIAFGVGFTVHWLFVVAVVLAVIWLISLLASGIGGRSRGAWW* |
| Ga0070667_1000102808 | 3300005367 | Switchgrass Rhizosphere | MLLLVLLAILAIIAFGLGFTIHWLFVAAVVLALVWLISFFVGGIGGRRRAWW* |
| Ga0070709_102705982 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFLVLLALLAIIAFGVGFTVHWLFIIAVVLALVWVITLFAGRGRTRGTWW* |
| Ga0070714_1004971613 | 3300005435 | Agricultural Soil | MEVRGMLVLIVLALLALVFLGFGFTAHWLFVAAVIAALVFVISLFLGSAGGRTRGYWW* |
| Ga0070713_1010036272 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLIVLALLALVFLGFGFTAHWLFVAAVIAALVFVISLFLGSAGGRTRGYWW* |
| Ga0070708_1009417762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLILLALLAIIAFGVGFTVHWLFIVAVIAALIWLISFFVGGVR |
| Ga0070708_1011145682 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLAIVAFGVGFTIHWLFVVAVILALLWLISLFLGGIGGRARSSWW* |
| Ga0066687_103693322 | 3300005454 | Soil | AFGVGFTVHWLFIVAVVLALVWLISLFAGGAGGRTRGSWW* |
| Ga0070741_1000695224 | 3300005529 | Surface Soil | MFLLLLLALLAIVAFGVGFTVHWLFVLAVVAALLFVISFFLGATRGRSRGAWW* |
| Ga0070741_104193191 | 3300005529 | Surface Soil | MLLLVLLAILAIIAFGVGFTVHWLFIVAVVLALGWLISLFAGGAGGRTRGSWW* |
| Ga0070679_1019966852 | 3300005530 | Corn Rhizosphere | LLAILTIIAFGVGFTVHWLFIVAIVLAVIWLISLLAGGTGGRTRGAWW* |
| Ga0070731_102025182 | 3300005538 | Surface Soil | MLVLVLLALLAIVAFGVGFTVHWLFVIAVVAALLWVISLFLSGARGRRRGAWW* |
| Ga0066697_107390532 | 3300005540 | Soil | LAIIAFGVGFTVHWLFIVAVVLALVWLISLFAGAAGGRSRGAWW* |
| Ga0070732_103343251 | 3300005542 | Surface Soil | IIAFGVGFTLHWLFIVTAVLALIWVISFFAGGSSGRSRRAWW* |
| Ga0066701_103835962 | 3300005552 | Soil | IAFGLGFTLHWLFVIAAVFAVIWLIGLFAGAAGGRSRRAWW* |
| Ga0066661_104905201 | 3300005554 | Soil | ILFGVGFTIHWLFIVAVIAALLFVISFFMSGVGGRRRGAWW* |
| Ga0066704_107896412 | 3300005557 | Soil | MAMLVLLAILAVIFFGVGFTIHWLFVIAVIAALLFVISLFLGGVGGRSRGAWW* |
| Ga0066699_107437701 | 3300005561 | Soil | LLAILAIVAFGVGFTIHWLFVLAVIAALLFLISLFVGGMGGRTRRAWW* |
| Ga0068855_1024235741 | 3300005563 | Corn Rhizosphere | IREGVEMLLLVLLAILAIVAFGAAFTIHWLFVVAVVAALLRVISAFLGGVGGRRRGTLF* |
| Ga0066705_108358311 | 3300005569 | Soil | MLLLVLLALLAIIAFGAGFTVHWLFVIAVVIALVWVISLFAGGYGGRTRGYWW* |
| Ga0066903_1033744791 | 3300005764 | Tropical Forest Soil | VGFTVHWLFVVAVVLALVWLIALFAGGIGGRSRRAWW* |
| Ga0066903_1045532091 | 3300005764 | Tropical Forest Soil | GFTVHWLFIVAVVLALIWLISLFMGGVRGRTRGSWW* |
