


| Basic Information | |
|---|---|
| Family ID | F037136 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIFMRVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.10 % |
| % of genes near scaffold ends (potentially truncated) | 55.36 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.071 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.976 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.36 |
| PF03401 | TctC | 1.79 |
| PF00582 | Usp | 1.79 |
| PF01384 | PHO4 | 1.19 |
| PF07859 | Abhydrolase_3 | 1.19 |
| PF00872 | Transposase_mut | 1.19 |
| PF00106 | adh_short | 0.60 |
| PF01321 | Creatinase_N | 0.60 |
| PF13432 | TPR_16 | 0.60 |
| PF13180 | PDZ_2 | 0.60 |
| PF01609 | DDE_Tnp_1 | 0.60 |
| PF02371 | Transposase_20 | 0.60 |
| PF04191 | PEMT | 0.60 |
| PF04972 | BON | 0.60 |
| PF08327 | AHSA1 | 0.60 |
| PF00589 | Phage_integrase | 0.60 |
| PF00005 | ABC_tran | 0.60 |
| PF00248 | Aldo_ket_red | 0.60 |
| PF01202 | SKI | 0.60 |
| PF14312 | FG-GAP_2 | 0.60 |
| PF00285 | Citrate_synt | 0.60 |
| PF14534 | DUF4440 | 0.60 |
| PF00227 | Proteasome | 0.60 |
| PF07508 | Recombinase | 0.60 |
| PF01068 | DNA_ligase_A_M | 0.60 |
| PF04218 | CENP-B_N | 0.60 |
| PF00126 | HTH_1 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.36 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.79 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 1.19 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.19 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.19 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.60 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.60 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.60 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.60 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.60 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.60 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.60 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.60 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.38 % |
| Unclassified | root | N/A | 47.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04XHS5H | Not Available | 507 | Open in IMG/M |
| 2088090014|GPIPI_17490720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2543 | Open in IMG/M |
| 3300000550|F24TB_10418679 | Not Available | 675 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1036679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1075264 | Not Available | 512 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10122890 | Not Available | 633 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1013211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1571 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10055646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10122040 | Not Available | 544 | Open in IMG/M |
| 3300000956|JGI10216J12902_104905471 | Not Available | 1089 | Open in IMG/M |
| 3300000956|JGI10216J12902_107173486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3154 | Open in IMG/M |
| 3300001867|JGI12627J18819_10360809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300002911|JGI25390J43892_10049313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 996 | Open in IMG/M |
| 3300002914|JGI25617J43924_10266695 | Not Available | 583 | Open in IMG/M |
| 3300004633|Ga0066395_10370213 | Not Available | 800 | Open in IMG/M |
| 3300005178|Ga0066688_10263922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1104 | Open in IMG/M |
| 3300005187|Ga0066675_10567117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300005332|Ga0066388_101393047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1217 | Open in IMG/M |
| 3300005332|Ga0066388_104888557 | Not Available | 681 | Open in IMG/M |
| 3300005332|Ga0066388_106103016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300005363|Ga0008090_15851748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300005436|Ga0070713_100655630 | Not Available | 1000 | Open in IMG/M |
| 3300005436|Ga0070713_102471246 | Not Available | 502 | Open in IMG/M |
| 3300005467|Ga0070706_100934094 | Not Available | 801 | Open in IMG/M |
| 3300005713|Ga0066905_100813080 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005713|Ga0066905_101905445 | Not Available | 550 | Open in IMG/M |
