


| Basic Information | |
|---|---|
| Family ID | F036978 |
| Family Type | Metagenome |
| Number of Sequences | 169 |
| Average Sequence Length | 48 residues |
| Representative Sequence | FLIGSQLTFTVPVDGRLYLAINDDDYSDNGGSFSVKIRY |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.67 % |
| % of genes near scaffold ends (potentially truncated) | 87.57 % |
| % of genes from short scaffolds (< 2000 bps) | 84.02 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.207 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 14.20 |
| PF04237 | YjbR | 5.92 |
| PF15919 | HicB_lk_antitox | 4.14 |
| PF00072 | Response_reg | 1.78 |
| PF12796 | Ank_2 | 1.78 |
| PF07992 | Pyr_redox_2 | 1.78 |
| PF07676 | PD40 | 1.78 |
| PF00069 | Pkinase | 1.78 |
| PF02852 | Pyr_redox_dim | 1.18 |
| PF01938 | TRAM | 1.18 |
| PF01695 | IstB_IS21 | 1.18 |
| PF02518 | HATPase_c | 1.18 |
| PF11396 | PepSY_like | 1.18 |
| PF00936 | BMC | 0.59 |
| PF04471 | Mrr_cat | 0.59 |
| PF13847 | Methyltransf_31 | 0.59 |
| PF00122 | E1-E2_ATPase | 0.59 |
| PF16355 | DUF4982 | 0.59 |
| PF12680 | SnoaL_2 | 0.59 |
| PF00174 | Oxidored_molyb | 0.59 |
| PF01627 | Hpt | 0.59 |
| PF00486 | Trans_reg_C | 0.59 |
| PF02371 | Transposase_20 | 0.59 |
| PF00271 | Helicase_C | 0.59 |
| PF08388 | GIIM | 0.59 |
| PF00479 | G6PD_N | 0.59 |
| PF03176 | MMPL | 0.59 |
| PF13581 | HATPase_c_2 | 0.59 |
| PF13185 | GAF_2 | 0.59 |
| PF13673 | Acetyltransf_10 | 0.59 |
| PF03100 | CcmE | 0.59 |
| PF03422 | CBM_6 | 0.59 |
| PF13424 | TPR_12 | 0.59 |
| PF02896 | PEP-utilizers_C | 0.59 |
| PF07883 | Cupin_2 | 0.59 |
| PF13858 | DUF4199 | 0.59 |
| PF13946 | DUF4214 | 0.59 |
| PF12833 | HTH_18 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.10 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 5.92 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.18 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.59 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.59 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.59 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.59 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.59 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.59 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.59 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.21 % |
| Unclassified | root | N/A | 14.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_6464261 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101956855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104303303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300000559|F14TC_104282300 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300000574|JGI1357J11328_10049494 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300001431|F14TB_106435203 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300002561|JGI25384J37096_10225677 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300002910|JGI25615J43890_1032463 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300004157|Ga0062590_100694201 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005171|Ga0066677_10491402 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005176|Ga0066679_10106602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300005178|Ga0066688_10503485 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005180|Ga0066685_10536018 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005332|Ga0066388_101503917 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005336|Ga0070680_100657042 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005444|Ga0070694_100066981 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
| 3300005445|Ga0070708_100914436 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005447|Ga0066689_10977206 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → Blastopirellula marina | 522 | Open in IMG/M |
| 3300005536|Ga0070697_101039343 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005543|Ga0070672_101882142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 538 | Open in IMG/M |
| 3300005544|Ga0070686_100058968 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300005560|Ga0066670_10981633 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005563|Ga0068855_101140282 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005566|Ga0066693_10285514 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005568|Ga0066703_10395951 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005576|Ga0066708_10394975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300005586|Ga0066691_10769371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300005616|Ga0068852_100653421 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005616|Ga0068852_100996974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 856 | Open in IMG/M |