| Ga0066903_1079187712 | 3300005764 | Tropical Forest Soil | LAIIAFGVGFTVHWLFIVAVVLALVWLIGVFMGGIGGRSRGTWW* |
| Ga0066903_1079396723 | 3300005764 | Tropical Forest Soil | TIHWLFIVAAVLAVIWLITLFAGGVGPRAGTRRW* |
| Ga0068858_1001757791 | 3300005842 | Switchgrass Rhizosphere | FGLGFTIHWLFIAAVVLALVWLISFFVGGIGGRRRAWW* |
| Ga0075292_10543451 | 3300005887 | Rice Paddy Soil | VALLIILAVLSIVLFGIGFTVHWLFWVAAIVALVFLIALFAGGIGGRRRVW* |
| Ga0075283_10125864 | 3300005891 | Rice Paddy Soil | MVALLVILAVLSIVLFGIGFTVHWLFWVAAICALIFLIALFAGGVGGRRRAWW* |
| Ga0075271_100512752 | 3300005899 | Rice Paddy Soil | LIALAILAIIAFGVRFTIHWLFIVAAVVALVWLISLFAGGVGGRSRGAWW* |
| Ga0066696_102331411 | 3300006032 | Soil | GFTIHWLFIVAAVLALIWLISLFAGGVGGRRAWW* |
| Ga0066696_108759353 | 3300006032 | Soil | AFGVGFTIHWLFIVAIVLALIWLISLFVGGVGGRSRSAWW* |
| Ga0075023_1002071662 | 3300006041 | Watersheds | MLLIVLALLALIAFGVGFTVHWLFVVAVILALVWVISLFAGGLGGRTRGVWR* |
| Ga0070712_1007754561 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LLAIILFGVGFTIHWLFIVAIIAALVFVISFFMGASGGRSRGAWW* |
| Ga0066665_105306892 | 3300006796 | Soil | MLFLVTLALLAMVAFGVGFTVHWLFVLAVVFALVWLISFFAGSARGRRRGYWW* |
| Ga0066660_102857462 | 3300006800 | Soil | MVLLVLLAVLAIVAFGLGFTLHWLFIVAVVLAIVWLISVFAGGIGGRRRSAWW* |
| Ga0066660_103054274 | 3300006800 | Soil | ILAIVAFGVGFTIHWLFVLAVILALLFVISFFLGGLGGRSRRAWW* |
| Ga0066660_104787433 | 3300006800 | Soil | FTLYWLFIIAAVVALVWLISMFAGGVGGRRRAWW* |
| Ga0066660_110923561 | 3300006800 | Soil | GVGFTIHWLFVLAVIAALLFVISVFVGGMGGRTRRAWW* |
| Ga0079220_107328392 | 3300006806 | Agricultural Soil | GFTLHWLFIIAAVLAVIWLISLFAGAAGGRSRGAWW* |
| Ga0075424_1024909122 | 3300006904 | Populus Rhizosphere | VGFTVHWLFIVAVVLALVWLIAIFAGGVGGRSRGAWW* |
| Ga0075436_1008064381 | 3300006914 | Populus Rhizosphere | FTIHWLFIVAVVLALVWLISLFAGGVGGRSRGAWW* |
| Ga0075436_1013017782 | 3300006914 | Populus Rhizosphere | MLLLIVLALLALVFFGFGFTAHWLFVVAVIAALVFVISLFLGSAGGRARGYWW* |
| Ga0105240_102286342 | 3300009093 | Corn Rhizosphere | MLLLVLLAILAIVAFGAAFTIHWLLVVAVVAALLRVISAFLGGVGGRRRGTLF* |
| Ga0066709_1034306671 | 3300009137 | Grasslands Soil | MLLLVLLALLAVIAFGVGFTLHWLFVVAVIAALLFVIRFFAGGIRGR |
| Ga0099792_101575643 | 3300009143 | Vadose Zone Soil | GFTVHWLFIVAVVLALVWLISIFAGGAGGRSRGAWW* |
