


| Basic Information | |
|---|---|
| Family ID | F037314 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PALEAYQKFLELDQDKNPDQVWQAQQRSKVLKRMLEQKR |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.81 % |
| % of genes from short scaffolds (< 2000 bps) | 85.12 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.976 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF01863 | YgjP-like | 10.71 |
| PF14520 | HHH_5 | 0.60 |
| PF03054 | tRNA_Me_trans | 0.60 |
| PF01541 | GIY-YIG | 0.60 |
| PF12006 | DUF3500 | 0.60 |
| PF13174 | TPR_6 | 0.60 |
| PF14559 | TPR_19 | 0.60 |
| PF12732 | YtxH | 0.60 |
| PF00331 | Glyco_hydro_10 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 10.71 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.24 % |
| Unclassified | root | N/A | 4.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10351571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10439820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005166|Ga0066674_10139842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1139 | Open in IMG/M |
| 3300005332|Ga0066388_105529834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300005437|Ga0070710_10637230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300005518|Ga0070699_100921540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300005518|Ga0070699_101868213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005541|Ga0070733_10714331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300005541|Ga0070733_10741087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300005554|Ga0066661_10347796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 908 | Open in IMG/M |
| 3300005566|Ga0066693_10387912 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005575|Ga0066702_10528404 | Not Available | 715 | Open in IMG/M |
| 3300005602|Ga0070762_10655911 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005921|Ga0070766_10783151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300006032|Ga0066696_10778731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300006176|Ga0070765_100444538 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300006354|Ga0075021_11040042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300006794|Ga0066658_10837702 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006796|Ga0066665_10284464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300006806|Ga0079220_10332531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 956 | Open in IMG/M |
| 3300006903|Ga0075426_10003029 | All Organisms → cellular organisms → Bacteria | 12002 | Open in IMG/M |
| 3300006904|Ga0075424_102029904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300007255|Ga0099791_10359167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300007265|Ga0099794_10110781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300007265|Ga0099794_10155322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300007819|Ga0104322_133379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300009012|Ga0066710_103673662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300009012|Ga0066710_104079272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300009038|Ga0099829_10501805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300009038|Ga0099829_10659621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300009088|Ga0099830_10771910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300009089|Ga0099828_10210846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1735 | Open in IMG/M |
| 3300009143|Ga0099792_10089442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1595 | Open in IMG/M |
| 3300009162|Ga0075423_11177777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300009649|Ga0105855_1247940 | Not Available | 550 | Open in IMG/M |
| 3300009792|Ga0126374_10891831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300010046|Ga0126384_10106910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2077 | Open in IMG/M |