| 3300005617|Ga0068859_100368063 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300005617|Ga0068859_100924998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 956 | Open in IMG/M |
| 3300005764|Ga0066903_107881516 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005840|Ga0068870_10668170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300005843|Ga0068860_100379871 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300006032|Ga0066696_10734576 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006794|Ga0066658_10524152 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006797|Ga0066659_11657054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300006800|Ga0066660_10462492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1062 | Open in IMG/M |
| 3300006800|Ga0066660_11424316 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006847|Ga0075431_101408793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300006871|Ga0075434_101188485 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300006871|Ga0075434_101371704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300006881|Ga0068865_100329122 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300009012|Ga0066710_101158516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300009088|Ga0099830_11381866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300009090|Ga0099827_11982002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009094|Ga0111539_10018818 | All Organisms → cellular organisms → Bacteria | 8545 | Open in IMG/M |
| 3300009094|Ga0111539_10479021 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1449 | Open in IMG/M |
| 3300009100|Ga0075418_12037402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300009143|Ga0099792_10742819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300009147|Ga0114129_10337943 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300009147|Ga0114129_11260940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300009148|Ga0105243_10551586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300009148|Ga0105243_10662511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1013 | Open in IMG/M |
| 3300009177|Ga0105248_10979910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300009177|Ga0105248_11345733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 808 | Open in IMG/M |
| 3300009177|Ga0105248_12800058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300010301|Ga0134070_10203413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 727 | Open in IMG/M |
| 3300010358|Ga0126370_11165987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300010361|Ga0126378_12402220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300010362|Ga0126377_12872862 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010375|Ga0105239_10525164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300010398|Ga0126383_13234874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010401|Ga0134121_12972196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010403|Ga0134123_11057975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300011119|Ga0105246_11295536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300011271|Ga0137393_10894134 | Not Available | 758 | Open in IMG/M |
| 3300012096|Ga0137389_10205353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300012185|Ga0136619_10173060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300012205|Ga0137362_10535678 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300012205|Ga0137362_10974051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300012205|Ga0137362_11049172 | Not Available | 693 | Open in IMG/M |
| 3300012207|Ga0137381_11188752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300012227|Ga0137449_1018915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
| 3300012285|Ga0137370_10545544 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012349|Ga0137387_10783348 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012350|Ga0137372_10796313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300012351|Ga0137386_11140837 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012353|Ga0137367_10122918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1904 | Open in IMG/M |
