


| Basic Information | |
|---|---|
| Family ID | F037319 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLERLVK |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.81 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 94.05 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.619 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF02668 | TauD | 83.93 |
| PF02738 | MoCoBD_1 | 5.95 |
| PF03401 | TctC | 1.19 |
| PF09084 | NMT1 | 0.60 |
| PF02627 | CMD | 0.60 |
| PF01557 | FAA_hydrolase | 0.60 |
| PF01970 | TctA | 0.60 |
| PF13618 | Gluconate_2-dh3 | 0.60 |
| PF00378 | ECH_1 | 0.60 |
| PF15579 | Imm52 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 83.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.19 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.60 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.60 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.60 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.60 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.60 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.43 % |
| Unclassified | root | N/A | 3.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_12069255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300004633|Ga0066395_10552998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300005167|Ga0066672_10538799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300005175|Ga0066673_10349432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300005332|Ga0066388_105838535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300005332|Ga0066388_108708101 | Not Available | 504 | Open in IMG/M |
| 3300005337|Ga0070682_101778097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300005471|Ga0070698_102171864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300005538|Ga0070731_10885293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300005539|Ga0068853_101845952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300005542|Ga0070732_10340110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
| 3300005543|Ga0070672_100344120 | Not Available | 1270 | Open in IMG/M |
| 3300005554|Ga0066661_10723024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300005602|Ga0070762_11044153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300005618|Ga0068864_102565186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300005712|Ga0070764_10441750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300005718|Ga0068866_11146864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300005764|Ga0066903_100129148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3547 | Open in IMG/M |
| 3300005764|Ga0066903_104565208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300005764|Ga0066903_104894615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300006028|Ga0070717_11183548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300006046|Ga0066652_101300372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300006176|Ga0070765_100219863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1731 | Open in IMG/M |
| 3300006176|Ga0070765_101668477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300006844|Ga0075428_102088013 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006847|Ga0075431_101835194 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009094|Ga0111539_12589316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300009100|Ga0075418_10828303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300009143|Ga0099792_10196850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300009523|Ga0116221_1065980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1647 | Open in IMG/M |
| 3300009683|Ga0116224_10247829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300009792|Ga0126374_11247407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300010043|Ga0126380_12061305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300010046|Ga0126384_11241854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300010343|Ga0074044_10908038 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010358|Ga0126370_11324248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300010358|Ga0126370_11932342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300010361|Ga0126378_12763831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300010366|Ga0126379_11121725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300010366|Ga0126379_13618049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300010376|Ga0126381_103466776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 620 | Open in IMG/M |