| 3300005764|Ga0066903_100637863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1858 | Open in IMG/M |
| 3300005764|Ga0066903_101691183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300005764|Ga0066903_101818282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300005764|Ga0066903_102519468 | Not Available | 996 | Open in IMG/M |
| 3300005764|Ga0066903_104432906 | Not Available | 749 | Open in IMG/M |
| 3300005764|Ga0066903_104827415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300005764|Ga0066903_105121698 | Not Available | 694 | Open in IMG/M |
| 3300005764|Ga0066903_105387601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300005764|Ga0066903_105598261 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005764|Ga0066903_107799050 | Not Available | 550 | Open in IMG/M |
| 3300006049|Ga0075417_10199518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300006051|Ga0075364_10882141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300006797|Ga0066659_10671846 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300006844|Ga0075428_101926389 | Not Available | 614 | Open in IMG/M |
| 3300006854|Ga0075425_101392002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300006904|Ga0075424_100280237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1773 | Open in IMG/M |
| 3300007076|Ga0075435_101790354 | Not Available | 539 | Open in IMG/M |
| 3300007255|Ga0099791_10607946 | Not Available | 535 | Open in IMG/M |
| 3300009137|Ga0066709_103877218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300009792|Ga0126374_10110730 | Not Available | 1582 | Open in IMG/M |
| 3300009792|Ga0126374_10153597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1399 | Open in IMG/M |
| 3300009792|Ga0126374_10174065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1333 | Open in IMG/M |
| 3300010043|Ga0126380_10685096 | Not Available | 821 | Open in IMG/M |
| 3300010043|Ga0126380_11452162 | Not Available | 605 | Open in IMG/M |
| 3300010043|Ga0126380_11601525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. HDIP04 | 581 | Open in IMG/M |
| 3300010046|Ga0126384_10456487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300010046|Ga0126384_10501885 | Not Available | 1046 | Open in IMG/M |
| 3300010046|Ga0126384_10734199 | Not Available | 878 | Open in IMG/M |
| 3300010048|Ga0126373_10930084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300010048|Ga0126373_11459819 | Not Available | 749 | Open in IMG/M |
| 3300010358|Ga0126370_10743635 | Not Available | 867 | Open in IMG/M |
| 3300010359|Ga0126376_10771487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300010361|Ga0126378_10330954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1631 | Open in IMG/M |
| 3300010376|Ga0126381_101181126 | Not Available | 1106 | Open in IMG/M |
| 3300010376|Ga0126381_101313266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300010398|Ga0126383_13402420 | Not Available | 520 | Open in IMG/M |
| 3300010863|Ga0124850_1002683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5276 | Open in IMG/M |
| 3300012189|Ga0137388_10882583 | Not Available | 827 | Open in IMG/M |
| 3300012198|Ga0137364_10120699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1868 | Open in IMG/M |
| 3300012199|Ga0137383_10611677 | Not Available | 797 | Open in IMG/M |
| 3300012200|Ga0137382_10570909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300012202|Ga0137363_10036865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3420 | Open in IMG/M |
| 3300012202|Ga0137363_10280729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1362 | Open in IMG/M |
| 3300012208|Ga0137376_10858350 | Not Available | 780 | Open in IMG/M |
| 3300012285|Ga0137370_10772246 | Not Available | 596 | Open in IMG/M |
| 3300012351|Ga0137386_10952243 | Not Available | 613 | Open in IMG/M |
| 3300012353|Ga0137367_10271773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300012354|Ga0137366_10085888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2391 | Open in IMG/M |
| 3300012358|Ga0137368_10816006 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012362|Ga0137361_11809725 | Not Available | 529 | Open in IMG/M |