| Ga0111538_1000318115 | 3300009156 | Populus Rhizosphere | LLAILAIILFGVGFTVHWLFILAIVAALLFVISFFMGAAGGRSRGAWW* |
| Ga0075423_104175354 | 3300009162 | Populus Rhizosphere | MIFLVLLALLAVIAFGLGFTIKWLFIVAVILAAVWLITFLAGGIGGRSRGAWW* |
| Ga0105248_107510294 | 3300009177 | Switchgrass Rhizosphere | AIIAFGVGFTVHWLFIVAVIAALIWLISLFLGGARGRTR* |
| Ga0126321_14441111 | 3300010145 | Soil | MLLLVLLAILTAIAFGVGFTVHWLFVVAIILAVVWLISLLAGGIGGRSRGAWW* |
| Ga0126318_102063783 | 3300010152 | Soil | AYFTLYWLFIIAAVVALVWLISFFVGGAEGRRRAWW* |
| Ga0126318_105133792 | 3300010152 | Soil | AFGVGFTIHALFIVAVVLALVWLIALFAGGVGGRSRGAWW* |
| Ga0126318_105295291 | 3300010152 | Soil | LVLLALLAIIAFGVGFTIHWLFIVAVVLALVWVIAMFMGGIGGRRRTN* |
| Ga0126318_107652833 | 3300010152 | Soil | LAIAAFGVGFTIHWLFIVAAILALLWLISLFAGGIGGRSRRAWW* |
| Ga0134086_102786322 | 3300010323 | Grasslands Soil | MALLVLLAILAIIFFGVGFTVHWLFVIAVIAALFFVISLFMGAAGGRSRGAWW* |
| Ga0134062_101210114 | 3300010337 | Grasslands Soil | GVGFTVHWLFILAIIAALLFVISFFMGGVGGRSRGAWW* |
| Ga0134062_102547692 | 3300010337 | Grasslands Soil | FTVHWLFIVAVVLALVWLISLFAGAAGGRSRGAWW* |
| Ga0126378_116912942 | 3300010361 | Tropical Forest Soil | FGVGFTVHWLFIIAAVAALLWLIAVFTGGIGGRRRGSWY* |
| Ga0126379_124563122 | 3300010366 | Tropical Forest Soil | FGVGFTVHWLLIVAVVLALLWLISVFMGGVGGRSRGTWW* |
| Ga0136449_1017318853 | 3300010379 | Peatlands Soil | FTVHWLFGVAVVLALLWLISLLLGGVGGRSRGAWW* |
| Ga0137393_116520561 | 3300011271 | Vadose Zone Soil | IAAFSAGFVIHWLFVIAVVLALVWLISLFAGGIGGRSRRAWW* |
| Ga0137389_102350023 | 3300012096 | Vadose Zone Soil | VFLLVVLAVLAIVAFGVGFTLHSLFIVAAVLALVWLISLFTGAAGGR |
| Ga0137389_109896111 | 3300012096 | Vadose Zone Soil | VLLLAILALLAIVAFGVGFTIHWLFIVAIVLALLWVIGVFAGGLGGRSGSAWW* |
| Ga0137389_116042542 | 3300012096 | Vadose Zone Soil | MLFLVILALLAMVAFGVGFTGHWLFVLAVVFALVWLISFFAGSARGRRRGYWW* |
| Ga0137388_107062871 | 3300012189 | Vadose Zone Soil | LLAIIAFGVGFTVHWLFIVAIVLALVWLISLFAGGLGGRTRSTWW* |
| Ga0137364_101401124 | 3300012198 | Vadose Zone Soil | VLALLAIILFGVGFTIHWLFIVAIIAALLFVISLFVGGAGGRSRRAWW* |
| Ga0137383_101369463 | 3300012199 | Vadose Zone Soil | MLLLILLALLAIFAFGVGFTVHWLFVVAVIAGLLWLISLFVGGLGGRTRTTWW* |
| Ga0137382_103042494 | 3300012200 | Vadose Zone Soil | LALLAIILFGVGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW* |