| 3300010868|Ga0124844_1014634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2087 | Open in IMG/M |
| 3300011271|Ga0137393_11553848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300012089|Ga0153924_1084833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300012199|Ga0137383_10766403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300012208|Ga0137376_11123045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300012209|Ga0137379_10095663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2857 | Open in IMG/M |
| 3300012351|Ga0137386_10099477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2055 | Open in IMG/M |
| 3300012363|Ga0137390_10685747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300012683|Ga0137398_10420120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 912 | Open in IMG/M |
| 3300012927|Ga0137416_10197351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1613 | Open in IMG/M |
| 3300012957|Ga0164303_10719822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300012961|Ga0164302_11143972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300013306|Ga0163162_12233432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300014311|Ga0075322_1204267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300014489|Ga0182018_10165391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
| 3300014501|Ga0182024_10249647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2380 | Open in IMG/M |
| 3300014657|Ga0181522_10089768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1766 | Open in IMG/M |
| 3300014657|Ga0181522_10134559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1440 | Open in IMG/M |
| 3300015371|Ga0132258_12408949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1318 | Open in IMG/M |
| 3300015373|Ga0132257_104224588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300016270|Ga0182036_10230351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1376 | Open in IMG/M |
| 3300016319|Ga0182033_11671979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300016341|Ga0182035_12181422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300016387|Ga0182040_11713386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300016445|Ga0182038_10385333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300016702|Ga0181511_1037061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1728 | Open in IMG/M |
| 3300017959|Ga0187779_10353713 | Not Available | 950 | Open in IMG/M |
| 3300017970|Ga0187783_11364173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300017975|Ga0187782_10741477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 758 | Open in IMG/M |
| 3300018066|Ga0184617_1020626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1461 | Open in IMG/M |
| 3300018076|Ga0184609_10108397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1254 | Open in IMG/M |
| 3300018079|Ga0184627_10588715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300018090|Ga0187770_11176269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300018465|Ga0190269_10553174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
| 3300020000|Ga0193692_1041728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300020020|Ga0193738_1125989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300021078|Ga0210381_10011465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2161 | Open in IMG/M |
| 3300021090|Ga0210377_10757881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300021168|Ga0210406_10869068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300021178|Ga0210408_10562631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300021178|Ga0210408_10872278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