| 3300010336|Ga0134071_10181927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300010336|Ga0134071_10428243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010343|Ga0074044_10259673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300010343|Ga0074044_10485052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300010358|Ga0126370_12617267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010359|Ga0126376_10791156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300010366|Ga0126379_10085016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2757 | Open in IMG/M |
| 3300010376|Ga0126381_101818514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300010398|Ga0126383_11516479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300011120|Ga0150983_13543485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300011120|Ga0150983_14984125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300011269|Ga0137392_10623120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300011270|Ga0137391_10409083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300012096|Ga0137389_11171440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300012202|Ga0137363_10087021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2342 | Open in IMG/M |
| 3300012202|Ga0137363_11668556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012203|Ga0137399_10810544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300012205|Ga0137362_10023932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4757 | Open in IMG/M |
| 3300012205|Ga0137362_10406755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300012205|Ga0137362_10948147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012207|Ga0137381_10077790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2781 | Open in IMG/M |
| 3300012207|Ga0137381_10995488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300012349|Ga0137387_11093341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012351|Ga0137386_10155146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300012361|Ga0137360_11222480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300012362|Ga0137361_10006268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8116 | Open in IMG/M |
| 3300012362|Ga0137361_10260535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300012683|Ga0137398_10108535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1756 | Open in IMG/M |
| 3300012683|Ga0137398_10201955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300012683|Ga0137398_10346638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300012917|Ga0137395_10274166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300012918|Ga0137396_10293394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300012923|Ga0137359_11144512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012924|Ga0137413_10259693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300012925|Ga0137419_11004963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012930|Ga0137407_12395810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300012944|Ga0137410_11571222 | Not Available | 576 | Open in IMG/M |
| 3300014150|Ga0134081_10131909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300014154|Ga0134075_10299551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300014968|Ga0157379_11466834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300014969|Ga0157376_11308021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300015051|Ga0137414_1090766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300015053|Ga0137405_1184143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
| 3300015054|Ga0137420_1042589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300015264|Ga0137403_10165155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2169 | Open in IMG/M |
| 3300017823|Ga0187818_10492301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300017924|Ga0187820_1000203 | All Organisms → cellular organisms → Bacteria | 12914 | Open in IMG/M |