| 3300012354|Ga0137366_10469294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012354|Ga0137366_10835188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012354|Ga0137366_11160099 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012357|Ga0137384_10575276 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012357|Ga0137384_10683041 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012360|Ga0137375_11404831 | Not Available | 519 | Open in IMG/M |
| 3300012532|Ga0137373_11042618 | Not Available | 589 | Open in IMG/M |
| 3300012532|Ga0137373_11240803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012684|Ga0136614_11221088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012913|Ga0157298_10425930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012923|Ga0137359_10390860 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300012923|Ga0137359_10396988 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300012927|Ga0137416_10285016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300012971|Ga0126369_12046172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012977|Ga0134087_10201473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300013297|Ga0157378_13305996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300013308|Ga0157375_10417351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300013308|Ga0157375_11395988 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300015078|Ga0167660_1010403 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300015241|Ga0137418_11111995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300015357|Ga0134072_10240821 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300015371|Ga0132258_10771039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2423 | Open in IMG/M |
| 3300015373|Ga0132257_100389990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300016357|Ga0182032_10115564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300017656|Ga0134112_10314348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300017792|Ga0163161_10806950 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300018076|Ga0184609_10364721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300018083|Ga0184628_10454398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300018482|Ga0066669_12426958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300019767|Ga0190267_11093599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300019885|Ga0193747_1010376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2243 | Open in IMG/M |
| 3300020202|Ga0196964_10031164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2212 | Open in IMG/M |
| 3300024290|Ga0247667_1069958 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025315|Ga0207697_10382332 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025325|Ga0209341_10538216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300025917|Ga0207660_10508425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura barringtoniae | 978 | Open in IMG/M |
| 3300025918|Ga0207662_10567645 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025924|Ga0207694_11221116 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300025926|Ga0207659_11213615 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300025930|Ga0207701_10965760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300025933|Ga0207706_10171908 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300025940|Ga0207691_11190796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 632 | Open in IMG/M |
| 3300025941|Ga0207711_10411441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300026035|Ga0207703_10433356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
| 3300026088|Ga0207641_10928091 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300026089|Ga0207648_10278435 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300026142|Ga0207698_10968391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 860 | Open in IMG/M |
| 3300026295|Ga0209234_1175741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300026309|Ga0209055_1139287 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026313|Ga0209761_1137007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300026335|Ga0209804_1075151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| 3300027383|Ga0209213_1100051 | Not Available | 536 | Open in IMG/M |