| 3300012363|Ga0137390_10051519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3994 | Open in IMG/M |
| 3300012582|Ga0137358_10697086 | Not Available | 679 | Open in IMG/M |
| 3300012924|Ga0137413_11552555 | Not Available | 540 | Open in IMG/M |
| 3300012948|Ga0126375_10697509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300012971|Ga0126369_12356380 | Not Available | 619 | Open in IMG/M |
| 3300012971|Ga0126369_12781805 | Not Available | 572 | Open in IMG/M |
| 3300012972|Ga0134077_10567029 | Not Available | 510 | Open in IMG/M |
| 3300012988|Ga0164306_11269969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300016319|Ga0182033_11197413 | Not Available | 680 | Open in IMG/M |
| 3300016319|Ga0182033_12108323 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300016341|Ga0182035_11801572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 554 | Open in IMG/M |
| 3300016357|Ga0182032_10291598 | Not Available | 1285 | Open in IMG/M |
| 3300016387|Ga0182040_10215374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1421 | Open in IMG/M |
| 3300016404|Ga0182037_11717943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300018468|Ga0066662_11780765 | Not Available | 644 | Open in IMG/M |
| 3300021168|Ga0210406_10624130 | Not Available | 839 | Open in IMG/M |
| 3300021560|Ga0126371_10906458 | Not Available | 1025 | Open in IMG/M |
| 3300021560|Ga0126371_12334590 | Not Available | 646 | Open in IMG/M |
| 3300025910|Ga0207684_11073725 | Not Available | 671 | Open in IMG/M |
| 3300025928|Ga0207700_11020912 | Not Available | 740 | Open in IMG/M |
| 3300025928|Ga0207700_12020648 | Not Available | 503 | Open in IMG/M |
| 3300026319|Ga0209647_1034988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2887 | Open in IMG/M |
| 3300026551|Ga0209648_10033990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4442 | Open in IMG/M |
| 3300027855|Ga0209693_10119463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1305 | Open in IMG/M |
| 3300027874|Ga0209465_10069351 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300031543|Ga0318516_10413972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300031546|Ga0318538_10061305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1867 | Open in IMG/M |
| 3300031546|Ga0318538_10564682 | Not Available | 617 | Open in IMG/M |
| 3300031546|Ga0318538_10795280 | Not Available | 513 | Open in IMG/M |
| 3300031546|Ga0318538_10819883 | Not Available | 505 | Open in IMG/M |
| 3300031564|Ga0318573_10691151 | Not Available | 548 | Open in IMG/M |
| 3300031572|Ga0318515_10740665 | Not Available | 519 | Open in IMG/M |
| 3300031573|Ga0310915_10086549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2094 | Open in IMG/M |
| 3300031573|Ga0310915_10218344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 1336 | Open in IMG/M |
| 3300031573|Ga0310915_10289901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1155 | Open in IMG/M |
| 3300031573|Ga0310915_11162873 | Not Available | 534 | Open in IMG/M |
| 3300031573|Ga0310915_11182623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300031640|Ga0318555_10164061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300031640|Ga0318555_10662769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 564 | Open in IMG/M |
| 3300031679|Ga0318561_10265226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300031681|Ga0318572_10265193 | Not Available | 1011 | Open in IMG/M |
| 3300031681|Ga0318572_10837926 | Not Available | 546 | Open in IMG/M |
| 3300031682|Ga0318560_10250410 | Not Available | 951 | Open in IMG/M |
| 3300031719|Ga0306917_10036120 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
| 3300031719|Ga0306917_10173981 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300031719|Ga0306917_10985286 | Not Available | 658 | Open in IMG/M |
| 3300031744|Ga0306918_10909097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031744|Ga0306918_11190352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium | 588 | Open in IMG/M |
| 3300031747|Ga0318502_10971562 | Not Available | 517 | Open in IMG/M |
| 3300031748|Ga0318492_10143869 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300031748|Ga0318492_10702842 | Not Available | 542 | Open in IMG/M |