| Ga0137365_102371022 | 3300012201 | Vadose Zone Soil | LLIVLALLAIVAFGVGFTIHWLFIVAVVLALLWVISFFTGRTGGRSRRAWR* |
| Ga0137374_109113842 | 3300012204 | Vadose Zone Soil | MLLLVLIALVAIIAFGVGFTIHWLFIVALVAALLWVISLFAGGLGGRTRHTWW* |
| Ga0137380_116184031 | 3300012206 | Vadose Zone Soil | ALLAIIAFGVGFTVHWLFVVAVVLALVWLISLFAGAAGGRSRGAWW* |
| Ga0137381_103558842 | 3300012207 | Vadose Zone Soil | MLLLVLLALLAIIAFGVGFTVHWLFVVAVVLALVWLISVFAGGIGGRS |
| Ga0137378_105496382 | 3300012210 | Vadose Zone Soil | TVHWLFVVAVVLALVWLISLFAGAAGGRSRGAWW* |
| Ga0137378_106238311 | 3300012210 | Vadose Zone Soil | VLLAILAIIAFGVGFTIHWLFIVAIILALVWLISLFAGGLGGRSRR |
| Ga0150985_1114374652 | 3300012212 | Avena Fatua Rhizosphere | GDHMLLLVLLAVLAIIAFGVGFTIHWLFIVAAVLAVIWLISLFAGGGFRGRGTY* |
| Ga0150985_1176387082 | 3300012212 | Avena Fatua Rhizosphere | LFGVGFTVHFLFVLAVVAALLFVIMFFMGAARGRSRGAWW* |
| Ga0134047_12069281 | 3300012380 | Grasslands Soil | RDTESAKAKRGGIMLLLILLAILAIAAFGVGFTVHWLFVIAVVAGLIWLISFFLGSSRGRSRGFWW* |
| Ga0134052_12751883 | 3300012393 | Grasslands Soil | IAFGLGFTIKWLFIVAVILAAIWLISLLAGGVGGRSRGAWW* |
| Ga0134057_10128012 | 3300012396 | Grasslands Soil | GVGFTVHWLFIVAIVLALVWLISLFAGGLGGRTRSTWW* |
| Ga0134060_10762891 | 3300012410 | Grasslands Soil | SDRKETGMILLVVLAILAIAAFGVGFTIHWLFIAAAVLALLWLLALFAGGVGGSRRAWW* |
| Ga0157293_103000712 | 3300012898 | Soil | FTIHWLFIVALVLALIWLISLLAGGVGGRGRGAWW* |
| Ga0164301_114568332 | 3300012960 | Soil | TVHWLFIVAVVLALVWLISLFAGGAGGRSRGAWW* |
| Ga0134076_104599181 | 3300012976 | Grasslands Soil | LALLAIVAFRVGFTIHWLFVVAIVLALVWLISLFAGGLGGRSRRAWW* |
| Ga0164308_115251052 | 3300012985 | Soil | LAIIAFGVGFTLHWLFIVAAVLALVWLISFFTGAGGRSRGAWW* |
| Ga0120158_100203207 | 3300013772 | Permafrost | VLAVLAIVAFGVGFTIHWLFIVAVVLALIWVISLLTGGIGGRRRAR* |
| Ga0120158_104048961 | 3300013772 | Permafrost | TIHWLFIVAVVLALLWLIRFFTGRAGGRGRRALR* |
| Ga0182030_107721221 | 3300014838 | Bog | MFLLIVLALLAVVAFGVAFTIHWLFIFAAILALIWVRSIFAGGIGGRTRST |
| Ga0137405_13038294 | 3300015053 | Vadose Zone Soil | MLLLVLLAVLAVIAFGLGFTLHWLFVVAAVLAVIWLIGLFAGAAGGRTRRAWW* |
| Ga0134073_102264411 | 3300015356 | Grasslands Soil | LALLAIILFGVGFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW* |
| Ga0134069_13037752 | 3300017654 | Grasslands Soil | LFGVGFTVHWLFIVAVVAALLFLISWFMGAAGGRSRGAWW |