| 3300021344|Ga0193719_10139504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
| 3300021432|Ga0210384_10760978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300021432|Ga0210384_11668096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300021474|Ga0210390_10850026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300021479|Ga0210410_10518450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1064 | Open in IMG/M |
| 3300021559|Ga0210409_10615759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300022557|Ga0212123_10366156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 979 | Open in IMG/M |
| 3300024288|Ga0179589_10302525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300025920|Ga0207649_11643185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300025927|Ga0207687_11867708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300025938|Ga0207704_10654330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 866 | Open in IMG/M |
| 3300025939|Ga0207665_10908388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300025940|Ga0207691_10435479 | Not Available | 1116 | Open in IMG/M |
| 3300026325|Ga0209152_10428204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300026538|Ga0209056_10037038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4525 | Open in IMG/M |
| 3300026555|Ga0179593_1009005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2437 | Open in IMG/M |
| 3300027181|Ga0208997_1028952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300027537|Ga0209419_1103363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300027562|Ga0209735_1024928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1237 | Open in IMG/M |
| 3300027629|Ga0209422_1138700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300027645|Ga0209117_1108076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300027886|Ga0209486_11091171 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027889|Ga0209380_10460134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300027889|Ga0209380_10814052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300027898|Ga0209067_10505424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300028380|Ga0268265_12033846 | Not Available | 582 | Open in IMG/M |
| 3300028720|Ga0307317_10235187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300028787|Ga0307323_10213948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300028802|Ga0307503_10392482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300028819|Ga0307296_10309828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 861 | Open in IMG/M |
| 3300028876|Ga0307286_10319498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300028906|Ga0308309_11011985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300028906|Ga0308309_11248252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300030294|Ga0311349_12101106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300031538|Ga0310888_10807050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300031544|Ga0318534_10129110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1454 | Open in IMG/M |
| 3300031547|Ga0310887_10959174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
| 3300031561|Ga0318528_10348382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300031573|Ga0310915_10755282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031681|Ga0318572_10272265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300031682|Ga0318560_10196305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300031708|Ga0310686_102363087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300031708|Ga0310686_111833064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300031719|Ga0306917_10864429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300031736|Ga0318501_10290349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300031771|Ga0318546_11268635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300031781|Ga0318547_10935653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300031793|Ga0318548_10666537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300031798|Ga0318523_10265633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300031798|Ga0318523_10597267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031805|Ga0318497_10729758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300031821|Ga0318567_10382958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300031879|Ga0306919_11420143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300031890|Ga0306925_10369497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1539 | Open in IMG/M |