| 3300031764|Ga0318535_10038748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1948 | Open in IMG/M |
| 3300031768|Ga0318509_10019913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3120 | Open in IMG/M |
| 3300031768|Ga0318509_10792087 | Not Available | 524 | Open in IMG/M |
| 3300031770|Ga0318521_10849020 | Not Available | 557 | Open in IMG/M |
| 3300031777|Ga0318543_10096934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1264 | Open in IMG/M |
| 3300031793|Ga0318548_10550257 | Not Available | 562 | Open in IMG/M |
| 3300031794|Ga0318503_10096629 | Not Available | 936 | Open in IMG/M |
| 3300031879|Ga0306919_10023224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3793 | Open in IMG/M |
| 3300031880|Ga0318544_10111649 | Not Available | 1035 | Open in IMG/M |
| 3300031893|Ga0318536_10675314 | Not Available | 515 | Open in IMG/M |
| 3300031910|Ga0306923_11063947 | Not Available | 874 | Open in IMG/M |
| 3300031912|Ga0306921_10155985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2671 | Open in IMG/M |
| 3300031912|Ga0306921_10415525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1569 | Open in IMG/M |
| 3300031941|Ga0310912_10481845 | Not Available | 967 | Open in IMG/M |
| 3300031941|Ga0310912_11398237 | Not Available | 528 | Open in IMG/M |
| 3300031941|Ga0310912_11532182 | Not Available | 501 | Open in IMG/M |
| 3300031942|Ga0310916_11036415 | Not Available | 683 | Open in IMG/M |
| 3300031942|Ga0310916_11136733 | Not Available | 648 | Open in IMG/M |
| 3300031954|Ga0306926_10089127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3765 | Open in IMG/M |
| 3300031954|Ga0306926_10474306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1540 | Open in IMG/M |
| 3300031954|Ga0306926_12056903 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031959|Ga0318530_10057011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1483 | Open in IMG/M |
| 3300032001|Ga0306922_10125379 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
| 3300032001|Ga0306922_10234801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1970 | Open in IMG/M |
| 3300032009|Ga0318563_10089081 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Botrimarina → Botrimarina colliarenosi | 1620 | Open in IMG/M |
| 3300032025|Ga0318507_10488011 | Not Available | 536 | Open in IMG/M |
| 3300032051|Ga0318532_10274684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium | 598 | Open in IMG/M |
| 3300032052|Ga0318506_10031944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2022 | Open in IMG/M |
| 3300032052|Ga0318506_10467929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 559 | Open in IMG/M |
| 3300032055|Ga0318575_10007242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4065 | Open in IMG/M |
| 3300032059|Ga0318533_10317565 | Not Available | 1132 | Open in IMG/M |
| 3300032059|Ga0318533_11256354 | Not Available | 541 | Open in IMG/M |
| 3300032063|Ga0318504_10461436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300032066|Ga0318514_10067933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1757 | Open in IMG/M |
| 3300032066|Ga0318514_10273972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300032076|Ga0306924_11126752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300032261|Ga0306920_100694770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1499 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.60% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.60% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_07333700 | 2070309004 | Green-Waste Compost | MIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF |
| GPIPI_02514000 | 2088090014 | Soil | MIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL |
| F24TB_104186791 | 3300000550 | Soil | VVLIPQWSTIFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII* |
| AF_2010_repII_A01DRAFT_10366793 | 3300000580 | Forest Soil | IRASRSFFNGRMIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF* |
| AF_2010_repII_A01DRAFT_10752641 | 3300000580 | Forest Soil | MIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| AF_2010_repII_A1DRAFT_101228902 | 3300000597 | Forest Soil | MIFMRVHKYWLDYDLAALALLIIGMVAVELLALMM* |
