


| Basic Information | |
|---|---|
| Family ID | F037279 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDEALEDLK |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.09 % |
| % of genes near scaffold ends (potentially truncated) | 89.29 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (22.024 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 2.38 |
| PF02775 | TPP_enzyme_C | 1.79 |
| PF01425 | Amidase | 1.79 |
| PF04392 | ABC_sub_bind | 1.19 |
| PF05016 | ParE_toxin | 1.19 |
| PF00211 | Guanylate_cyc | 1.19 |
| PF01850 | PIN | 1.19 |
| PF00296 | Bac_luciferase | 1.19 |
| PF11716 | MDMPI_N | 1.19 |
| PF03972 | MmgE_PrpD | 1.19 |
| PF08530 | PepX_C | 1.19 |
| PF01408 | GFO_IDH_MocA | 0.60 |
| PF13551 | HTH_29 | 0.60 |
| PF00239 | Resolvase | 0.60 |
| PF12773 | DZR | 0.60 |
| PF03869 | Arc | 0.60 |
| PF08883 | DOPA_dioxygen | 0.60 |
| PF14269 | Arylsulfotran_2 | 0.60 |
| PF01526 | DDE_Tnp_Tn3 | 0.60 |
| PF13424 | TPR_12 | 0.60 |
| PF01610 | DDE_Tnp_ISL3 | 0.60 |
| PF13649 | Methyltransf_25 | 0.60 |
| PF10728 | DUF2520 | 0.60 |
| PF08241 | Methyltransf_11 | 0.60 |
| PF12974 | Phosphonate-bd | 0.60 |
| PF07690 | MFS_1 | 0.60 |
| PF03400 | DDE_Tnp_IS1 | 0.60 |
| PF13378 | MR_MLE_C | 0.60 |
| PF05685 | Uma2 | 0.60 |
| PF10294 | Methyltransf_16 | 0.60 |
| PF03061 | 4HBT | 0.60 |
| PF13191 | AAA_16 | 0.60 |
| PF13561 | adh_short_C2 | 0.60 |
| PF13359 | DDE_Tnp_4 | 0.60 |
| PF00078 | RVT_1 | 0.60 |
| PF04879 | Molybdop_Fe4S4 | 0.60 |
| PF00383 | dCMP_cyt_deam_1 | 0.60 |
| PF13586 | DDE_Tnp_1_2 | 0.60 |
| PF03649 | UPF0014 | 0.60 |
| PF02036 | SCP2 | 0.60 |
| PF13565 | HTH_32 | 0.60 |
| PF01494 | FAD_binding_3 | 0.60 |
| PF02371 | Transposase_20 | 0.60 |
| PF09962 | DUF2196 | 0.60 |
| PF01717 | Meth_synt_2 | 0.60 |
| PF03476 | MOSC_N | 0.60 |
| PF00589 | Phage_integrase | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.19 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.19 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.19 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.19 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 1.19 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.19 |
| COG0390 | ABC-type iron transport system FetAB, permease component | Inorganic ion transport and metabolism [P] | 0.60 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.60 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.60 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.60 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.60 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.60 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.60 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.60 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.60 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.60 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.43 % |
| Unclassified | root | N/A | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0337908 | Not Available | 647 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10493413 | Not Available | 647 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101994664 | Not Available | 547 | Open in IMG/M |
| 3300000550|F24TB_10825672 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300000955|JGI1027J12803_101982780 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300001431|F14TB_102335280 | Not Available | 583 | Open in IMG/M |
| 3300005332|Ga0066388_101051352 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300005332|Ga0066388_102167894 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005471|Ga0070698_101779012 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 569 | Open in IMG/M |
| 3300005552|Ga0066701_10677636 | Not Available | 621 | Open in IMG/M |
| 3300005554|Ga0066661_10909407 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005558|Ga0066698_11054607 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005713|Ga0066905_101203423 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005713|Ga0066905_101580351 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005719|Ga0068861_100393576 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300005764|Ga0066903_100164558 | All Organisms → cellular organisms → Bacteria | 3226 | Open in IMG/M |