| Ga0187786_100663553 | 3300017944 | Tropical Peatland | MLWLILIGLLAIIAFGVGFTIHWLFIVAVVLALIWVIALFAGGLSSRSSRL |
| Ga0187785_100302156 | 3300017947 | Tropical Peatland | FGVGFTIHWLFIVAVVLALIWVIALFAGGLSSRSSRL |
| Ga0187785_106803951 | 3300017947 | Tropical Peatland | PGQLERKADMLWLILIGLLAIIAFGVGFTIHWLFIVAVVLALIWVIALFAGGLSSRSSRL |
| Ga0066667_105772671 | 3300018433 | Grasslands Soil | IILFGVGFTIHWLFIVAIIAALLFVISFFMGGAGGRSRRAWW |
| Ga0190274_136883911 | 3300018476 | Soil | MVLLIVLALLAIVAFGVGFTMHWLFVVAAILAVIWLITFFAGGVRGGAR |
| Ga0066669_122335141 | 3300018482 | Grasslands Soil | LLAIIAFGVGFTVHWLFIVAVILAVVWLISLLAGGAAGRTRGNWW |
| Ga0184643_11215411 | 3300019255 | Groundwater Sediment | RDQKSAEGGVVLLLALLAILAIAAFGVGFTVHWLFVIAVVAALIWLISFFLSGSGGRSRGTWW |
| Ga0184642_17075322 | 3300019279 | Groundwater Sediment | ALLAILAIAAFGVGFTVHWLFVIAVVAALIWLISFFVSGSGGRSRGTWW |
| Ga0197907_104346662 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLVLLAILAIVAFGAAFTIHWLFVVAVVAALLRVISAFLGGVGGRRRGTLF |
| Ga0206356_117671881 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | REGVEMLLLVLLAILAIVAFGAAFTIHWLLVVAVVAALLRVISAFLGGVGGRRRGTLF |
| Ga0206349_13941091 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | REEVEMLLLVLLAILAIVAFGAAFTIHWLFIVAVVAALLWVISAFLGGVGGRRSSTLF |
| Ga0206355_13084803 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFGVGFTIHWLFVVAIVLAVIWLISLLTGGVGGRTRGAWW |
| Ga0206351_105428141 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | EMLLLVLLAILAIVAFGAAFTIHWLLVVAVVAALLRVISAFLGGVGGRRRGTLF |
| Ga0206352_104849131 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | GGDTGVLLLVLLALLAIIAFGVGFTIHWLFNVAIVLALAWLISALAGGIGRRSRGAWW |
| Ga0193719_100064282 | 3300021344 | Soil | MLLIVLALLALVAFGVGFTVHWLFVVAVILALVWVISVFTGGIGGRSRRAWR |
| Ga0193719_101706542 | 3300021344 | Soil | IVLFGVGFAIKWLFILAVIVALLFVISFFMSAAGGRSRGAWW |
| Ga0210384_113182011 | 3300021432 | Soil | MLLLVLLAVLAIVAFGAAFAIHWLFVVAIVAALLWVISALLGGVGGRRRGAIW |
| Ga0222625_16454241 | 3300022195 | Groundwater Sediment | VREQHRDQKSAEGGVVLLLALLAILAIAAFGVGFTVHWLFVIAVVAALIWLISFFLSGSGGRSRGTWW |
| Ga0224712_100967733 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLLALLAIIAFGVGFTVHWLFVIAVVLAVVWLISLLAGGYGGRARGTWW |
| Ga0224712_101361443 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | REGVEMLLLVLLAILAIVAFGAAFTIHWLFVVAVVAALLRVISAFLGGVGGRRRGTLF |