| AF_2010_repII_A100DRAFT_10132111 | 3300000655 | Forest Soil | WLVIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF* |
| AF_2010_repII_A001DRAFT_100556462 | 3300000793 | Forest Soil | SFFNGRMIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF* |
| AF_2010_repII_A001DRAFT_101220401 | 3300000793 | Forest Soil | MIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF* |
| JGI10216J12902_1049054713 | 3300000956 | Soil | MIFMRVHKYWLEYDAAALAFLVVGIAVVGLLAIII* |
| JGI10216J12902_1071734861 | 3300000956 | Soil | VHLAHLQWKMIFMRVHKYWLDYDVAAVAFLIVGIAVVGLLALII* |
| JGI12627J18819_103608091 | 3300001867 | Forest Soil | FILNGETIFMRLYKHWLDHDVAALAFLILGMTAVELLAMII* |
| JGI25390J43892_100493133 | 3300002911 | Grasslands Soil | MRPKRCNRRSTIFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII* |
| JGI25617J43924_102666951 | 3300002914 | Grasslands Soil | KSVFIHSFILEWRMIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII* |
| Ga0066395_103702132 | 3300004633 | Tropical Forest Soil | LILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII* |
| Ga0066688_102639223 | 3300005178 | Soil | HHSLIVQWGMTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII* |
| Ga0066675_105671172 | 3300005187 | Soil | CTSLITQWSTIFMRVHTHWLDYDVAAVAFLIVGIASVGLLAIII* |
| Ga0066388_1013930471 | 3300005332 | Tropical Forest Soil | SLILAWGMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIVI* |
| Ga0066388_1048885571 | 3300005332 | Tropical Forest Soil | VQRWVTFMRVHTHWLDCDAAAWTFLIVGIAAVGLLVIII* |
| Ga0066388_1061030162 | 3300005332 | Tropical Forest Soil | ASRSFFNGRMIFMRVHKHWLDYDVVALAFLVIAIAAVELLALIF* |
| Ga0008090_158517482 | 3300005363 | Tropical Rainforest Soil | LVIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF* |
| Ga0070714_1019267592 | 3300005435 | Agricultural Soil | SLMSARWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI* |
| Ga0070713_1006556302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSLFKGGMIFMGVYKHWLDYDAAALAFLIVGIAAVGLIAIII* |
| Ga0070713_1018225621 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI* |
| Ga0070713_1024712461 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SLILQRRMIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL* |
| Ga0070710_104774661 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARWGTNLMRVQKYWLDYDLAAVALLLIGLAAVEVLALVLI* |
| Ga0070706_1009340941 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF*LQPHP |
| Ga0066905_1008130802 | 3300005713 | Tropical Forest Soil | MIFMRVHKYWLDYDLAALALLIIGMAAVELLALIM* |
| Ga0066905_1019054451 | 3300005713 | Tropical Forest Soil | LFDGMIFMRVRKYWLDYDAAALAFLIIGIAAIEVLALIIM* |
| Ga0066903_1006378632 | 3300005764 | Tropical Forest Soil | MTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII* |
| Ga0066903_1016911834 | 3300005764 | Tropical Forest Soil | MTFMRVHTHWLECDAGAWTFLIVGIAAVGLLVIII* |
| Ga0066903_1018182823 | 3300005764 | Tropical Forest Soil | MIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF* |
| Ga0066903_1025194681 | 3300005764 | Tropical Forest Soil | FNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0066903_1044329062 | 3300005764 | Tropical Forest Soil | LILQWRMIFMRVYKHWLDYDVAALAFLIGGIAAVELIAIII* |
| Ga0066903_1048274153 | 3300005764 | Tropical Forest Soil | MILMRVYKHWLDYDVAALAFLIFGMAAVGLLAIII* |
| Ga0066903_1051216982 | 3300005764 | Tropical Forest Soil | MIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM* |
| Ga0066903_1053876012 | 3300005764 | Tropical Forest Soil | MIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF* |
| Ga0066903_1055982612 | 3300005764 | Tropical Forest Soil | VHVARWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM* |
| Ga0066903_1077990501 | 3300005764 | Tropical Forest Soil | LHGGMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII* |
| Ga0075417_101995181 | 3300006049 | Populus Rhizosphere | CSPLIPQWSTIFMRVHIHWLDYDVAALAFLIVGIAAVGLLAIMI* |
| Ga0075364_108821412 | 3300006051 | Populus Endosphere | IHHSLILQWGMIFMRVNKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0066659_106718462 | 3300006797 | Soil | MIFMRVHKYWLEYDVAALAFLIVGLAAVGLLAMII* |