| 3300005764|Ga0066903_104026181 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005937|Ga0081455_10546572 | Not Available | 767 | Open in IMG/M |
| 3300006049|Ga0075417_10258043 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006196|Ga0075422_10265446 | Not Available | 726 | Open in IMG/M |
| 3300006844|Ga0075428_100036254 | All Organisms → cellular organisms → Bacteria | 5433 | Open in IMG/M |
| 3300006844|Ga0075428_101040934 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006844|Ga0075428_101165004 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006844|Ga0075428_102578711 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 520 | Open in IMG/M |
| 3300006845|Ga0075421_100738918 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300006846|Ga0075430_100573159 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006846|Ga0075430_101293366 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006846|Ga0075430_101619600 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006846|Ga0075430_101670873 | Not Available | 523 | Open in IMG/M |
| 3300006847|Ga0075431_101106434 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006853|Ga0075420_101114164 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006871|Ga0075434_100395050 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300006880|Ga0075429_100139893 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300006880|Ga0075429_100843036 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300006880|Ga0075429_100986137 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006880|Ga0075429_101156078 | Not Available | 676 | Open in IMG/M |
| 3300006904|Ga0075424_100553339 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300007255|Ga0099791_10647298 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 518 | Open in IMG/M |
| 3300007258|Ga0099793_10651408 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 530 | Open in IMG/M |
| 3300009012|Ga0066710_104112112 | Not Available | 544 | Open in IMG/M |
| 3300009038|Ga0099829_11399966 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009089|Ga0099828_11189791 | Not Available | 676 | Open in IMG/M |
| 3300009090|Ga0099827_11874167 | Not Available | 523 | Open in IMG/M |
| 3300009094|Ga0111539_10028431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6820 | Open in IMG/M |
| 3300009094|Ga0111539_10061897 | All Organisms → cellular organisms → Bacteria | 4433 | Open in IMG/M |
| 3300009094|Ga0111539_11460179 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 793 | Open in IMG/M |
| 3300009094|Ga0111539_11591349 | Not Available | 758 | Open in IMG/M |
| 3300009100|Ga0075418_10159734 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300009100|Ga0075418_11488504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300009100|Ga0075418_13160199 | Not Available | 501 | Open in IMG/M |
| 3300009143|Ga0099792_10614586 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009147|Ga0114129_10036905 | All Organisms → cellular organisms → Bacteria | 6899 | Open in IMG/M |
| 3300009147|Ga0114129_11151960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300009147|Ga0114129_11402722 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300009147|Ga0114129_11656112 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009147|Ga0114129_13422006 | Not Available | 510 | Open in IMG/M |
| 3300009156|Ga0111538_10154365 | Not Available | 2916 | Open in IMG/M |
| 3300009173|Ga0114996_10746797 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009444|Ga0114945_10478327 | Not Available | 748 | Open in IMG/M |
| 3300009553|Ga0105249_11748235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300009610|Ga0105340_1305480 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010041|Ga0126312_10069464 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 2373 | Open in IMG/M |
| 3300010043|Ga0126380_10310153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 1128 | Open in IMG/M |
| 3300010043|Ga0126380_10661867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 833 | Open in IMG/M |
| 3300010043|Ga0126380_10851004 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300010043|Ga0126380_11916899 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 539 | Open in IMG/M |
| 3300010046|Ga0126384_10544881 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010047|Ga0126382_10442468 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium | 1028 | Open in IMG/M |