| 3300017943|Ga0187819_10313218 | Not Available | 911 | Open in IMG/M |
| 3300018482|Ga0066669_10390278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300019789|Ga0137408_1412467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300020170|Ga0179594_10225460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300020579|Ga0210407_10091121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2307 | Open in IMG/M |
| 3300020580|Ga0210403_10056241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3149 | Open in IMG/M |
| 3300020580|Ga0210403_10065108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2924 | Open in IMG/M |
| 3300020581|Ga0210399_10959736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300020583|Ga0210401_10525881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300021046|Ga0215015_10391323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300021088|Ga0210404_10270213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300021168|Ga0210406_10987762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300021170|Ga0210400_10813833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300021180|Ga0210396_11639983 | Not Available | 524 | Open in IMG/M |
| 3300021403|Ga0210397_10583098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300021478|Ga0210402_10956269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300021479|Ga0210410_10037406 | All Organisms → cellular organisms → Bacteria | 4217 | Open in IMG/M |
| 3300021560|Ga0126371_13159506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300021560|Ga0126371_13378230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300024182|Ga0247669_1005818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2490 | Open in IMG/M |
| 3300024251|Ga0247679_1001617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3988 | Open in IMG/M |
| 3300024323|Ga0247666_1000138 | All Organisms → cellular organisms → Bacteria | 32077 | Open in IMG/M |
| 3300025898|Ga0207692_10211750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300025899|Ga0207642_10248225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300025938|Ga0207704_11077880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300026088|Ga0207641_10306991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300026298|Ga0209236_1202294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300026320|Ga0209131_1107430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300026324|Ga0209470_1176195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300026328|Ga0209802_1219504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300026341|Ga0257151_1031705 | Not Available | 566 | Open in IMG/M |
| 3300026496|Ga0257157_1040285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300026548|Ga0209161_10407485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300026551|Ga0209648_10102232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2346 | Open in IMG/M |
| 3300027381|Ga0208983_1037018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300027439|Ga0209332_1060225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300027535|Ga0209734_1013281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300027587|Ga0209220_1042125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300027629|Ga0209422_1010262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2306 | Open in IMG/M |
| 3300027655|Ga0209388_1041076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300027671|Ga0209588_1157333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300027698|Ga0209446_1132833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027765|Ga0209073_10478425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027795|Ga0209139_10316636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300027846|Ga0209180_10150140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300027846|Ga0209180_10642279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300027862|Ga0209701_10026216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3791 | Open in IMG/M |