| Ga0224712_103313372 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGFTVHWLFIVAVVLALVWLISLFAGGAGGRTRGSWW |
| Ga0210142_10542562 | 3300025552 | Natural And Restored Wetlands | LVALLIILAVLSIVLFGIGFTVHWLFWVAAIVALVFLIALFAGGIGGRRRVW |
| Ga0207685_104718322 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | FGVGFTVHWLFILAIIAALLFVISFFLSGAGGRSRRAWW |
| Ga0207645_107835873 | 3300025907 | Miscanthus Rhizosphere | IVAFGVGFTIHWLFVVAIVLAVIWLISLLTGGVGGRTRGAWW |
| Ga0207695_101999232 | 3300025913 | Corn Rhizosphere | MLLLVLLAILAIVAFGAAFTIHWLLVVAVVAALLRVISAFLGGVGGRRRGTLF |
| Ga0207693_100742341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AIIAFGVGFTAHWLFVIAVVLALVWVISLFAGGAGGRTRGTWW |
| Ga0210077_10071432 | 3300025952 | Natural And Restored Wetlands | MILLVVLALLAIVAFGVGFTVHWLFVVAVVCALIWLISFFLGGTRGRSRGAWW |
| Ga0207658_100068901 | 3300025986 | Switchgrass Rhizosphere | MLLLVLLAILAIIAFGLGFTIHWLFVAAVVLALVWLISFFVGGIGGRRRAWW |
| Ga0208142_10364142 | 3300025994 | Rice Paddy Soil | MVALLVILAVLSIVLFGIGFTVHWLFWVAAICALIFLIALFAGGVGGRRRAWW |
| Ga0207703_100671632 | 3300026035 | Switchgrass Rhizosphere | MLLLVLLAVLAIIAFGLGFTIHWLFVAAVVLALVWLISFFVGGIGGRRRAWW |
| Ga0207678_104276154 | 3300026067 | Corn Rhizosphere | VHWLFILAIIAALLFVISFFLSGAGGRSRRAWWWSAELVI |
| Ga0209686_10384354 | 3300026315 | Soil | AIILFGVGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW |
| Ga0209152_104072072 | 3300026325 | Soil | IAFGVGFTLHWLFVVAAVVALIWLISLFAGGMGGRSRGAWW |
| Ga0257171_10904131 | 3300026377 | Soil | GFTIHWLFIVAIIAALLFVISFFMGASGGRSRGAWW |
| Ga0209805_14419752 | 3300026542 | Soil | VLFGVGFAIKWLFILAVIVALVFVISFFMGAAGGRRRGAWW |
| Ga0209156_101620901 | 3300026547 | Soil | AIILFGVGFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW |
| Ga0209156_105040302 | 3300026547 | Soil | VGVGFTIHWLFIIAVIAALLFVISLFMGGVGGRSRGAWW |
| Ga0209577_103919762 | 3300026552 | Soil | MVLLVLLAVLAIVAFGLGFTLHWLFIVAVVLAIVWLISVFAGGIGGRRRSAWW |
| Ga0209579_102989592 | 3300027869 | Surface Soil | VLAIIAFGVGFTIHWLFIAAVVLAVLFLISLFAGGGRSRAWW |
| Ga0209579_107473201 | 3300027869 | Surface Soil | LLAIIAFGVGFTLHWLFIVAVVLAVVWLIALLAGGVGGRTRSTWY |
| Ga0265318_102443401 | 3300028577 | Rhizosphere | MFLLFVLAVLAIVAFGVGFTIHWLFIVAVVAALIWLVSVFLGGTGGRTRGTWW |