| 3300010145|Ga0126321_1068325 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1370 | Open in IMG/M |
| 3300010360|Ga0126372_12552075 | Not Available | 562 | Open in IMG/M |
| 3300010360|Ga0126372_12752101 | Not Available | 544 | Open in IMG/M |
| 3300010362|Ga0126377_10183091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1995 | Open in IMG/M |
| 3300010362|Ga0126377_10968093 | Not Available | 916 | Open in IMG/M |
| 3300010362|Ga0126377_12518381 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 590 | Open in IMG/M |
| 3300010362|Ga0126377_13541072 | Not Available | 505 | Open in IMG/M |
| 3300010366|Ga0126379_11699985 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 736 | Open in IMG/M |
| 3300010366|Ga0126379_12358254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria | 632 | Open in IMG/M |
| 3300010398|Ga0126383_10243412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena → Moorena bouillonii | 1759 | Open in IMG/M |
| 3300010398|Ga0126383_11926033 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 679 | Open in IMG/M |
| 3300010398|Ga0126383_12957872 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010398|Ga0126383_13632028 | Not Available | 504 | Open in IMG/M |
| 3300011270|Ga0137391_10568774 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300012022|Ga0120191_10122954 | Not Available | 564 | Open in IMG/M |
| 3300012199|Ga0137383_10426054 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 972 | Open in IMG/M |
| 3300012206|Ga0137380_10339974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300012206|Ga0137380_10609840 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300012209|Ga0137379_10441417 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012349|Ga0137387_10493184 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012359|Ga0137385_10641716 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012359|Ga0137385_10827823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 768 | Open in IMG/M |
| 3300012360|Ga0137375_10796126 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 761 | Open in IMG/M |
| 3300012362|Ga0137361_11387566 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 626 | Open in IMG/M |
| 3300012362|Ga0137361_11943064 | Not Available | 505 | Open in IMG/M |
| 3300012363|Ga0137390_10207062 | Not Available | 1949 | Open in IMG/M |
| 3300012363|Ga0137390_10557000 | Not Available | 1117 | Open in IMG/M |
| 3300012685|Ga0137397_10825924 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 687 | Open in IMG/M |
| 3300012923|Ga0137359_11566660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012927|Ga0137416_11379307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300012929|Ga0137404_10182226 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300012929|Ga0137404_10597873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 992 | Open in IMG/M |
| 3300012930|Ga0137407_10234230 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300012948|Ga0126375_10391003 | Not Available | 1002 | Open in IMG/M |
| 3300012948|Ga0126375_10491977 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012948|Ga0126375_11329473 | Not Available | 605 | Open in IMG/M |
| 3300012948|Ga0126375_11808264 | Not Available | 533 | Open in IMG/M |
| 3300012971|Ga0126369_10875290 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012971|Ga0126369_11295969 | Not Available | 818 | Open in IMG/M |
| 3300012971|Ga0126369_12198798 | Not Available | 639 | Open in IMG/M |
| 3300013306|Ga0163162_11131681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300013306|Ga0163162_13437798 | Not Available | 505 | Open in IMG/M |
| 3300015371|Ga0132258_13670402 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1048 | Open in IMG/M |
| 3300015372|Ga0132256_102092764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300016270|Ga0182036_11057398 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 671 | Open in IMG/M |
| 3300016270|Ga0182036_11631849 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300016371|Ga0182034_10419685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 | 1101 | Open in IMG/M |
| 3300016371|Ga0182034_12088068 | Not Available | 500 | Open in IMG/M |