| Ga0075428_1019263892 | 3300006844 | Populus Rhizosphere | LGLQRRRLLRGRKHWLEYDVAALVLLIVGMAAVGLLALMI* |
| Ga0075425_1013920021 | 3300006854 | Populus Rhizosphere | MFFMRVHKYWLEYDAAALAFLIVGMAAVGLLAVVI* |
| Ga0075424_1002802373 | 3300006904 | Populus Rhizosphere | CSRRRTRIFMRVHKYWLEHDPAALAFLIIGIAVVGLLAIII* |
| Ga0075435_1017903541 | 3300007076 | Populus Rhizosphere | MLFMRVHKYWLEYDAAALAFLAVGMAVVGLLAIII* |
| Ga0099791_106079461 | 3300007255 | Vadose Zone Soil | MIFMRVHKHWLDYDVAALAFLIVGIAAVEVLAIIL* |
| Ga0066709_1038772182 | 3300009137 | Grasslands Soil | MLFMRVHKYWLEYDAAALAFLIVGIAAVGLLVIII* |
| Ga0126374_101107303 | 3300009792 | Tropical Forest Soil | GGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0126374_101535972 | 3300009792 | Tropical Forest Soil | MIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII* |
| Ga0126374_101740653 | 3300009792 | Tropical Forest Soil | MILMRVHKHWLDYDVVALAFLIIGIAAVELVALIF* |
| Ga0126380_106850962 | 3300010043 | Tropical Forest Soil | MILMRVHKHWLDYDVVALAFLIIGIAAVELFALIF* |
| Ga0126380_114521622 | 3300010043 | Tropical Forest Soil | MIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII* |
| Ga0126380_116015251 | 3300010043 | Tropical Forest Soil | HHSLILAWGMIFVRVYKHWLDYDAAALAFLIVGIAAVELLAMII* |
| Ga0126384_104564872 | 3300010046 | Tropical Forest Soil | MIFVRVYKHWLDYDAAALAFLIVGIAAVELLAMII* |
| Ga0126384_105018852 | 3300010046 | Tropical Forest Soil | MIFMRALHKHWLDYDVAALAFLIVGIAAVEVLAIIL* |
| Ga0126384_107341992 | 3300010046 | Tropical Forest Soil | MIFMRVHKHWLDYDVVALAFLIIGIAAVELVALIF* |
| Ga0126373_109300841 | 3300010048 | Tropical Forest Soil | FQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0126373_114598191 | 3300010048 | Tropical Forest Soil | IFMRVHKYWLDYDLAALALLIIGMAAVELLALMM* |
| Ga0126370_107436351 | 3300010358 | Tropical Forest Soil | MIFMRVLHKHWLDYDVAALAFLIVGIAAVEVLAIIL* |
| Ga0126376_107714871 | 3300010359 | Tropical Forest Soil | MIFMRTHKHWLDYDVAALAFLILGMAAVEVLAIIL* |
| Ga0126378_103309543 | 3300010361 | Tropical Forest Soil | LAWGMIFVRVYKHWLDYDAAALAFLIVGIAVVGLLAIII* |
| Ga0126381_1011811261 | 3300010376 | Tropical Forest Soil | MIFMRAYKHWLDHDVAALAFLIVGIAAVELLAAII* |
| Ga0126381_1013132661 | 3300010376 | Tropical Forest Soil | NFQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0126383_134024201 | 3300010398 | Tropical Forest Soil | WRMIFMRVHKYWLDYDLAALALLIIGMVAVELLALMM* |
| Ga0124850_10026836 | 3300010863 | Tropical Forest Soil | GCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII* |
| Ga0137388_108825831 | 3300012189 | Vadose Zone Soil | SVFIHSFILEWRMIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII* |
| Ga0137364_101206993 | 3300012198 | Vadose Zone Soil | MIFMRVHKYWLEYDAAALAFLIVGIAVVELLAIII* |
| Ga0137383_106116772 | 3300012199 | Vadose Zone Soil | MIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF* |
| Ga0137382_105709091 | 3300012200 | Vadose Zone Soil | IPRSFFNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII* |
| Ga0137363_100368653 | 3300012202 | Vadose Zone Soil | MIFMRVHKHWLDYDVAAVAFLIVGIAAVGLLALII* |
| Ga0137363_102807292 | 3300012202 | Vadose Zone Soil | MIFMRVHKHWLDYDVVALAFLVVGIAAVELLALIF* |
| Ga0137376_108583501 | 3300012208 | Vadose Zone Soil | MIIMRVLHKHWLDSDVAALAFLIVGLAAVEVLAIIL* |
| Ga0137370_107722461 | 3300012285 | Vadose Zone Soil | MLFMRVHKYWLEYDAAALAFLIVGIAVVGLLAIII* |
| Ga0137386_109522431 | 3300012351 | Vadose Zone Soil | MIFMRVLHKHWLDYDVAALAFLILGIAAVEVLAIIL* |
| Ga0137367_102717731 | 3300012353 | Vadose Zone Soil | IFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII* |
| Ga0137366_100858883 | 3300012354 | Vadose Zone Soil | HWCTSLITQWSTIFMRVHTHWLDYDVAAVAFLIVGIAAVGLLAIII* |
| Ga0137368_108160061 | 3300012358 | Vadose Zone Soil | TSLIPQWSTIFMRVHKHWLDYDVAALAFLIVGIAAVGLLAIII* |
| Ga0137361_118097251 | 3300012362 | Vadose Zone Soil | FIPRSFFNGGTIFMHVYKHWLDHDVAALAFLIVGMTAVELLAMII* |
| Ga0137390_100515194 | 3300012363 | Vadose Zone Soil | MIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII* |
| Ga0137358_106970862 | 3300012582 | Vadose Zone Soil | MIFMRVHKHWLDYDVVALAFLVIGIAVVELLALIF* |
| Ga0137413_115525551 | 3300012924 | Vadose Zone Soil | MIFMRVHKHWLDYDVVALAFLVISIAAVELLALIF* |
| Ga0126375_106975094 | 3300012948 | Tropical Forest Soil | MIFMMLHKHWLDYDVAALAFLIVGIAAVEVLAIIL* |