| Ga0307309_101836831 | 3300028714 | Soil | GFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW |
| Ga0307306_101991342 | 3300028782 | Soil | ILFGVGFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW |
| Ga0307294_100410413 | 3300028810 | Soil | VGFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW |
| Ga0307310_102815941 | 3300028824 | Soil | VGFTVHWLFIVAVVAALLFVISWFMGAAGGRSRGAWW |
| Ga0307277_103141602 | 3300028881 | Soil | VGFTVHWLFIIALIAALLFVISFFMGGARGRSRGAWW |
| Ga0307308_105386751 | 3300028884 | Soil | MLLLVLLALLAVIAFGVGFTVHWLFVMAVIAALLFVISFFAGGPRRRSRGAWW |
| Ga0257196_12384911 | 3300030612 | Host-Associated | LALLAIVAFGVAFTVHWLFVAAVVLALIWLISLFAGGIGGRQRGAWW |
| Ga0102757_100244011 | 3300030785 | Soil | LLALLAVIAFGVGFTLHWLFVLAVIAALLFVISFFLGGIGGRSRGAWW |
| Ga0074013_113705641 | 3300030907 | Soil | ILLVLLALLAIVAFGVAFTVHWLFVAAVVLALIWVISLFAGGIGGRQRGAWW |
| Ga0074013_116717822 | 3300030907 | Soil | LVLLALLAIVAFGVAFTVHWLFVAAVVLALIWLISLFAGGIGGRQRGAWW |
| Ga0308189_103849621 | 3300031058 | Soil | DMLLLVLLAILAIVAFGAAFTIHWLFVVAVVAALLWVISALLGGVGGRRRGLIW |
| Ga0308199_11097932 | 3300031094 | Soil | LAIILFGVGFTVHFLFILAVIAALLFVIMFFMGAAGGRSRGAWW |
| Ga0318534_103265362 | 3300031544 | Soil | MLLLVLLAILAIIAFGVGFTVHWLFSVAVVLALLWLISVFMGGVGGRSRGTWW |
| Ga0265314_104001441 | 3300031711 | Rhizosphere | IMFGAGFAIHLLWIVAVIAALLWVISFFVGGSRRRGTI |
| Ga0318494_104235112 | 3300031751 | Soil | MLLLILLALLAIIAFGIGFTVHWLFIIAVVAALLWVISFFFSGAGGRSRGSWW |
| Ga0307475_104830901 | 3300031754 | Hardwood Forest Soil | FGVGFTVHWLFVIAVVLALVWVITLFAGGAGGRTRGTWW |
| Ga0318535_105411202 | 3300031764 | Soil | IVLFGVGFTIHWLFILAAIAALLSLIAVFTGGMGGRSRGSWY |
| Ga0318521_105478181 | 3300031770 | Soil | GFTVHWLFIVAVIAALLWLIAVFTGGVGGRRRGSWY |
| Ga0308175_1005020511 | 3300031938 | Soil | FIGAGFVIKWLFVLAVICALLFLISLFVGGMGGRTRRAWW |
| Ga0307472_1022402321 | 3300032205 | Hardwood Forest Soil | FGVGFTIHWLFIVALVLALVWLISALAGGIGGRSRGAWW |
| Ga0335070_100695427 | 3300032829 | Soil | VLFLALLAIIAFGVGFTVHWLFIVAVIAALIWLISLFLGGAGGRTRGTWW |
| Ga0335081_121291241 | 3300032892 | Soil | MLILVVLAILAIAAFGVGFTVHWLFVVAVIAALLWVISLLFGATGGRTRGTWW |
| Ga0335069_100956083 | 3300032893 | Soil | MLFLVLLALLAIIAFGVGFTVHWLFIVAVIAALIWLISLFLGGAGGRTRGTWW |
| Ga0370546_099163_383_496 | 3300034681 | Soil | VGFTIHWLFIVAIIAALLFVISFFVGGAGGRSRRAWW |
| ⦗Top⦘ |