| 3300016445|Ga0182038_11591535 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300016445|Ga0182038_11691909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 570 | Open in IMG/M |
| 3300018078|Ga0184612_10445505 | Not Available | 645 | Open in IMG/M |
| 3300018079|Ga0184627_10021842 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300018433|Ga0066667_11359492 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 622 | Open in IMG/M |
| 3300018468|Ga0066662_11626530 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 674 | Open in IMG/M |
| 3300022563|Ga0212128_10158109 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300025157|Ga0209399_10117877 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300025910|Ga0207684_10293070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300025910|Ga0207684_11359751 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300025961|Ga0207712_10310673 | Not Available | 1297 | Open in IMG/M |
| 3300026116|Ga0207674_11049667 | Not Available | 784 | Open in IMG/M |
| 3300026310|Ga0209239_1353988 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 514 | Open in IMG/M |
| 3300026358|Ga0257166_1056019 | Not Available | 565 | Open in IMG/M |
| 3300026497|Ga0257164_1058122 | Not Available | 629 | Open in IMG/M |
| 3300027748|Ga0209689_1215346 | Not Available | 827 | Open in IMG/M |
| 3300027846|Ga0209180_10631240 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 589 | Open in IMG/M |
| 3300027873|Ga0209814_10574310 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027874|Ga0209465_10285217 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027880|Ga0209481_10343794 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300027882|Ga0209590_10526167 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 763 | Open in IMG/M |
| 3300027882|Ga0209590_10682555 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027882|Ga0209590_10749090 | Not Available | 623 | Open in IMG/M |
| 3300027907|Ga0207428_10482721 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300027909|Ga0209382_10627411 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300030006|Ga0299907_10964755 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031740|Ga0307468_101895409 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 568 | Open in IMG/M |
| 3300031820|Ga0307473_10509660 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 814 | Open in IMG/M |
| 3300031908|Ga0310900_11482615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 572 | Open in IMG/M |
| 3300031942|Ga0310916_10655389 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 890 | Open in IMG/M |
| 3300031942|Ga0310916_11416265 | Not Available | 569 | Open in IMG/M |
| 3300031944|Ga0310884_10378480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300031954|Ga0306926_11428430 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032017|Ga0310899_10726322 | Not Available | 506 | Open in IMG/M |
| 3300032025|Ga0318507_10493772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
| 3300032055|Ga0318575_10309842 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032075|Ga0310890_10939049 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300032091|Ga0318577_10349343 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 707 | Open in IMG/M |
| 3300032122|Ga0310895_10784159 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 501 | Open in IMG/M |
| 3300032126|Ga0307415_101136007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2 | 733 | Open in IMG/M |
| 3300033551|Ga0247830_10173685 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1592 | Open in IMG/M |
| 3300033551|Ga0247830_10292277 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1246 | Open in IMG/M |
| 3300033813|Ga0364928_0017534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300034667|Ga0314792_193581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300034672|Ga0314797_126971 | Not Available | 547 | Open in IMG/M |
| 3300034678|Ga0314803_144198 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300034681|Ga0370546_077321 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 22.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.60% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.60% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_03379081 | 3300000033 | Soil | MDFVTVVDQAIALXRQRGRLTYRTLQLQFQLDEVSLEALKDELV |