| Ga0126369_123563801 | 3300012971 | Tropical Forest Soil | MENIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM* |
| Ga0126369_127818052 | 3300012971 | Tropical Forest Soil | MIFMRVRKYWLDYDLAALALLIIGMAAVELLALIM* |
| Ga0134077_105670291 | 3300012972 | Grasslands Soil | QWSTIFMRVHTHWLDYDVAAVAFLIVGIASVGLLAIII* |
| Ga0164306_112699692 | 3300012988 | Soil | FIPRSFFNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII* |
| Ga0164305_109477562 | 3300012989 | Soil | RWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI* |
| Ga0182033_111974132 | 3300016319 | Soil | MIFMRVHKHWLDYDVVALALLVIAIAAVELLTLIF |
| Ga0182033_121083231 | 3300016319 | Soil | PRSFFNGGTIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII |
| Ga0182035_118015722 | 3300016341 | Soil | NGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0182032_102915984 | 3300016357 | Soil | FNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0182040_102153741 | 3300016387 | Soil | MIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF |
| Ga0182037_117179431 | 3300016404 | Soil | MIFMRVHKHWLDYDVVALALLVIAIAAVELLALAF |
| Ga0066662_117807651 | 3300018468 | Grasslands Soil | ILQWRMIFMRALHKHWLDYDVAALAFLIVGIAAVEVLAIIL |
| Ga0210406_106241302 | 3300021168 | Soil | MIFMRVHKHWLDYDVVALAFLVISIAVVELLALIF |
| Ga0126371_109064582 | 3300021560 | Tropical Forest Soil | QGCLHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0126371_123345901 | 3300021560 | Tropical Forest Soil | ETIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII |
| Ga0207684_110737251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF |
| Ga0207700_110209121 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSLFKGGMIFMGVYKHWLDYDAAALAFLIVGIAAVGLIAIII |
| Ga0207700_120206482 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RSLILQRRMIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL |
| Ga0209647_10349887 | 3300026319 | Grasslands Soil | FNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII |
| Ga0209648_100339902 | 3300026551 | Grasslands Soil | MIFMRVHKYWLDYDLAALTLLIIGLAAVELLALII |
| Ga0209693_101194634 | 3300027855 | Soil | FNGGTIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII |
| Ga0209465_100693511 | 3300027874 | Tropical Forest Soil | MIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM |
| Ga0318516_104139722 | 3300031543 | Soil | FIHWLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Ga0318538_100613051 | 3300031546 | Soil | IWLVIRASRSFFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0318538_105646821 | 3300031546 | Soil | MIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Ga0318538_107952802 | 3300031546 | Soil | VFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318538_108198831 | 3300031546 | Soil | MIFVRVYKHWLDYDVAALAFLICGIAAVELIAIII |
| Ga0318573_106911512 | 3300031564 | Soil | FQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318515_107406651 | 3300031572 | Soil | NFQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0310915_100865496 | 3300031573 | Soil | IHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0310915_102183443 | 3300031573 | Soil | MIFMRVHKYWLDHDLAALALLIIGMAAVELLALMM |
| Ga0310915_102899013 | 3300031573 | Soil | MIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF |
| Ga0310915_111628732 | 3300031573 | Soil | MIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0310915_111826231 | 3300031573 | Soil | MIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII |
| Ga0318555_101640611 | 3300031640 | Soil | VIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0318555_106627692 | 3300031640 | Soil | QSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318561_102652262 | 3300031679 | Soil | VIRASRSFFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0318572_102651931 | 3300031681 | Soil | MILMRVHKHWLDYDVVALAFLIIGIAAVELVALIF |
| Ga0318572_108379262 | 3300031681 | Soil | HQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318560_102504101 | 3300031682 | Soil | SVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0306917_100361201 | 3300031719 | Soil | VARWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM |
| Ga0306917_101739815 | 3300031719 | Soil | NGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0306917_109852862 | 3300031719 | Soil | LHSAHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0306918_109090972 | 3300031744 | Soil | MIFMRVHKHWLDYDVVALALLVIAIAAVELLALIF |
| Ga0306918_111903523 | 3300031744 | Soil | IHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318502_109715621 | 3300031747 | Soil | VFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318492_101438692 | 3300031748 | Soil | MIFMRVHKHWLDYDVVALAFLIIGIAAVELVALIF |
| Ga0318492_107028421 | 3300031748 | Soil | IGVTCMRVHKHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0318535_100387481 | 3300031764 | Soil | FFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0318509_100199136 | 3300031768 | Soil | LQWRMIFMRVKHWLDYDVAALALLIVGIAAVEVLAIIL |
| Ga0318509_107920871 | 3300031768 | Soil | VFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0318521_108490202 | 3300031770 | Soil | LVFKSAFIHWLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Ga0318543_100969341 | 3300031777 | Soil | MILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0318548_105502572 | 3300031793 | Soil | CIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318503_100966291 | 3300031794 | Soil | CIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0306919_100232241 | 3300031879 | Soil | TIFMRVYKHWLDHDVAALAFLIVGIVAVELLAMII |
| Ga0318544_101116492 | 3300031880 | Soil | MILMRVHKHWLDYDVVALAFLIIGIAAVELFALIF |
| Ga0318536_106753141 | 3300031893 | Soil | MRVSPVEVLQWRMIFMRVKHWLDYDVAALALLIVGIAAVEVLAIIL |
| Ga0306923_110639472 | 3300031910 | Soil | MIFMRVYEHWLDYDAAALAFLIVGIGAVELLAIII |
| Ga0306921_101559851 | 3300031912 | Soil | NGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF |
| Ga0306921_104155255 | 3300031912 | Soil | FFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0310912_104818453 | 3300031941 | Soil | GMIFMRVYEHWLDYDAAALAFLIVGIGAVELLAIII |
| Ga0310912_113982371 | 3300031941 | Soil | FNFQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0310912_115321821 | 3300031941 | Soil | IIQWGMTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0310916_110364151 | 3300031942 | Soil | AHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0310916_111367331 | 3300031942 | Soil | RLHSAHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0306926_100891277 | 3300031954 | Soil | MILMRVHKHWPDYDVVALAFLIIGIAAVELVALVF |
| Ga0306926_104743063 | 3300031954 | Soil | RWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM |
| Ga0306926_120569032 | 3300031954 | Soil | MIFMRVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Ga0318530_100570111 | 3300031959 | Soil | WRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM |
| Ga0306922_101253796 | 3300032001 | Soil | HQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0306922_102348014 | 3300032001 | Soil | HYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII |
| Ga0318563_100890812 | 3300032009 | Soil | CIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318507_104880111 | 3300032025 | Soil | FNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318532_102746843 | 3300032051 | Soil | FQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318506_100319441 | 3300032052 | Soil | RMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM |
| Ga0318506_104679291 | 3300032052 | Soil | SVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII |
| Ga0318575_100072421 | 3300032055 | Soil | STGNDMRVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| Ga0318533_103175653 | 3300032059 | Soil | FIHWLILQWRMIFVRVYKHWLDYDVAALAFLICGIAAVELIAIII |
| Ga0318533_112563542 | 3300032059 | Soil | GTIFMRVYKHWLDHDVAALAFLIVGIAAVELLAMII |
| Ga0318504_104614361 | 3300032063 | Soil | WLVIRASRSFFNGKMIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF |
| Ga0318514_100679333 | 3300032066 | Soil | LVIRASRSFFNGRMIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF |
| Ga0318514_102739722 | 3300032066 | Soil | LILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII |
| Ga0306924_111267524 | 3300032076 | Soil | MIFMRVRKNWLDYDIAAVTLLMIGLAAVELLAFVIN |
| Ga0306920_1006947701 | 3300032261 | Soil | CIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII |
| ⦗Top⦘ |