| 3300027875|Ga0209283_10594289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300027894|Ga0209068_10154289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300027895|Ga0209624_10110374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300028047|Ga0209526_10240854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300028047|Ga0209526_10508098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300028146|Ga0247682_1004351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2486 | Open in IMG/M |
| 3300028536|Ga0137415_10034587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4961 | Open in IMG/M |
| 3300028776|Ga0302303_10137650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300028906|Ga0308309_11420323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300030730|Ga0307482_1139770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300030737|Ga0302310_10625632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031057|Ga0170834_108946131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300031233|Ga0302307_10019421 | All Organisms → cellular organisms → Bacteria | 3824 | Open in IMG/M |
| 3300031446|Ga0170820_16033140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031474|Ga0170818_102864470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300031543|Ga0318516_10724078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300031543|Ga0318516_10737461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031716|Ga0310813_10961523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300031718|Ga0307474_10800530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300031720|Ga0307469_10863379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300031753|Ga0307477_10813361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300031753|Ga0307477_10822095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031754|Ga0307475_10444605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300031764|Ga0318535_10460522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031777|Ga0318543_10454114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300031912|Ga0306921_10211154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2275 | Open in IMG/M |
| 3300031954|Ga0306926_11932945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300031962|Ga0307479_10367691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300031962|Ga0307479_11673132 | Not Available | 590 | Open in IMG/M |
| 3300032001|Ga0306922_10166496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2361 | Open in IMG/M |
| 3300032052|Ga0318506_10379162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300032174|Ga0307470_10034626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2441 | Open in IMG/M |
| 3300032174|Ga0307470_10642052 | Not Available | 800 | Open in IMG/M |
| 3300032205|Ga0307472_100912044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300032515|Ga0348332_13563773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300033486|Ga0316624_10221793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300033561|Ga0371490_1125658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_103515711 | 3300002914 | Grasslands Soil | KLALEAYQKFLDLDQDKNSDQIWQAQERSKVLRRMLERKR* |
| JGIcombinedJ51221_104398202 | 3300003505 | Forest Soil | PALEAYQKFLELNQDKNPDQVWQAEQRSKVLRRMLEQKR* |
| Ga0066674_101398421 | 3300005166 | Soil | LNQPKPALDAYQKFLELDQDKNPNQVWQAQERSKVLRRMLEGKK* |
| Ga0066388_1055298342 | 3300005332 | Tropical Forest Soil | VRALCYDKLQQTQAALDAFQKFLHSDQNRNADQVWQAQQRISVLKKVLEKR* |
| Ga0070710_106372302 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | CYDKLQQTKAALDAYGKFLEADQNRNPDQVWQAQQRISVLKKTLEKKR* |
| Ga0070699_1009215403 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DKLQQTKAALDAYEKFLQADQNQNSDQVWQAQQRIRVLKRMLEKKR* |
| Ga0070699_1018682131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DKLQQTKAALDAYEKFLQADQNQNSDQVWQAQQRIRVLKKMLEKKR* |
| Ga0070733_107143311 | 3300005541 | Surface Soil | YQKFLSMDENKNPDQIWQAKQRTQVLQHQLEAKRQ* |