| 3300031890|Ga0306925_12095510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300031894|Ga0318522_10270209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300031940|Ga0310901_10418657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300031941|Ga0310912_10401146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300031941|Ga0310912_11000795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300031944|Ga0310884_10451501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300031945|Ga0310913_10668064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300031946|Ga0310910_10886793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300031946|Ga0310910_10967434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300031981|Ga0318531_10237825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300032001|Ga0306922_10787280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
| 3300032001|Ga0306922_12003593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300032035|Ga0310911_10141488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
| 3300032041|Ga0318549_10414877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300032059|Ga0318533_10146953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1666 | Open in IMG/M |
| 3300032060|Ga0318505_10582974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300032063|Ga0318504_10108787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300032065|Ga0318513_10550743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300032066|Ga0318514_10168574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| 3300032066|Ga0318514_10402526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300032067|Ga0318524_10219545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300032075|Ga0310890_10770552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300032076|Ga0306924_11989332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300032091|Ga0318577_10259035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
| 3300032180|Ga0307471_101445106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300032180|Ga0307471_104108502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300032261|Ga0306920_102459021 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032261|Ga0306920_103984048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300032783|Ga0335079_11780194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300032892|Ga0335081_10299205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. | 2133 | Open in IMG/M |
| 3300032895|Ga0335074_10118435 | Not Available | 3437 | Open in IMG/M |
| 3300032895|Ga0335074_10723276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.19% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.60% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_120692551 | 3300000890 | Soil | MATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATLKA |
| Ga0066395_105529981 | 3300004633 | Tropical Forest Soil | MSSARLPVLEKFIADLRTIWSAEADNHQRMERAKPLLEQLVKDAGLKA |
| Ga0066672_105387991 | 3300005167 | Soil | MSNARLPVLEQFIGDLRAVWAAEADERRRMEKARPLLERLVRDPALRVHSAAW |
| Ga0066673_103494321 | 3300005175 | Soil | MTNPRLPVLDRFIGDLRAIWAADSDNERRMAKAKPLLEKLVKDATLKAHST |
| Ga0066388_1058385351 | 3300005332 | Tropical Forest Soil | MSSARLPVLEKFIGDLRTIWSADADNQRRMEKAKPRLEQLV |
| Ga0066388_1087081012 | 3300005332 | Tropical Forest Soil | MPPKSWVPDMSSARLPVLEKFINELRVIWSTNADRQSRMEKAKPVLECFVMEPTLK |
| Ga0070682_1017780971 | 3300005337 | Corn Rhizosphere | MTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKA |
| Ga0070698_1021718641 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDARLPILEKFIDELRAVWAAETDDQRRMEKAKPLLERLVRD |
| Ga0070731_108852931 | 3300005538 | Surface Soil | MPNQRLPVLDKFIADLRAIWAAESDDEHRMKKAKPLLEKLVM |
| Ga0068853_1018459521 | 3300005539 | Corn Rhizosphere | MTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKAH |
| Ga0070732_103401102 | 3300005542 | Surface Soil | MSNPNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMEKAKPL |
| Ga0070672_1003441202 | 3300005543 | Miscanthus Rhizosphere | MTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAMPLLEQLVKDETLKAHSTE |
| Ga0066661_107230241 | 3300005554 | Soil | MSSARLPVLEKFIKELRTIWAAESDTRRRMERAKPLLEEFVKD |
| Ga0070762_110441531 | 3300005602 | Soil | MSNIAAQRLPVFEKFIGDLRAVWAAEADDRRRMERAKPLLE |
| Ga0068864_1025651861 | 3300005618 | Switchgrass Rhizosphere | MTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVK |
| Ga0070764_104417502 | 3300005712 | Soil | MSNLAAQRLPVFDKFIGDLRAVWAAETDDQRRMQKAKPLLERLVMDPALKSHSASW |
| Ga0068866_111468642 | 3300005718 | Miscanthus Rhizosphere | MSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPAL |
| Ga0066903_1001291485 | 3300005764 | Tropical Forest Soil | MPARLPVMEKFIGDLRAVWAAASENQIRMERAKPLLE |
| Ga0066903_1045652082 | 3300005764 | Tropical Forest Soil | MTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLVMD |
| Ga0066903_1048946152 | 3300005764 | Tropical Forest Soil | MSITRLPVLEKFIADLRTIWSAEADNRRRMERAKPLLEQLVK |
| Ga0070717_111835482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNPNLAAQRLPVFEKFISDLRAVWAAESDDQRRMEKAKPLLERLVL |
| Ga0066652_1013003721 | 3300006046 | Soil | MSSARPPILEKFIGDLRTIWAAEAHEQRRMEKAKPLLERLVSDGGLKAHSAAWPS |
| Ga0070765_1002198631 | 3300006176 | Soil | MTNPRLPVFDTFIGDLRAIWAAEADDQRRMEKAKPLLERLVL |
| Ga0070765_1016684771 | 3300006176 | Soil | MSNPNLAARRLPVFETFIDNLRAVWAAEADDRRRMEKAKPLLERLVLD |
| Ga0075428_1020880131 | 3300006844 | Populus Rhizosphere | MSSARLPVLEKFIHELRKVWSTNADNQSRMEKAKPLLENFV |
| Ga0075431_1018351941 | 3300006847 | Populus Rhizosphere | MSSPRLPVLEKFIHELRKVWSTNADNQSRMERAKPLLEKFVLEPTLKAHS |
| Ga0111539_125893161 | 3300009094 | Populus Rhizosphere | VQNQRLRAFARFIGELRAVWAAERDDEARMNRAKPLLER |
| Ga0075418_108283031 | 3300009100 | Populus Rhizosphere | MSGPRLPVLEKFIGELRGIWATEAGDRRRMEAAKPLMERLVMEPALKAAATEWPS |
| Ga0099792_101968501 | 3300009143 | Vadose Zone Soil | MPNPRLPVLDKFIGDLRAVWAAEADNQRRMEKAKPLLEQLVKDPALKANSAGSPST |
| Ga0116221_10659801 | 3300009523 | Peatlands Soil | MPNARLPVFDKFIGDLRAVWSTEPDDAQRMEKAKPLVEAFVKDPSLKSHSA |
| Ga0116224_102478292 | 3300009683 | Peatlands Soil | VKETAMSNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMEKAKPLMERLVLDDTLKAHSAHWP |
| Ga0126374_112474072 | 3300009792 | Tropical Forest Soil | MSSARLPILEQFIGDLRAVWAAEADEARRMEKAKPLLERLVADSGLKAHS |
| Ga0126380_120613052 | 3300010043 | Tropical Forest Soil | MSSARLPILDKFIGDLRTIWSADADNQRRMEKAKPRLEQLVKD |
| Ga0126384_112418542 | 3300010046 | Tropical Forest Soil | MSSARLPVLDKFIGDLRTIWSAEADNQPRMEKAKPLLEQLVKDDGLKAHSA |
| Ga0074044_109080382 | 3300010343 | Bog Forest Soil | MANLRLPVFDTFIADLRAIWAAETDDRRRMERAKPLLENLVLEPTL* |
| Ga0126370_113242481 | 3300010358 | Tropical Forest Soil | MTSARLPVLERFIADLRTVWAAQSDNGRRMEEAKPLLERLLR |
| Ga0126370_119323421 | 3300010358 | Tropical Forest Soil | MSNARLPVLEKFIADLRTIWSAEADNQRRMEKAKP |
| Ga0126378_127638312 | 3300010361 | Tropical Forest Soil | MSSARRLPVFEQFIGELRAVWTAEPDARRRMERAKPLLERLVNDAA |
| Ga0126379_111217251 | 3300010366 | Tropical Forest Soil | MASARLPILETFIADLRAIWAAEADDQRRMERAKPLLERLV |
| Ga0126379_136180491 | 3300010366 | Tropical Forest Soil | MSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLERLVK |
| Ga0126381_1034667761 | 3300010376 | Tropical Forest Soil | MSNARLPVFEKFISDLRAIWAAHSDNQRRMETAKPLLEQFVKNESLRAH |
| Ga0124844_10146343 | 3300010868 | Tropical Forest Soil | MSSARLPVLDKFIADLQAIWSGEADNRRRMEKAKPRLEQLVKDEGLRAHSATWP |
| Ga0137393_115538482 | 3300011271 | Vadose Zone Soil | MPSARLPVLEQFIGDLRALWAAEPDNRRRMEQAKPLLEQLLNDPGLRAH |
| Ga0153924_10848332 | 3300012089 | Attine Ant Fungus Gardens | MTNPRSPIFDKFIADLRAIWAAEADDQRRMEKAKPLVERLVMD |
| Ga0137383_107664032 | 3300012199 | Vadose Zone Soil | MSSARLPVLEKFINELRTIWAAESGTRRRMERAKPLLEEFVKDP |