| 3300027591|Ga0209733_1009031 | Not Available | 2605 | Open in IMG/M |
| 3300027678|Ga0209011_1011162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2996 | Open in IMG/M |
| 3300027787|Ga0209074_10132846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300027875|Ga0209283_10154467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1522 | Open in IMG/M |
| 3300027875|Ga0209283_10517753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300027907|Ga0207428_11301377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300027909|Ga0209382_10255358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
| 3300028536|Ga0137415_10396433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1112534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300031740|Ga0307468_100503925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300031820|Ga0307473_10622737 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031892|Ga0310893_10270668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300031903|Ga0307407_10338012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300032180|Ga0307471_100563751 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300032180|Ga0307471_104076561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300032205|Ga0307472_100294139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300033412|Ga0310810_10332683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300034172|Ga0334913_056763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300034221|Ga0334937_229664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.78% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.18% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.59% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.59% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.59% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.59% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001326 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0479.00003120 | 2162886012 | Miscanthus Rhizosphere | IGYIRQPSGQPSPVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY |
| INPhiseqgaiiFebDRAFT_1019568551 | 3300000364 | Soil | LSPPYLVGSNLSTSVPMDGRLILAVNDDNYNDNSGSFSVRIRY* |
| INPhiseqgaiiFebDRAFT_1043033032 | 3300000364 | Soil | QPFLIGSQLTFTVPADGRLYLAVNDDDYSDNGGAFKVTIKY* |
| F14TC_1042823003 | 3300000559 | Soil | ALIGYIRQPNGQASQAFLVGTQLILSVPADGRLYLAINDDDYSDNGGGFRVKIRY* |
| JGI1357J11328_100494942 | 3300000574 | Groundwater | LSSPYLIGSQLSATVPADGRLILLVNDDNYSDNSGSFTVRIRY* |
| JGI11643J11755_115675452 | 3300000787 | Soil | SQSTFTAQVDGRLYLVVNDDNYTDNSGSFSVRIVYPDNR* |
| A2835W6_10305791 | 3300001326 | Permafrost | QSTFTSPADGRLFLLVNDDNYSDNTGSFSARIVYPDYR* |
| F14TB_1064352031 | 3300001431 | Soil | PGALIGFIRLANGQTSQPFLVGSQLTLNVPADPRLYLGINDDNYSDNGGSFKVTIKY* |
| JGI25384J37096_102256772 | 3300002561 | Grasslands Soil | GPGALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIRY* |
| JGI25615J43890_10324632 | 3300002910 | Grasslands Soil | DGQQTEAFLIGSQLTFTVPADGRLFLAINDDDYSDNSGSFSVKIRY* |
| Ga0062590_1006942011 | 3300004157 | Soil | GALIGYIRQPNGQVSQPFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVRIRY* |
| Ga0062594_1012249791 | 3300005093 | Soil | VFLVGSQATFTTPVDGRLYLLVNDDNYGDNSGSFTARIVYPDNR* |
| Ga0066677_104914021 | 3300005171 | Soil | LSQAYLIGSQLSTTVPTDGRLILAINDDDYSDNSGSFSVRIRH* |
| Ga0066679_101066021 | 3300005176 | Soil | NGQLSQAYLIGSNLTTTVPTDGRLILAINDDDYSDNRGSFSVRIRY* |
| Ga0066688_105034853 | 3300005178 | Soil | YIRMSNGQLSQAYLVGSQLSSTVPVDGRLILAINDDDYSDNSGSFSVRIRH* |
| Ga0066685_105360182 | 3300005180 | Soil | DSQQLQAFVIGSQLTFTVPSDGRLYLAINDDDYSDNSGSFSVRIRY* |
| Ga0066388_1015039171 | 3300005332 | Tropical Forest Soil | QSDGQSSQAFLVGTQLTLKVPADGRLFLAINDDNYSDNSGAFKVKIRH* |
| Ga0070680_1006570422 | 3300005336 | Corn Rhizosphere | FLVGSQLTFTVPVDGRLYLLINDDNYSDNGGTFNVRIRY* |
| Ga0070694_1000669814 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GIVGTRPLPNSGPGALIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0070708_1009144362 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGALIAYIRMLNGQLSQAYLIGSQLSTTVPVEGRLILAINDDDYSDNGGSFSVRIKY* |
| Ga0066689_109772061 | 3300005447 | Soil | LIGYIRTPDGQQSPAFLIGSQLTFTVPVDGRLYLAINDDDFSDNSGSFSVRIRY* |
| Ga0070697_1010393431 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GALIAYIRMPNGQMSQAYLIGSQLSTTVPLDGRLILAINDDDYSDNGGSFTVRIRY* |