| Ga0070733_107410871 | 3300005541 | Surface Soil | YQKFLEADQNRNPDQVWQAQQRIIVLKRILDNKK* |
| Ga0066661_103477963 | 3300005554 | Soil | ALEAYQKFLELDQDKNPDQVWQAKERSKLLQRMLERKR* |
| Ga0066693_103879121 | 3300005566 | Soil | KLALEAYQMFLALDQDKNPDQVWQARERSKVLQRMLERKR* |
| Ga0066702_105284041 | 3300005575 | Soil | ALDAYEKFLALDQGKNSDQVWQAQQRSKVLKHMLEEKR* |
| Ga0070762_106559111 | 3300005602 | Soil | QPKPALEAYEKFLELDQDKNPDQVWQAQQRSKVLRRMLDQKR* |
| Ga0070766_107831512 | 3300005921 | Soil | LEAYQKFLTMDENKNPDQVWQAQQRSAVLKHQLDAKGK* |
| Ga0066696_107787312 | 3300006032 | Soil | KLALEAYQKFLELDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0070765_1004445383 | 3300006176 | Soil | PKPALEAYQKFLELNQDKNPDQVWQAEQRSKVLRRMLEQKR* |
| Ga0075021_110400421 | 3300006354 | Watersheds | LKQTKLALEAYQKFLELDQYKNPDQVWQARERSKVLQRMLERKR* |
| Ga0066658_108377022 | 3300006794 | Soil | LEAYQKFLELDQDKNPDQVWQAKERSKLLQRMLERKR* |
| Ga0066665_102844644 | 3300006796 | Soil | EAYQKFLDLDQDKNSDQIWQAKERSKVLRRMLERKR* |
| Ga0079220_103325311 | 3300006806 | Agricultural Soil | KPALEAYQKFLELDQNKNPDQVWQAQERSKVLRRMLEGKK* |
| Ga0075426_1000302915 | 3300006903 | Populus Rhizosphere | ALCYDKLQQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR* |
| Ga0075424_1020299042 | 3300006904 | Populus Rhizosphere | LEAYQNFLAADQDRNPDQVWQAQQRIIVLKKALEKKK* |
| Ga0099791_103591672 | 3300007255 | Vadose Zone Soil | LDAYQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0099794_101107811 | 3300007265 | Vadose Zone Soil | LNQPKHALEAYQKFLELDQDKNPDQVWHAKERSKVLQRMLERKR* |
| Ga0099794_101553223 | 3300007265 | Vadose Zone Soil | PALEAYQKFLELDQDKNPDQVWQAQQRSKVLKRMLEQKR* |
| Ga0104322_1333794 | 3300007819 | Permafrost Soil | DKLNQPRPALEAYQKFLSLDQGQNADQVWQAQERSKVLRKVLEHKR* |
| Ga0066710_1036736622 | 3300009012 | Grasslands Soil | YDKLQQTKAALDAYEKFLEADQNRNPDQVWQAQQRIIVLKKALE |
| Ga0066710_1040792721 | 3300009012 | Grasslands Soil | YDKLQQTKAALDAYEKFLEADQNRNPDQVWQAQQRIIVLKKTLEKRK |
| Ga0099829_105018053 | 3300009038 | Vadose Zone Soil | ICYDKLNQPKLALEAYQKFLELDQDKNPDQVWQSKERSKVLQRMLERKR* |
| Ga0099829_106596213 | 3300009038 | Vadose Zone Soil | YQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0099830_107719103 | 3300009088 | Vadose Zone Soil | KLQQTKAALDAYQNFLQADQNRNSDQVWQAQQRMIVLKKTLDKKR* |
| Ga0099828_102108461 | 3300009089 | Vadose Zone Soil | PALAAYDKFLALEQGKTSDQIWQAQQRSKVLRHMLEEKR* |
| Ga0099792_100894424 | 3300009143 | Vadose Zone Soil | YDKLNQPKLALGAYQKFLELDQDKNPDQVWQAQQRSKVLKRMLEQKR* |
| Ga0075423_111777773 | 3300009162 | Populus Rhizosphere | AYQNFLAADQDRNPDQVWQAQQRIIVLKKTLEKKR* |
| Ga0105855_12479401 | 3300009649 | Permafrost Soil | DKLNQPQPALDAYQMFLSLDQGQNADQVWQAQERSKVLRKVLEHKR* |
| Ga0126374_108918312 | 3300009792 | Tropical Forest Soil | EAYQNFLAADQDRNPDQVWQAQQRIIVLKKTLEKKK* |
| Ga0126384_101069104 | 3300010046 | Tropical Forest Soil | ALEAYQNFLGADQDRNPDQVWQAQQRIIVLKKTLEKKR* |
| Ga0134071_101819273 | 3300010336 | Grasslands Soil | YQKFLDLDQDKNSDQTWQAKERSKVLRRMLERKR* |
| Ga0134071_104282432 | 3300010336 | Grasslands Soil | EAYQKFLELDQDKNPDQVWQAQQRSKVLKRMLEQKR* |
| Ga0074044_102596731 | 3300010343 | Bog Forest Soil | CYDNLNQFQPALEAYQKFLDLDKDKNPDQVWQAQQRSKVLRRKLEEKR* |
| Ga0074044_104850521 | 3300010343 | Bog Forest Soil | LEAYEKFLELDQDKNPDQVWQAQQRSKILRRMLDQKR* |
| Ga0126370_126172672 | 3300010358 | Tropical Forest Soil | ALEAYQKFLELDQNKNADQVWQAQERSKVLRRMLEGKK* |
| Ga0126376_107911561 | 3300010359 | Tropical Forest Soil | QTQPALDAYQKFLDLDQDKNPDQVWQAQQRSIVLKKALEKKR* |
| Ga0126379_100850166 | 3300010366 | Tropical Forest Soil | YDKLQHAGPALDAYQKFLELDQDKNPDQVWQAQQRIIVLKKVLEKKR* |
| Ga0126381_1018185141 | 3300010376 | Tropical Forest Soil | AALEAYQNFLAADQDRDPDQVWQAQQRIIVLKKTLEKKR* |
| Ga0126383_115164791 | 3300010398 | Tropical Forest Soil | LEAYQKFLELDQNKNPDQVWQAQERSKVLRRKLEGKK* |
| Ga0150983_135434852 | 3300011120 | Forest Soil | LALEAYQKFLELDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0150983_149841251 | 3300011120 | Forest Soil | ALEAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEARR* |