| Ga0137376_111230452 | 3300012208 | Vadose Zone Soil | MTNPRLPVLDRFIGELRAIWAADSENERRMAKAKPLLEKLVKDE |
| Ga0137379_100956634 | 3300012209 | Vadose Zone Soil | MSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDE |
| Ga0137386_100994773 | 3300012351 | Vadose Zone Soil | MSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDAG |
| Ga0137390_106857472 | 3300012363 | Vadose Zone Soil | MATPRLPVLDKFIGDLRAIWAGEFENGRRMEKTKPLLEQLVKDATLKAHSVGWPS |
| Ga0137398_104201202 | 3300012683 | Vadose Zone Soil | MPNPRLPVLDKFIGNLRAVWAAESDNQRRMERAKPLLEQLVRDP |
| Ga0137416_101973514 | 3300012927 | Vadose Zone Soil | MGSAGLLVFEEFVAQLRAIWEAESDNQGRMEKAKPLLERLVKDPGL |
| Ga0164303_107198222 | 3300012957 | Soil | MANARLPVFDKFIDDLRAIWAAEAENRLRMEKAKPLVEQLMKDPSLKA |
| Ga0164302_111439721 | 3300012961 | Soil | MANARLPVFDKFIDDLRAIWAAEAENRLRMEKAKPLVEQLM |
| Ga0163162_122334321 | 3300013306 | Switchgrass Rhizosphere | MPNARLPVFDRFIDDLRSIWAADPENGRRMEKAKPLLEQLVKDAT |
| Ga0075322_12042672 | 3300014311 | Natural And Restored Wetlands | MPKSIPVLDAFIARLREVWAEEFDDRRRMERAKPLLEHLVAD |
| Ga0182018_101653911 | 3300014489 | Palsa | VKETIMSNLAAQRLPVFDKFIGDLRAIWSAEADDQRRMEKAKPLLEQLV |
| Ga0182024_102496474 | 3300014501 | Permafrost | VKETIMSNLAAQRLPIFEKFIGDLRAVWAAEADDQRRMEKAKPLVERLVLDETLK |
| Ga0181522_100897683 | 3300014657 | Bog | VKETIMSNLAAPNLTARRLPVFEKFIGDLRAVWAAEADDRRRMERAKPLLERLVLDQ |
| Ga0181522_101345591 | 3300014657 | Bog | MPNPRLPVFDKFIADLRAIWAAEADDGRRMAKAKPFLERLV |
| Ga0132258_124089493 | 3300015371 | Arabidopsis Rhizosphere | MSSARLPVLDKFIGELRTIWSAEADNQRRMEKAKPLLEQLVKDGGLKAHSASWPS |
| Ga0132257_1042245882 | 3300015373 | Arabidopsis Rhizosphere | MSNARLPVFEKFIADLRAIWAAQPDDQRRMEAAKPLLERLVLDPALKAHSASWPS |
| Ga0182036_102303511 | 3300016270 | Soil | MSSARLPILEKFIADLRTIWSAEADNQRRMEKAKPLLEQLVKDEGLK |
| Ga0182033_116719792 | 3300016319 | Soil | MSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVMDNGLKA |
| Ga0182035_121814222 | 3300016341 | Soil | MSSIRLPVLEKFVADLRTIWSAEADNQRRMEKAKPLLEHLV |
| Ga0182040_117133861 | 3300016387 | Soil | MSNARLPVFEKFISDLQGIWAAHSDNQRRMETAKP |
| Ga0182038_103853331 | 3300016445 | Soil | MTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPL |
| Ga0181511_10370611 | 3300016702 | Peatland | MSNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMERAQPLLERLV |
| Ga0187779_103537131 | 3300017959 | Tropical Peatland | MTTLPVFETFIRDLRAIWAATADNAARMEQARPLME |
| Ga0187783_113641732 | 3300017970 | Tropical Peatland | MSQPRLPVFDEFIADLRVVWAAEVDDGRRMARAKPLLERLVKDETLKAHSAD |
| Ga0187782_107414772 | 3300017975 | Tropical Peatland | MARPRLPVFDRFIGELRAIWAAEADDGRRMEQAKPLLEALVMDPA |
| Ga0184617_10206261 | 3300018066 | Groundwater Sediment | MASPRLPVLDRFIGDLRAIWAAESDNRHRMERAKPVLERL |
| Ga0184609_101083973 | 3300018076 | Groundwater Sediment | MANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKDATLKAHSAGW |
| Ga0184627_105887152 | 3300018079 | Groundwater Sediment | MSRLSVLEKFIGDLRAIWAAETDNQRRMERAKPLLETFVVE |
| Ga0187770_111762691 | 3300018090 | Tropical Peatland | MPNSRLLVFDKFIADLRAIWSSDADDGRRMAKAKPLLERLVMDPVFKACSVD |
| Ga0190269_105531741 | 3300018465 | Soil | MSARLPALETFIADLRAIWSANAVNKDRMEKAKPRL |
| Ga0193692_10417281 | 3300020000 | Soil | MANPRLPVLDKFIVELRTIWAEDSENERRMAKAKPLLEQLVKDATLK |
| Ga0193738_11259892 | 3300020020 | Soil | MAERLPAFESFIRELRAVWAAEADDRARMERAKPLLERLV |
| Ga0210381_100114651 | 3300021078 | Groundwater Sediment | MATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATLKAHSAGWPS |
| Ga0210377_107578812 | 3300021090 | Groundwater Sediment | MTKKRLPALEMFIGELRAVWAAEAEDRARMERAKPLLEWLVMDVRLKA |
| Ga0210406_108690682 | 3300021168 | Soil | MASAGLPVFEQFIAQLRAIWEADGDNQRRMEKAKPLLEALVRDPDLKAHSA |
| Ga0210408_105626311 | 3300021178 | Soil | MSSARLPVLEKFIADLRTIWSAEADNQRRMERAKPLLEQLVKDAGLKGH |
| Ga0210408_108722782 | 3300021178 | Soil | MSNGRLPVFQRFIADLRAIWAAEGEDARRMERAKPLLESFVMDEDLK |
| Ga0193719_101395042 | 3300021344 | Soil | MANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKDATL |
| Ga0210384_107609781 | 3300021432 | Soil | MSAGLPVFEQFVADLRAIWEAESDNQSRMQNAKPLLE |