| ICChiseqgaiiFebDRAFT_104934131 | 3300000363 | Soil | MDFVTVVDQAIALXRQRGRLTYRTLQLQFQLDEVSLEALKDELVY |
| INPhiseqgaiiFebDRAFT_1019946642 | 3300000364 | Soil | MDFVAVLDEVIALLRQRGRVAYRTLKVQFHLDAAALEALW* |
| F24TB_108256722 | 3300000550 | Soil | VDFVAVLDQVIALLHQRGRLTYRTLKRQFELDDAALEDLK |
| JGI1027J12803_1019827802 | 3300000955 | Soil | VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEALD |
| F14TB_1023352801 | 3300001431 | Soil | MDFVALVDQVFALLRQRGRVTYRTLQRQFQLDADA |
| Ga0066388_1010513523 | 3300005332 | Tropical Forest Soil | VDFVAVMDQVIVLLRQRGRLTYRTLQRQFQLDDAALDDLK |
| Ga0066388_1021678943 | 3300005332 | Tropical Forest Soil | MDFVAVLDQVIALLRQRGRLTYSTLKRQFQLDDAALEDVK |
| Ga0070698_1017790121 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFVAVLDQVIALLRQRGRLTYRTLQRQFQLDDAALDDLKDE |
| Ga0066701_106776361 | 3300005552 | Soil | MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDA |
| Ga0066661_109094071 | 3300005554 | Soil | VDFVAVVDQALALLRQRGRVTYRTLQIQFALDDPQ |
| Ga0066698_110546072 | 3300005558 | Soil | VDFVAVVDQAIALLRQRGCLTYRTLQLQFQLDDAHL |
| Ga0066905_1012034232 | 3300005713 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDV |
| Ga0066905_1015803511 | 3300005713 | Tropical Forest Soil | MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDAHL |
| Ga0068861_1003935761 | 3300005719 | Switchgrass Rhizosphere | MDFVAVVDQVITLLRQRGRVTYRTLQRQFQLDEEALADLLAELR |
| Ga0066903_1001645583 | 3300005764 | Tropical Forest Soil | MDFVAVVDQVIALLRQRGRLTYRTLQRQFQLDEAALDDLKDELMYG |
| Ga0066903_1040261812 | 3300005764 | Tropical Forest Soil | VDFIAVLDQAIALLRQRGRLTYSTLKRQFQLDDAALE |
| Ga0081455_105465721 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALK |
| Ga0075417_102580432 | 3300006049 | Populus Rhizosphere | VDFVTVVDQVSALLRQRGRVAYRTLKRQFQLDDEA |
| Ga0075422_102654461 | 3300006196 | Populus Rhizosphere | MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHL |
| Ga0075428_1000362546 | 3300006844 | Populus Rhizosphere | VNFVAVVDQVITLLRQRGRVAYRTLKRQFQLDDEAI |
| Ga0075428_1010409341 | 3300006844 | Populus Rhizosphere | VDIVAVLDQAIALLRQRGRLTYRTLQRQFHLDDAALDDLKDELI |
| Ga0075428_1011650041 | 3300006844 | Populus Rhizosphere | VDFVALVDQVTALLRQRGRVTYRTLQRQFQLDADALSDLLG |
| Ga0075428_1025787111 | 3300006844 | Populus Rhizosphere | MDFVSIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHDLTEEL |
| Ga0075421_1007389183 | 3300006845 | Populus Rhizosphere | VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDAAAL |
| Ga0075430_1005731591 | 3300006846 | Populus Rhizosphere | VDFVAVVDQVIVLLRQRGRIAYRTLKVQFSLDDNALEALKDELL |
| Ga0075430_1012933661 | 3300006846 | Populus Rhizosphere | VDFVAVVDQALALLRQRGCVTYRTLQRQFQLDAEALADLLAELRYAY |
| Ga0075430_1016196002 | 3300006846 | Populus Rhizosphere | VDFVAVVDQAMTLLRQRGRLTYGTLKRQFQLDDAAL |
| Ga0075430_1016708731 | 3300006846 | Populus Rhizosphere | VAVVDQAIALLRQRGRLTYRTLQLQFQLDTEHLEALKTVRDACP* |
| Ga0075431_1011064341 | 3300006847 | Populus Rhizosphere | VDFVALVDQVITLLRQRGRVTYRTLQRQFQLDAEA |
| Ga0075420_1011141641 | 3300006853 | Populus Rhizosphere | VDFVAVVDQAITLLRQRGRLTYRTLQLQFQLDDAHLEALK |
| Ga0075420_1017499611 | 3300006853 | Populus Rhizosphere | MDFDAILDQAIALLQRRGRLTYRTLKVQFALTEEQLDALREEL |
| Ga0075434_1003950501 | 3300006871 | Populus Rhizosphere | VDFVTVVDQVIVLLRQRGRVTYRLLKRQFQLDDEA |
| Ga0075429_1001398931 | 3300006880 | Populus Rhizosphere | VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDAA |
| Ga0075429_1008430361 | 3300006880 | Populus Rhizosphere | VDFVAVMDQVITLLRQRGRLTYRTLQRQFQLDDAAL |
| Ga0075429_1009861371 | 3300006880 | Populus Rhizosphere | VDFVAVVDQVMALLRQRGRVAYRTLKRQFQLDDEA |
| Ga0075429_1011560782 | 3300006880 | Populus Rhizosphere | VEFVGVVDQVIALLRQRGRVAYRTLKRQFQLDDEA |
| Ga0075424_1005533394 | 3300006904 | Populus Rhizosphere | MDFVAVVDQVIALLCQRGRVAYRTLKRQFQLDDEALE |
| Ga0099791_106472981 | 3300007255 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRVTYRTLQLQFTLDDAQLAALK |
| Ga0099793_106514081 | 3300007258 | Vadose Zone Soil | VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAEHL |
| Ga0066710_1041121121 | 3300009012 | Grasslands Soil | VDFVAVVDQVIALLRQRGRMTYRTLQRQFQLDDDA |
| Ga0099829_113999661 | 3300009038 | Vadose Zone Soil | MDFVAVVDQVIALLRQRGRVTYRTLQRQFQLDENA |
| Ga0099828_111897912 | 3300009089 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRLTYRTLQLQFALDDEQLAVL |