| Ga0137392_106231203 | 3300011269 | Vadose Zone Soil | LDAYQKFLALDQDKNPDQVWQAKERSKVLQRVLGRKR* |
| Ga0137391_104090833 | 3300011270 | Vadose Zone Soil | PKLALEAYQKFLDLDQDKNPDQVWQAKERSKVLQRMLERRR* |
| Ga0137389_111714401 | 3300012096 | Vadose Zone Soil | ALDAYQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137363_100870215 | 3300012202 | Vadose Zone Soil | SYEKFLALQQGKTSDQVWQAQQRSKVLKHMLEEKR* |
| Ga0137363_116685561 | 3300012202 | Vadose Zone Soil | LALDAYQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137399_108105443 | 3300012203 | Vadose Zone Soil | ALEAYQKFLDLDQDKNPDQVWQAQQRSKVLKRMLEQKR* |
| Ga0137362_100239321 | 3300012205 | Vadose Zone Soil | LEAYQKFLELGQDKNPDQIWQAKERSKVLQHMLERKR* |
| Ga0137362_104067553 | 3300012205 | Vadose Zone Soil | YDKLQQTKAALDAYQKFLDADQNRNSDQVWQAQQRIRVLKKILEKKR* |
| Ga0137362_109481473 | 3300012205 | Vadose Zone Soil | YEKFLGADQNRNPDQVWQAQQRIIVLKKTLEKRK* |
| Ga0137381_100777901 | 3300012207 | Vadose Zone Soil | ICYDKLNQPKLALEAYQKFLELDQDKNSDQVWQAKERSKVLQRMLERKR* |
| Ga0137381_109954882 | 3300012207 | Vadose Zone Soil | QQTKAALDAYEKFLGADQNRNPDQVWQAQQRIIVLKRTLEKRK* |
| Ga0137387_110933411 | 3300012349 | Vadose Zone Soil | QQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR* |
| Ga0137386_101551464 | 3300012351 | Vadose Zone Soil | YQKFLELDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137360_112224801 | 3300012361 | Vadose Zone Soil | HQPKPALEAYQKFLDLDQDKNPDQVWQAKGRSKTLQHMLERKR* |
| Ga0137361_100062681 | 3300012362 | Vadose Zone Soil | PALEAYDKFLALEQGRTSDQVWQAQQRSKVLKHMLEGKR* |
| Ga0137361_102605354 | 3300012362 | Vadose Zone Soil | DAYQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137398_101085351 | 3300012683 | Vadose Zone Soil | AYQKFLALDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137398_102019554 | 3300012683 | Vadose Zone Soil | KLNQPKLALDAYQKFLALDRDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137398_103466381 | 3300012683 | Vadose Zone Soil | AYDKFLALEQGKTSDQIWQAQQRSKVLRHMLEEKR* |
| Ga0137395_102741663 | 3300012917 | Vadose Zone Soil | RPALDAYDKFLALEKRKSSDQVWQAQQRSKVLKHMLEAKR* |
| Ga0137396_102933943 | 3300012918 | Vadose Zone Soil | DKLNQPKLALEAYQKFLELDQDKNPDQVWQAKERSKVLQRVLGRKR* |
| Ga0137359_111445121 | 3300012923 | Vadose Zone Soil | NLNQPKSALEAYQKFLGLDQDKNPDQVWQAKERSKVLQRMLERKR* |
| Ga0137413_102596933 | 3300012924 | Vadose Zone Soil | LCYDKLRQFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKR* |
| Ga0137419_110049631 | 3300012925 | Vadose Zone Soil | QPKVALENYQKFLDADKNGNPDQVWQAQQRIKALKLILEHKR* |
| Ga0137407_123958101 | 3300012930 | Vadose Zone Soil | GYQKFLDADQNRNSDQVWQAQQRIRVLKKILEKKR* |
| Ga0137410_115712221 | 3300012944 | Vadose Zone Soil | QFKPALEAYDKFLALEQGKASDQVWQAQQRSKVLKHMLEGKR* |
| Ga0134081_101319091 | 3300014150 | Grasslands Soil | LNQPKLALEAYQKFLALDQDKNLDQVWQARERSKVLQRMLERKR* |
| Ga0134075_102995511 | 3300014154 | Grasslands Soil | PALEAYQKFLELDQNRNLDQVWQAQERSKVLRRMLEGKK* |
| Ga0157379_114668341 | 3300014968 | Switchgrass Rhizosphere | LEAYQKFLDLDAGKNPDQIWQAQQRSKVLKHQLEEKRPSR* |
| Ga0157376_113080212 | 3300014969 | Miscanthus Rhizosphere | ALCYDKLQQTKAALEAYQNFLVADQNRNPDQVWQAQQRIIVLKKTLEKKR* |
| Ga0137414_10907661 | 3300015051 | Vadose Zone Soil | KLQQTQLALQAYQKFLVEADQNRNADQVWQAQQRIIVLKKILDKKR* |
| Ga0137405_11841431 | 3300015053 | Vadose Zone Soil | PAKACVAGLPEYQKFLELDLDKNPDQVWQAQQRSKVLKRMLEQKR* |
| Ga0137420_10425893 | 3300015054 | Vadose Zone Soil | YDKLRQFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKR* |
| Ga0137403_101651554 | 3300015264 | Vadose Zone Soil | YEKFLEADQNRNPDQVWQAQQRIIVLKKTLEKRK* |
| Ga0187818_104923011 | 3300017823 | Freshwater Sediment | AYEKFLELDQDKNPDQVWQAQQRSKVLRRMLEQKR |
| Ga0187820_100020314 | 3300017924 | Freshwater Sediment | EAYQKFLELDQDKNPDQVWQAQQRSKVLKRMLGQDR |
| Ga0187819_103132181 | 3300017943 | Freshwater Sediment | ALAAYEQYLELEKDQNSDQVWQAQQRAKLLRRMLQK |