| Ga0210384_116680961 | 3300021432 | Soil | MASAGLPVFEKFVAQLRAIWEAESDNQGRMEKAKPLLEQLVRDP |
| Ga0210390_108500261 | 3300021474 | Soil | MSNLAAQRLPVFEKFIGDLRAVWAAENDDQRRMEGAKPLLERLVMD |
| Ga0210410_105184501 | 3300021479 | Soil | MASAGLPVFEKFVAQLRAIWEAESDNQGRMERARPLL |
| Ga0210409_106157591 | 3300021559 | Soil | MSNLAAQRLPVFEKFIGDLRAIWAAEADDQRRMEKAKLLLE |
| Ga0212123_103661562 | 3300022557 | Iron-Sulfur Acid Spring | MSNLAAQRLPVFEKFIGDLRAVWAAENDDRRRMERAKPLLERLVLDETLKSHSASWP |
| Ga0179589_103025251 | 3300024288 | Vadose Zone Soil | MSNARLPVFDRFVNDLRGIWAAEAENQHRMERAKPLLERLVKDDGLKAHS |
| Ga0207649_116431851 | 3300025920 | Corn Rhizosphere | MTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKAHST |
| Ga0207687_118677081 | 3300025927 | Miscanthus Rhizosphere | MTNPRLPVLDRFIGELRAIWATDSDNEHRMAKAKPLLEKLVTDATLKAH |
| Ga0207704_106543301 | 3300025938 | Miscanthus Rhizosphere | MSVRLPVLDKFIADLRAIWAANTDNQSRMEKAKPALEKFVMDPAL |
| Ga0207665_109083881 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSARLPVLEKFIGDLRTVWAAQSDNGRRMEQAKPLLERLLRDPDLKAHSAQWPST |
| Ga0207691_104354792 | 3300025940 | Miscanthus Rhizosphere | MTNPRLPVLNRFIGDLRAIWAADSENERRMAKAKP |
| Ga0209152_104282041 | 3300026325 | Soil | MSRLPVLEQFIRDLRSIWATQSDSQRRMERAKPFLEELLKD |
| Ga0209056_100370381 | 3300026538 | Soil | MSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDAGLKAHSASWPST |
| Ga0179593_10090054 | 3300026555 | Vadose Zone Soil | VKETTMSNLAAQRLPVFEKFIGDLRAVWAAEAHDQRRMERANPSWNGW |
| Ga0208997_10289522 | 3300027181 | Forest Soil | MPNPRLPVLDKFIGDLRAVWTAEADNQRRMEKAKPLLEQFVKDPALKANSADWP |
| Ga0209419_11033632 | 3300027537 | Forest Soil | MSNLAAQRLPVFEKFIGDLRAVWATETDDQRRMEKAKPLVERLVLDE |
| Ga0209735_10249281 | 3300027562 | Forest Soil | MNNPNLAAQRLPVFDKFIGDLRTVWAAEADDRRRMEKAKPFLERLVLDDTLKT |
| Ga0209422_11387001 | 3300027629 | Forest Soil | MSNLAAQRLPVFEKFIGDLRAVWAAESDDQRRMEK |
| Ga0209117_11080761 | 3300027645 | Forest Soil | MSIPSIAARRLPVFDKFIGDLRAVWAAEADDQGRMERAK |
| Ga0209486_110911711 | 3300027886 | Agricultural Soil | MSSAQRLPELNAFIAELRAIWAANGENKDRMEQAKPVLERFVR |
| Ga0209380_104601342 | 3300027889 | Soil | MSSPNLAARRLPVFEKFIGDLRAVWAAEPNDQCRMERAKPLLERLVLDQTLKAHSA |
| Ga0209380_108140521 | 3300027889 | Soil | MASAGLLIFETFITQLRVIWEADGDNQRRMEKAKPLLEALVK |
| Ga0209067_105054241 | 3300027898 | Watersheds | MPNARLPVFEKFIGDLRAVWSDETDDARRMERARPLV |
| Ga0268265_120338461 | 3300028380 | Switchgrass Rhizosphere | TFMPTARLPVFQAFIDDLRAVWAGQPDDRRRMQRAKPLLER |
| Ga0307317_102351872 | 3300028720 | Soil | MPNPRLPVLDKFIGDLRAVWAAEADNQRRMEKAKPLLEQLVKDPALK |
| Ga0307323_102139481 | 3300028787 | Soil | MATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATL |
| Ga0307503_103924822 | 3300028802 | Soil | MVNARLPVFEKFINDLRAVWGAETDRRRRMERAKPLVEQLVRDPSLKAHS |
| Ga0307296_103098281 | 3300028819 | Soil | MPNPRLPVLDKFIGDLRAVWTAEADNQRRMEKAKPLLEQFVKNPALKASSAD |
| Ga0307286_103194982 | 3300028876 | Soil | MANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKD |
| Ga0308309_110119851 | 3300028906 | Soil | MSNPRLPVFDRFIADLRAIWAAEIEDRRRMERAGPLLQKLMMD |
| Ga0308309_112482521 | 3300028906 | Soil | MASAGLPVFEDFVAQLRAIWQAEGDNQRRMEKARPLLQQLVKD |
| Ga0311349_121011061 | 3300030294 | Fen | MVTPRMPVLDKFIGDLRAIWAADSENQRRMEKAKPLLEKLVKDE |
| Ga0310888_108070501 | 3300031538 | Soil | MASPRLPVLDRFIGDLRAIWTAESDNQHRMERAKPLLERLVMDPTLKA |
| Ga0318534_101291101 | 3300031544 | Soil | MSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVKDAGLKAH |
| Ga0310887_109591742 | 3300031547 | Soil | MSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPALEKFV |
| Ga0318528_103483822 | 3300031561 | Soil | MSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVM |
| Ga0310915_107552821 | 3300031573 | Soil | MSSARLPVLEKFIADLRTVWSAEADSRRRMERAKPLLEQLVKDAGLKAHSA |
| Ga0318572_102722651 | 3300031681 | Soil | MTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPLLERLVMDQDLK |
| Ga0318560_101963052 | 3300031682 | Soil | MSSTRLPVLEKFIADLRTIWSAEADNHRRMERAKPLLEQLVKDAGLKAHSASWPS |
| Ga0310686_1023630872 | 3300031708 | Soil | MSNPNLAAHRLPVFDEFIGALRAIWAAETDDQRRMENAKPLLERL |
| Ga0310686_1118330642 | 3300031708 | Soil | MSNPRLPIFDKFVADLRAIWAAEAEDQRRMEKAKPLLERL |