| Ga0099827_118741671 | 3300009090 | Vadose Zone Soil | VDFVAIVDQVIALVRQRGRVTYRTLQLQFTLDDEQL |
| Ga0111539_100284317 | 3300009094 | Populus Rhizosphere | VDFVAVVDQVIALLRQRGRVTYRTLQLQFQLDDAHLEVLKDK |
| Ga0111539_100618971 | 3300009094 | Populus Rhizosphere | VDFVAMVDQAIALLRQRGRVTYRTLQLQFTLDDAQLAALKDE |
| Ga0111539_114601793 | 3300009094 | Populus Rhizosphere | VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDTHLEALRD |
| Ga0111539_115913493 | 3300009094 | Populus Rhizosphere | VDFVAIVDQAIALLRQRGRLTYRTLQVQFQLDDAHLE |
| Ga0075418_101597341 | 3300009100 | Populus Rhizosphere | VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDEAAL |
| Ga0075418_114885042 | 3300009100 | Populus Rhizosphere | VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEAIE |
| Ga0075418_131601991 | 3300009100 | Populus Rhizosphere | MDFVAVVDQVIVLLRQRGRVTYSTLKRQFQLDEAAL |
| Ga0099792_106145862 | 3300009143 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRLTYRTLQLQFALDDEQLAVLKDELLYS |
| Ga0114129_100369055 | 3300009147 | Populus Rhizosphere | VDFVAVVDQAIALLRQRGRVAYRTLKRHFQLDDEALE |
| Ga0114129_111519602 | 3300009147 | Populus Rhizosphere | VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEALK |
| Ga0114129_114027221 | 3300009147 | Populus Rhizosphere | VDFVAVVDQVITLLRQRGRVAYRTLKRQFQLDDEALED |
| Ga0114129_116561121 | 3300009147 | Populus Rhizosphere | MDFVAVLDQVSTLLRQRGRVAYRTLKVQFHLDDDA |
| Ga0114129_134220061 | 3300009147 | Populus Rhizosphere | VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALKD |
| Ga0111538_101543651 | 3300009156 | Populus Rhizosphere | VDFVTVVDQAIALLRQRGRLTYRTLQRQFHLDDAAL |
| Ga0114996_107467972 | 3300009173 | Marine | MDFVAVIEQAKALLQSKGRLTYRTLQRQFALDDEALEDLKDELLFSD |
| Ga0114945_104783272 | 3300009444 | Thermal Springs | VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAVLKLANRASSRW* |
| Ga0105249_117482351 | 3300009553 | Switchgrass Rhizosphere | VTFDEVLNQAIELLKKRGRLTYRTVKRQFHLDEAALEDL |
| Ga0105340_13054801 | 3300009610 | Soil | MQGGDRVDFVAVVDQVIVLLRQRGRVTYRTLKRQFQLDDPA |
| Ga0126312_100694644 | 3300010041 | Serpentine Soil | MDFVAVVDQVITLLRQQGRVTYCTLQRQFQLDDDALH |
| Ga0126380_103101532 | 3300010043 | Tropical Forest Soil | MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEAL |
| Ga0126380_106618671 | 3300010043 | Tropical Forest Soil | VDCVAVVDQVIALLRQRARLTYCTLQLQFQPDEAHLEAL |
| Ga0126380_108510041 | 3300010043 | Tropical Forest Soil | VDFVAVLDQVIALLRQRGRITYRTLQRQSQLDEVALEDLK |
| Ga0126380_119168991 | 3300010043 | Tropical Forest Soil | MAEAIAMLQRRGRVTYQTLRLQFQLDEEHLEALKDAIL |
| Ga0126384_105448811 | 3300010046 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEAI |
| Ga0126382_104424681 | 3300010047 | Tropical Forest Soil | VDFVAVVDQAITLLRQRGRLTYRTLQLQYQLDDAHL |
| Ga0126321_10683253 | 3300010145 | Soil | MDFVAVLDQVIALLQQRGRLTYSTLKRQFQLDDAALEDVKN* |
| Ga0126372_125520752 | 3300010360 | Tropical Forest Soil | VDFVAVLEQVIALLRQRGRMTYSTLKRQFQLDDTALDDL |
| Ga0126372_127521012 | 3300010360 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVKNELI |
| Ga0126377_101830914 | 3300010362 | Tropical Forest Soil | VDFVAVVDQAIALLRQRGRLTYRTLQLQLQLDDAHLAALKDEL |
| Ga0126377_109680931 | 3300010362 | Tropical Forest Soil | VDFVAVLDQVIALLRQRGRLTYRTLQVQFHLDEAHLEILKE |
| Ga0126377_125183811 | 3300010362 | Tropical Forest Soil | MDFVAVLDQVIALLCQRGRLTYRTLQRQFQLDEATLDDLKD |
| Ga0126377_135410721 | 3300010362 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAAL |
| Ga0126379_116999851 | 3300010366 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYRTLQLQFTLDDAQLAALKDE |
| Ga0126379_123582541 | 3300010366 | Tropical Forest Soil | VDFVAVLDQVIALLRQRGRLTYRTLRRQFQLDDTALEDLTVELIK |
| Ga0126383_102434123 | 3300010398 | Tropical Forest Soil | VDFVAVVDQSIALLRQRGRLTYRTLQLQFQLDAEHLEALKD |
| Ga0126383_119260331 | 3300010398 | Tropical Forest Soil | MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHDLT |
| Ga0126383_129578721 | 3300010398 | Tropical Forest Soil | VDFVAVVDQAIALLRQRGRLTYGTLKRQFQLDDAVLDDLKD |
| Ga0126383_136320281 | 3300010398 | Tropical Forest Soil | VDFVAVVDQVIVLLRQRGRLTYRTLPLQFQLDQAHLEALKAE |
| Ga0137391_105687741 | 3300011270 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRVTYRTLKRQFQLDDDVLEDLK |