| Ga0066669_103902781 | 3300018482 | Grasslands Soil | PALDAYQKFLELDQDKNPNQVWQAQERSKVLRRMLEGKK |
| Ga0137408_14124672 | 3300019789 | Vadose Zone Soil | ALDAYQKFLELDRDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0179594_102254602 | 3300020170 | Vadose Zone Soil | QFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKR |
| Ga0210407_100911211 | 3300020579 | Soil | QPKPALEAYEKFLELDQDRNPDQVWQAQQRSKVLRRMVDQKR |
| Ga0210403_100562416 | 3300020580 | Soil | CYDKLQQTKAALDAYQKFLEADQNRNADQVWQAQQRIIVLKKTLDKKR |
| Ga0210403_100651086 | 3300020580 | Soil | LEAYQKFLGLDQDKNPDQVWQANERSKVLQRMLERKR |
| Ga0210399_109597362 | 3300020581 | Soil | LNQPKPALEAYQKFLDMDQNKNPDQVWQATERSKVLKRMLEKR |
| Ga0210401_105258813 | 3300020583 | Soil | ALEAYEKFLELDQDRNPDQVWQAQQRSKVLRRMLDQKR |
| Ga0215015_103913233 | 3300021046 | Soil | FDAYQKYLELAPDKNSDQVWQAQQRSKVLRRLLDPKR |
| Ga0210404_102702133 | 3300021088 | Soil | LALEAYQKFLALDQDRNPDQVWQAKERSKVLQRMLERKR |
| Ga0210406_109877622 | 3300021168 | Soil | PALEAYQKFLEMDQNKNPDQVWQATERSKVLKRMVEKR |
| Ga0210400_108138333 | 3300021170 | Soil | EAYQKFLELDQDKNPDQVWQAKERSKVLQRMLERKR |
| Ga0210396_116399831 | 3300021180 | Soil | YQKFLTMDEGKNPDQIWQAQQRSAVLKHQLEAKGK |
| Ga0210397_105830982 | 3300021403 | Soil | IKPALEAYQKFLSMDENKNPDQVWQAKQRTQVLQHQLEAKRQ |
| Ga0210402_109562693 | 3300021478 | Soil | AIEAYQKFLDFDKDKNPDQVWQATERIKVLQHMLERKR |
| Ga0210410_100374061 | 3300021479 | Soil | LEAYQKFLTMDEGKNPDQVWQAQQRSAVLKHQLEAKGK |
| Ga0126371_131595062 | 3300021560 | Tropical Forest Soil | QQTKPALEAYQKFLEADQNRNPDQVWQAQQRIIVLKKMLENKK |
| Ga0126371_133782302 | 3300021560 | Tropical Forest Soil | NQPKPALEAYQKFLELDQNKNPDQVWQAGERSKVLRRMLEGKK |
| Ga0247669_10058185 | 3300024182 | Soil | PALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0247679_10016171 | 3300024251 | Soil | DKLQQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0247666_10001381 | 3300024323 | Soil | LCYDKLQQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0207692_102117501 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | CYDKLQQTKAALDAYGKFLEADQNRNPDQVWQAQQRISVLKKTLEKKR |
| Ga0207642_102482253 | 3300025899 | Miscanthus Rhizosphere | LQQTKAALEAYQNFLAADQNRNPDQVWQAQQRIIVLKKTLEKKR |
| Ga0207704_110778801 | 3300025938 | Miscanthus Rhizosphere | LCYDKLQQTKAALEAYQNFLAADQNRNPDQVWQAQQRIIVLKKTLEKKR |
| Ga0207641_103069911 | 3300026088 | Switchgrass Rhizosphere | CYDKLQQIKAALEAYQNFLAADQGRNPDQVWQAQQRIIVLKKMLERKR |
| Ga0209236_12022941 | 3300026298 | Grasslands Soil | LQAYQKFLELDQDKNPDQIWQAKERSKVLQRMLERKR |
| Ga0209131_11074302 | 3300026320 | Grasslands Soil | LQQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLERKR |
| Ga0209470_11761951 | 3300026324 | Soil | LEAYQKFLDLDQNKHPDQVWQAQERSKVLRRMLEGKK |
| Ga0209802_12195041 | 3300026328 | Soil | KLALEAYQMFLALDQDKNPDQVWQARERSKVLQRMLERKR |
| Ga0257151_10317052 | 3300026341 | Soil | YDKLHQFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKR |
| Ga0257157_10402853 | 3300026496 | Soil | ALEAYQKFLELDQDKNPDQVWQAKERSKVLQRMLERKR |
| Ga0209161_104074852 | 3300026548 | Soil | LQQTQPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0209648_101022321 | 3300026551 | Grasslands Soil | ALEAYQKFLDLDQDKNPDQVWQAKERSKVLQHMLERKR |
| Ga0208983_10370183 | 3300027381 | Forest Soil | CYDKLHQFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKK |
| Ga0209332_10602252 | 3300027439 | Forest Soil | KPALEAYQKFLSLDQGQNADQEWQARERSKVLRKVLEHKR |
| Ga0209734_10132811 | 3300027535 | Forest Soil | RPALDAYGQFLALEQGKSSDQVWQAQERSKVLKHMLEGKK |
| Ga0209220_10421251 | 3300027587 | Forest Soil | NQPKLALEAYQKFLELDQDKNPDQVWQAKERGKVLQRMLERKR |
| Ga0209422_10102621 | 3300027629 | Forest Soil | ALEAYQKFLSLDQGQNADQEWQAQERSKVLRKVLEHKR |
| Ga0209388_10410763 | 3300027655 | Vadose Zone Soil | QFKPALESYEKFLALQQGKTSDQVWQAQQRSKVLKHMLEEKR |
| Ga0209588_11573332 | 3300027671 | Vadose Zone Soil | KLNQPKLALEAYQKFLGLDQDKNPDQVWQARERSKVLQRMLERKR |
| Ga0209446_11328332 | 3300027698 | Bog Forest Soil | AYEKFLELDQDKNPDQVWQAQQRSKVLRRMLDQKR |