| Ga0306917_108644291 | 3300031719 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLKAHSAQGKQDAQAV |
| Ga0318501_102903491 | 3300031736 | Soil | MGRLPVIEKFIADLRAIWASETDDRRRMEEAKPLLERLLADPGLK |
| Ga0318546_112686352 | 3300031771 | Soil | MSSARLPVLEKFIADLRTIWSAEADNHRRMERAKPLLEQLVK |
| Ga0318547_109356532 | 3300031781 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPL |
| Ga0318548_106665372 | 3300031793 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVK |
| Ga0318523_102656332 | 3300031798 | Soil | MTGARLPVLDSFIADLRAVWAAEPDDRRRMERAKP |
| Ga0318523_105972672 | 3300031798 | Soil | MSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLEHLVKD |
| Ga0318497_107297582 | 3300031805 | Soil | MSSARLPVLEKFIADLRTVWSAEADSRRRMERAKPLLEQLVKDAGLKAHSASWP |
| Ga0318567_103829582 | 3300031821 | Soil | MANPNLPAQRLPVFDSFIADLRVIWAAEADDRRRMEKAKPRLERLVRNDA |
| Ga0306919_114201432 | 3300031879 | Soil | MSQLPVLEAFIRELRAVWAAEPDNGRRMERAKPLLERLLREPALKAHA |
| Ga0306925_103694973 | 3300031890 | Soil | MTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLVMDQG |
| Ga0306925_120955102 | 3300031890 | Soil | MLPVFEKFVGDLRAIWAADSDNQRRMERAKPLLEQLVKDETL |
| Ga0318522_102702091 | 3300031894 | Soil | MSSARLPILEKFIDDLRAAWAADADEARRMENAKPLLERLV |
| Ga0310901_104186572 | 3300031940 | Soil | MSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPLLERFVMEPALKAHSADWP |
| Ga0310912_104011462 | 3300031941 | Soil | MTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLV |
| Ga0310912_110007951 | 3300031941 | Soil | MLPGFEKFIGDLRAIWAADSDNQRRMERTKPLLEQL |
| Ga0310884_104515011 | 3300031944 | Soil | MTKLLPAFESFVHELRAIWAAERDDRTRMKHAKPLLE |
| Ga0310913_106680642 | 3300031945 | Soil | MSSTRLPVLEKFIGDLRTIWSAEADNQRRMEKARPLPEH |
| Ga0310910_108867932 | 3300031946 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDP |
| Ga0310910_109674342 | 3300031946 | Soil | MSRLPVIEQFIADLRAIWASETDNEGRMTRAKSLLERLLNNPDLKAHSATWPST |
| Ga0318531_102378252 | 3300031981 | Soil | MTTAGLPVFENFVADLRAIWAAENDNQRRMERAKP |
| Ga0306922_107872802 | 3300032001 | Soil | MANPNLAAQRLPVFDSFIADLRAIWAAEADDRRRM |
| Ga0306922_120035931 | 3300032001 | Soil | MLPGFEKFIGDLRAIWAADSDNQRRMERAKPLLEQLVKDESLRVHSAR |
| Ga0310911_101414881 | 3300032035 | Soil | MTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPLLERLVMDQDLKAHS |
| Ga0318549_104148772 | 3300032041 | Soil | MSSTRLPILEKFIADLRTIWGAEADNQRRMEKAKPLL |
| Ga0318533_101469533 | 3300032059 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLKG |
| Ga0318505_105829741 | 3300032060 | Soil | MASVGLPVFENFIADLRRIWAAERDNKRRMERAKPLLEQLVMDSGLKAHSA |
| Ga0318504_101087871 | 3300032063 | Soil | MTRARLPVLDSFIADLRAVWAAEPDDRRRMERAKPLLEKLLADP |
| Ga0318513_105507432 | 3300032065 | Soil | MTGARLPVLDSFIADLRAVWAAEPDDRRRMERAKPLLEKLLAD |
| Ga0318514_101685742 | 3300032066 | Soil | MSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVK |
| Ga0318514_104025261 | 3300032066 | Soil | MSSTRLPVLEKFIGDLRTIWSAEADNQRRMEKARPL |
| Ga0318524_102195451 | 3300032067 | Soil | MSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVKDAGLKAHSASWPST |
| Ga0310890_107705521 | 3300032075 | Soil | MASPRLPVLDRFIGDLRAIWTAESDNQHRMERAKPLLE |
| Ga0306924_119893322 | 3300032076 | Soil | MSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVMDNGLKAHSAQ |
| Ga0318577_102590352 | 3300032091 | Soil | MPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLK |
| Ga0307471_1014451061 | 3300032180 | Hardwood Forest Soil | MANRLAAFERFIGDLRAVWAEARDDQQRIERAKPLLERFVMDP |
| Ga0307471_1041085021 | 3300032180 | Hardwood Forest Soil | MSNLAAQLLPVFEKFIGDLSAVWAAEAEDRRRMEKSKPLLERLV |
| Ga0306920_1024590211 | 3300032261 | Soil | ARLPILEKFIADLRTIWSADTDNQRRMEKAKPLLE |
| Ga0306920_1039840481 | 3300032261 | Soil | MTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLE |
| Ga0335079_117801941 | 3300032783 | Soil | MANPRLPVFDAFIGDLRAIWAAEADDRRRMEKAKPLLERLV |
| Ga0335081_102992051 | 3300032892 | Soil | MTIPAFDRFLADLRALWAAESDMRRRMERAKPLLERLV |
| Ga0335074_101184354 | 3300032895 | Soil | MPHSRLPIFDQFIADLRAIWAAESDDGGRMHKAKPLLERLVRD |
| Ga0335074_107232761 | 3300032895 | Soil | MTNPRLPVFDKFITDLRAVWAAESDDGRRMAKAKPLLEK |
| ⦗Top⦘ |