| Ga0120191_101229542 | 3300012022 | Terrestrial | VDFVALVDQVIALLRQRGRVTYRTLQRQFQLDADALTDLLGE |
| Ga0137383_104260541 | 3300012199 | Vadose Zone Soil | MDFVAVVDQVLTLLRQRGRVTYRTLQIQFALDDTQ |
| Ga0137380_103399742 | 3300012206 | Vadose Zone Soil | MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALVAYL* |
| Ga0137380_106098402 | 3300012206 | Vadose Zone Soil | MDFVAVVDQVLTLLRQRGRVTYRTLQIQFALDDTQFAALKD |
| Ga0137379_104414173 | 3300012209 | Vadose Zone Soil | MDFVAVVDQVIALLRQRGRVAYRTLKVQFTLDDDAL* |
| Ga0137387_104931841 | 3300012349 | Vadose Zone Soil | VADFVAVLDQVIALLRQRGRLTYRTLQLQFQLDETQLEVLKDELI |
| Ga0137385_106417163 | 3300012359 | Vadose Zone Soil | VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVKNELI |
| Ga0137385_108278231 | 3300012359 | Vadose Zone Soil | VDFVAVLDQVIVLLRQRGRMTYRALQRQFQLDDDAL |
| Ga0137375_107961261 | 3300012360 | Vadose Zone Soil | MDFVAVVDQVIALLRQRGRLTYRTLQRQFQLDDAALDDLKDE |
| Ga0137361_113875663 | 3300012362 | Vadose Zone Soil | VDFVAVVDQAIALLRQRGRVTYRTLQLQFTLDDEQLAALK |
| Ga0137361_119430642 | 3300012362 | Vadose Zone Soil | MDFVAVVDQVITLLRQRGRLTYRTLQLQFQLDETHLEVLKDELVYG |
| Ga0137390_102070624 | 3300012363 | Vadose Zone Soil | MDFVAVVDQAIVLLRQRGRLTYRTLQLQFQLDDAHL |
| Ga0137390_105570002 | 3300012363 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVKN |
| Ga0137397_108259242 | 3300012685 | Vadose Zone Soil | VDFVAVLDQVITLLRQRGRVTYRTLKRQFQLDEAALEDLQQREPMAA* |
| Ga0137359_115666602 | 3300012923 | Vadose Zone Soil | VDFVAVMEQVIALLRQWGRLTYRTLQRQFHLDDDTLT |
| Ga0137416_113793072 | 3300012927 | Vadose Zone Soil | VDFVAVVDQAIALLRQRGRVTYSTLKRQFQLDDAAL |
| Ga0137404_101822263 | 3300012929 | Vadose Zone Soil | VDFVAVVDQAIALLRQRGRVTYRTLQLQFQLDEAHLE |
| Ga0137404_105978732 | 3300012929 | Vadose Zone Soil | MAIVDQVIALLRQRGRLTYRTLQLQFQLDETHLEVIKDELL |
| Ga0137407_102342301 | 3300012930 | Vadose Zone Soil | MDFVAVVDQVIALLRQRGRVTYRTLQLQFQLDDAQLAALKD |
| Ga0126375_103910031 | 3300012948 | Tropical Forest Soil | VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAAHLDA |
| Ga0126375_104919772 | 3300012948 | Tropical Forest Soil | MDFVAVVDQVITLLHQRGRVAYRTLKRQFQLDNEAIED |
| Ga0126375_113294731 | 3300012948 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALED |
| Ga0126375_118082641 | 3300012948 | Tropical Forest Soil | VDFVTIVDQAIALLRQRGRLTYRTLQVQFQLDDTHLE |
| Ga0126369_108752902 | 3300012971 | Tropical Forest Soil | MDFVAIVDQVIALLRQRGRVTYRTLKRQFQLDDEALEDLK |
| Ga0126369_112959691 | 3300012971 | Tropical Forest Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFHLDEAALEDVKN |
| Ga0126369_121987982 | 3300012971 | Tropical Forest Soil | VDFVAVMEQAIALLRQRGRVTYRTLQIQFTLDDEQLAALK |
| Ga0157378_125190932 | 3300013297 | Miscanthus Rhizosphere | VDFVTVVDQGLALLRQRGRTTYRTLQRQFPVDRLPRCH |
| Ga0163162_111316811 | 3300013306 | Switchgrass Rhizosphere | VDFVAVLDQVIALLHQRGRLTYSTLKRQFQLDDATLEDVK |
| Ga0163162_134377981 | 3300013306 | Switchgrass Rhizosphere | VDFVAVVDQVMTLLRQRGRVTYRLLKRQFQLDDEAL |
| Ga0132258_136704023 | 3300015371 | Arabidopsis Rhizosphere | VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDEALEDLK |
| Ga0132256_1020927642 | 3300015372 | Arabidopsis Rhizosphere | MDFVAIVDQVLTLLRQRGRVTYRTLQRQFQLDEGALA |
| Ga0182036_110573982 | 3300016270 | Soil | VDFVAVVDQAITLLRQRGRVTYRTLQRQFQLDDAALDDLKD |
| Ga0182036_116318491 | 3300016270 | Soil | LDQAIAMLQRRGHLTYRTLQLQFQLDETYLEALKDELI |
| Ga0182034_104196853 | 3300016371 | Soil | VDFVAILDQVMALLRQRGRVAYRTLKVQFHLDDDALEALK |
| Ga0182034_120880681 | 3300016371 | Soil | VDFVAVVDQAIAHLRQRGRVTYRTLQLQFTLDNEQLAALKD |
| Ga0182038_115915351 | 3300016445 | Soil | MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDGVHLEALKDEL |
| Ga0182038_116919092 | 3300016445 | Soil | VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEALKDEL |
| Ga0184612_104455051 | 3300018078 | Groundwater Sediment | VDFVTVVDQAIALLRQRGRVTYRTLQIQFTLDDAQL |
| Ga0184627_100218421 | 3300018079 | Groundwater Sediment | VDFVAVVDQVIALLRQRGRVTYHTLQLQFTLDDAQLA |
| Ga0066667_113594921 | 3300018433 | Grasslands Soil | VDFVAVMEQAIALLRQRGRVTYRTLQIQFTLDDEQLAALKDELL |
| Ga0066662_116265301 | 3300018468 | Grasslands Soil | MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDEALHDLTDE |
| Ga0212128_101581093 | 3300022563 | Thermal Springs | VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAALK |
| Ga0209399_101178773 | 3300025157 | Thermal Springs | VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAVLKLANRASSRW |
| Ga0207680_111706661 | 3300025903 | Switchgrass Rhizosphere | VDFVTVVDQGLALLRQRGRTTYRTLQRQFPVDRLPRCHMIS |
| Ga0207684_102930703 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFVAVVDQVIALLRQRGRLAYRTLKRQFQLDDEALADL |
| Ga0207684_113597511 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFVAVVDQAIALLRQRGRLTYRTLQLQLQLDDAHLAALKDE |
| Ga0207712_103106731 | 3300025961 | Switchgrass Rhizosphere | VDFVAVLDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVK |
| Ga0207674_110496671 | 3300026116 | Corn Rhizosphere | MDFVAVLDQVIALLRQRGRLTYRTLQLQYQLDDAHLEALKD |
| Ga0209239_13539881 | 3300026310 | Grasslands Soil | VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDDAALEDLT |
| Ga0257166_10560191 | 3300026358 | Soil | VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVK |
| Ga0257164_10581222 | 3300026497 | Soil | VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVKNE |
| Ga0209689_12153461 | 3300027748 | Soil | VDFVAVLDQVIVLLRQRGRLTYSTIKRQFQLDEAALEDVKN |
| Ga0209180_106312401 | 3300027846 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDDAV |
| Ga0209814_105743102 | 3300027873 | Populus Rhizosphere | VDFVAVMDQVITLLRQRGRLTYRTLQRQFQLDAAALE |
| Ga0209465_102852171 | 3300027874 | Tropical Forest Soil | MDFVAVLDQVIALLQQRGRLTYSTLKRQFQLDDTALEDVKNE |
| Ga0209481_103437941 | 3300027880 | Populus Rhizosphere | VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDTHLE |
| Ga0209590_105261671 | 3300027882 | Vadose Zone Soil | MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHD |
| Ga0209590_106825551 | 3300027882 | Vadose Zone Soil | VDFVAVVDQVIALLRQRGRVTYRTLKRQFQLDDDVL |
| Ga0209590_107490901 | 3300027882 | Vadose Zone Soil | VDFVAVLDQVIVLLRQRGRVTYSTLKRQFQLDDAAL |
| Ga0207428_104827213 | 3300027907 | Populus Rhizosphere | VDFVAVLDQVIALLRQRGRLTYRTLQRQFQLDEAALEDLKVEL |
| Ga0209382_106274113 | 3300027909 | Populus Rhizosphere | VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDAAALDDLTVELIKG |
| Ga0209860_10453011 | 3300027949 | Groundwater Sand | MQGGDGVDFVAVLDQVIALLRQRGRLTYSTLKRQFQD |
| Ga0299907_109647551 | 3300030006 | Soil | VDFVTLVDQVLALLRQRGRVTYRTLQRQFQLEADALT |
| Ga0307468_1018954092 | 3300031740 | Hardwood Forest Soil | VDFVAVLDQVIALLHQRGRLTYRTLKRQFELDDVA |
| Ga0307473_105096601 | 3300031820 | Hardwood Forest Soil | MDFVAVVDQVITLLRQRGRVTYSTLKRQFQRDDAAVEDVKNELI |
| Ga0310900_114826153 | 3300031908 | Soil | MDFVAVVDQVIALLRQRGRVTYRTLQLQFTLNDAQMVALKDE |
| Ga0310916_106553891 | 3300031942 | Soil | MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDAVHDLTD |
| Ga0310916_114162652 | 3300031942 | Soil | VDFVAVVDQVIALLRQRGRVAYRMLKVQFHLDDDA |
| Ga0310884_103784802 | 3300031944 | Soil | GVDFVAVLDQVMLLRQRGRLTYRTLQRQFQLDDAALDDLFVWRHL |
| Ga0306926_114284301 | 3300031954 | Soil | VDFLAIVDQVIALLRQRGRMTYRTLKRQFQLDEAALEDL |
| Ga0307414_110308702 | 3300032004 | Rhizosphere | MDFYDMLDQVRDLLRQRGRVAYRVLKLQFKLDDET |
| Ga0310899_107263221 | 3300032017 | Soil | VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDAEAIE |
| Ga0318507_104937722 | 3300032025 | Soil | VDFVAVVDQAITLLRQRGRVTYRTLQRQFQLDDAALD |
| Ga0318575_103098421 | 3300032055 | Soil | MDFVAVLDQVIALLRQRRRLTYSTLKRQFQLDDAALEE |
| Ga0310890_109390492 | 3300032075 | Soil | VDFVAVLDQVIALLRQRGRLTYRTLKRQFQLDDEAL |
| Ga0318577_103493432 | 3300032091 | Soil | VDFVAVVDQAIALLRQRGHLTYRTLQLQFQLDAEYLA |
| Ga0310895_107841592 | 3300032122 | Soil | VDFVAVLDQVITLLRQRGRLTYRTLKRQFELDDAALED |
| Ga0307415_1011360071 | 3300032126 | Rhizosphere | MDFVAVMDQVIALLRQRGRLTYRTLQLQFQLDETHLEVLKEEL |
| Ga0247830_101736851 | 3300033551 | Soil | MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHL |
| Ga0247830_102922772 | 3300033551 | Soil | VAVVDQAIALLRQRGRLTYRTLQLQFQLDTEHLEALKTVRDACP |
| Ga0364928_0017534_899_1015 | 3300033813 | Sediment | VDFVAVLEQVIALLRQRGRLTYSTLKRQFQLDDAALED |
| Ga0314792_193581_423_560 | 3300034667 | Soil | MDFVAVVDQAIALLRPRGRLTYRTLQRQFQLDDAALDDLFVWRHL |
| Ga0314797_126971_429_545 | 3300034672 | Soil | VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDEHLQAL |
| Ga0314803_144198_375_500 | 3300034678 | Soil | VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDEHLQALTDE |
| Ga0370546_077321_394_528 | 3300034681 | Soil | MDFVAVVDQVIALLQQRGRVTYRTLQRQFQLDEAALEDGTSSPA |
| ⦗Top⦘ |