| Ga0209073_104784251 | 3300027765 | Agricultural Soil | EAYQKFLELDQDKNPDQVWQAQERSKVLRRMLEGKK |
| Ga0209139_103166362 | 3300027795 | Bog Forest Soil | LEAYQKFLELDKDRNPDQVWQAQQRSKALRRKLEEKR |
| Ga0209180_101501404 | 3300027846 | Vadose Zone Soil | LEAYEKFLGLDQDKNPDQVWQAKERSKVLQRMLERKR |
| Ga0209180_106422792 | 3300027846 | Vadose Zone Soil | LALEAYQKFLELDQDKNPDQVWQSKERSKVLQRMLERKR |
| Ga0209701_100262161 | 3300027862 | Vadose Zone Soil | KLNQPKPALEAYQKFLDLEQDKNSDQFWQAQQRSKALRRMLERKR |
| Ga0209283_105942892 | 3300027875 | Vadose Zone Soil | PKPALEAYQKFLELDQNKNPDQVWQAQERSKVLRRMLEGKK |
| Ga0209068_101542894 | 3300027894 | Watersheds | KLKQTKLALEAYQKFLELDQYKNPDQVWQARERSKVLQRMLERKR |
| Ga0209624_101103741 | 3300027895 | Forest Soil | ALEAYQKFLTMDENKNPDQVWQAQQRSAVLKHQLDAKGK |
| Ga0209526_102408541 | 3300028047 | Forest Soil | ALEAYEKFLRLTPDKNTDQVWQATERSKVLRRMLGSK |
| Ga0209526_105080983 | 3300028047 | Forest Soil | PALEAYDKFLALEQGKTSDQVWQAQQRSKVLRRMLDQKR |
| Ga0247682_10043511 | 3300028146 | Soil | QPALDAYQKFLELDQDKNPDQVWQAQQRSIVLKKVLEKKR |
| Ga0137415_100345871 | 3300028536 | Vadose Zone Soil | NQPKLALEAYQKFLELDQDKNPDQIWQAKERSKVLQRMLERKR |
| Ga0302303_101376503 | 3300028776 | Palsa | LVHPALDAYQKFLDMDQGKNPDQVWQAQQRSKVLKDMLDHKR |
| Ga0308309_114203232 | 3300028906 | Soil | PKPALEAYEKFLELDRDKNPDQVWQAQQRSKVLRRMLDQKR |
| Ga0307482_11397701 | 3300030730 | Hardwood Forest Soil | EPKPALDAYQKFLELDQDKNPDQVWQAKERSKVLQRMLDRKR |
| Ga0302310_106256321 | 3300030737 | Palsa | AAYQTFLARTTDKNTDQVWQATERSKVLKRMLGQQK |
| Ga0170834_1089461311 | 3300031057 | Forest Soil | KAALDAYQKFLDADQNRNSDQVWQAQQRIRVLKKTLEKKR |
| Ga0302307_100194216 | 3300031233 | Palsa | AYQKFLDMDQGKNPDQVWQAQQRSKVLKDMLDHKR |
| Ga0170820_160331402 | 3300031446 | Forest Soil | AYQKFLSMDENKNPDQIWQAKQRTQVLQHQLEAKRQ |
| Ga0170818_1028644701 | 3300031474 | Forest Soil | ALCYDKLNQPRPALEAYQKFLSLDQGQNADQVWQAQERSKVLRKVLEHKR |
| Ga0318516_107240782 | 3300031543 | Soil | PKPALDAYQKFLELDQNKNPNQVWQAQERSKVLRRMLEGKK |
| Ga0318516_107374611 | 3300031543 | Soil | TKPALDAYQKFLEADQNRNPDQVWQAQQRIIVLKKRLDNKK |
| Ga0310813_109615231 | 3300031716 | Soil | LAAYEKFLDLEKEQDSDQVWQAQQRAKLLRRMLEK |
| Ga0307474_108005302 | 3300031718 | Hardwood Forest Soil | PALEAYQKFLTMDEGKNPDQIWQAQQRSAVLKHQLEAKGK |
| Ga0307469_108633791 | 3300031720 | Hardwood Forest Soil | YDKLRQFKPALAAYDKFLALEQGKTSDQVWQAQQRSKVLRHMLEEKR |
| Ga0307477_108133611 | 3300031753 | Hardwood Forest Soil | KPALEAYQKFLEADQNRNPDQVWQAQQRIIVLKRILDNKK |
| Ga0307477_108220952 | 3300031753 | Hardwood Forest Soil | ALCYDKLHQFKPALEAYGKFLALEQGKTSDQVWQAQERSKVLKHLLEGNR |
| Ga0307475_104446053 | 3300031754 | Hardwood Forest Soil | KPALEAYGKFLALEQGKTSDQVWQAQERSKVLKHLLEGNR |
| Ga0318535_104605221 | 3300031764 | Soil | QTKAALEAYQNFLAADQERNPDQVWQAQQRVIVLKKAFEKKK |
| Ga0318543_104541141 | 3300031777 | Soil | LDAYQKFLELDQNKNPNQVWQAQERSKVLRRMLEGKK |
| Ga0306921_102111541 | 3300031912 | Soil | ALDAYQKFLEADQNRNPDQVWQAQQRIIVLKKRLDNKK |
| Ga0306926_119329452 | 3300031954 | Soil | PALEAYQKFLEADQNRNPDQVWQAQQRIIVLKKRLDNKK |
| Ga0307479_103676914 | 3300031962 | Hardwood Forest Soil | PALAAYEKFLELDQDKNPDQVWQAQQRSKVLRRMLDQKR |
| Ga0307479_116731321 | 3300031962 | Hardwood Forest Soil | QVQPAFDAYQKFLELAPDKKSDQVWQAEQRTKVLRRILDQKR |
| Ga0306922_101664965 | 3300032001 | Soil | NQPKPALDAYQKFLELDQNKNPNQVWQAQERSKVLRRALEGKK |
| Ga0318506_103791622 | 3300032052 | Soil | PALDAYQKFLELDQNKNPNQVWQAQERSKVLRRMLEGKK |
| Ga0307470_100346265 | 3300032174 | Hardwood Forest Soil | EAYDKFLALEQGKTSDQVWQAQQRSKVLKHMLEGKR |
| Ga0307470_106420521 | 3300032174 | Hardwood Forest Soil | FKPALEAYDRFLAMEQGKTSDQVWQAQQRTKVLKHMLEEKR |
| Ga0307472_1009120441 | 3300032205 | Hardwood Forest Soil | KAALAAYQKFLEADQNRNADQVWQAQQRIIVLKKTLDKKR |
| Ga0348332_135637731 | 3300032515 | Plant Litter | PALEAYEKFLELDQDQNPNQVWQAQQRSKVLRRMLDQKR |
| Ga0316624_102217934 | 3300033486 | Soil | NQPKLALEAYQKFLELDEGKNADQVWQAQQRSKVLRRMLDQKR |
| Ga0371490_11256581 | 3300033561 | Peat Soil | PALEAYQRFLSMSQGKSPNQEWQAGERSKILKRELEKK |
| ⦗Top⦘ |