| Ga0070672_1018821422 | 3300005543 | Miscanthus Rhizosphere | PGALIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0070686_1000589684 | 3300005544 | Switchgrass Rhizosphere | GPGALIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0070693_1011699441 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GSQSTFTAQVDGRLYLVVNDDNYTDNSGSFSVRIVYPENR* |
| Ga0066670_109816331 | 3300005560 | Soil | GALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKVRY* |
| Ga0068855_1011402822 | 3300005563 | Corn Rhizosphere | GQASQAFLVGTQLTLSVPADGRLYLAINDDDYSDNGGAFKVRIRY* |
| Ga0066693_102855143 | 3300005566 | Soil | GALIAYIRMSNGQLSQAYLIGSQLSTTVPTDGRLILAINDDDYSDNSGSFSVKVRY* |
| Ga0066703_103959511 | 3300005568 | Soil | YLIGSQLSTTVPTDGRLILAINDDDYSDNSGSFSVKIRY* |
| Ga0066708_103949752 | 3300005576 | Soil | SLTTTVPMDGRLILAVNDDDYSDNSGSFSVRIRY* |
| Ga0068857_1023656261 | 3300005577 | Corn Rhizosphere | GNQATFTTPVDGRLYLMVNDDNFSDNSGSFSARIVYPSFR* |
| Ga0066691_107693712 | 3300005586 | Soil | AYVRMANGQLSQPYLVGSHLDGTVPVDGRLILAINDDNYSDNSGSFSVRIRY* |
| Ga0068852_1006534212 | 3300005616 | Corn Rhizosphere | VGTQLTFSVPVDGRLYLAINDDDYSDNGGGFKVRIRY* |
| Ga0068852_1009969742 | 3300005616 | Corn Rhizosphere | QLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0068859_1003680632 | 3300005617 | Switchgrass Rhizosphere | PGALIGYIRQQNGQSSQPFLVGTQLTFSVPVDGRLYLAINDDDYSDNGGGFKVRIRY* |
| Ga0068859_1009249981 | 3300005617 | Switchgrass Rhizosphere | ALIGYIRQPNGQASQPFLVGTQLTLTAPADGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0066903_1078815162 | 3300005764 | Tropical Forest Soil | QLSPAYLVGSHLTTTAPMDGRLILAVNDDNYNDNSGSFSVTIRY* |
| Ga0068870_106681701 | 3300005840 | Miscanthus Rhizosphere | QPNGQASQPFLVGTQLVLSVPIEGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0068860_1003798711 | 3300005843 | Switchgrass Rhizosphere | YIRNVNGSLSPAYLVGSNLTTSVPMDGRLILAVNDDNYNDNSGTFRVTVRY* |
| Ga0066696_107345761 | 3300006032 | Soil | MSQPFLVGPSLTTTVPMDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0066658_105241521 | 3300006794 | Soil | YFIGSQLSTTVPADGRLILAINDDDYSDNSGSFSVRIRH* |
| Ga0066659_116570542 | 3300006797 | Soil | SQLTFTVPVEGRLYLAINDDDYSDNSGSFSVRIRY* |
| Ga0066660_104624922 | 3300006800 | Soil | QLSTTVPADGRLILAINDDDYSDNSGSFSVRIRH* |
| Ga0066660_114243162 | 3300006800 | Soil | QLSTTVPTDGRLILAINDDDYSDNSGSFSVRIRH* |
| Ga0075431_1014087931 | 3300006847 | Populus Rhizosphere | GSQLTISAPADGRLYLAINDDDYSDNGGAFKVTIRY* |
| Ga0075434_1011884851 | 3300006871 | Populus Rhizosphere | DANGQASQPFLVGPSVTMTVPVDGRLILAINDDNYNDNSGSFSVRIRY* |
| Ga0075434_1013717042 | 3300006871 | Populus Rhizosphere | MANGQLSPPYLIGSNLTTSVPMDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0068865_1003291221 | 3300006881 | Miscanthus Rhizosphere | SQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0066710_1011585162 | 3300009012 | Grasslands Soil | YIRMSNGQLSQAYLIGSQLSTTVPVDGRLILAINDDDYSDNSGSFSVKIRY |
| Ga0099830_113818662 | 3300009088 | Vadose Zone Soil | QLAGTVPTDGRLILAINDDNYGDNSGSFSVRIRY* |
| Ga0099827_119820022 | 3300009090 | Vadose Zone Soil | YLIGSHLDATVPVDGRLILLINDDNYNDNSGSFSVRIRY* |
| Ga0111539_1001881810 | 3300009094 | Populus Rhizosphere | QASQPFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGSGFKVKIRY* |
| Ga0111539_104790213 | 3300009094 | Populus Rhizosphere | VATAGAGALIGVIRQPNGQTTQAFLVGSQLTFTIPVDGRLYLLINDDNYSDNGGAFKVTIRY* |
| Ga0075418_120374021 | 3300009100 | Populus Rhizosphere | GALIGFIRQLNGQASQVFLVGTQLTLSVPVDGRLYLAINDDDFSDNGGAFKVKIRY* |
| Ga0099792_107428191 | 3300009143 | Vadose Zone Soil | YIRMSNGQLSQAYLIGSNLTTTVPTDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0114129_103379434 | 3300009147 | Populus Rhizosphere | VFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGAFKVKIRY* |
| Ga0114129_112609401 | 3300009147 | Populus Rhizosphere | NGQASQVFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0105243_105515861 | 3300009148 | Miscanthus Rhizosphere | SQPYLIGANLSTTVPVDGRLILAINDDDFSDNSGSFSVRIRY* |
| Ga0105243_106625112 | 3300009148 | Miscanthus Rhizosphere | PLPNSGPGALIGYIRQPSGQPSPVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0105242_123941762 | 3300009176 | Miscanthus Rhizosphere | LVGDQMTLTVPSDGRLFLLVNDDNYSDNTGSFSVRIQYPDNR* |
| Ga0105248_109799102 | 3300009177 | Switchgrass Rhizosphere | FFIGSSLTYNTTTDGRLYLAINDDNYNDNSGSFTVRIRY* |
| Ga0105248_113457332 | 3300009177 | Switchgrass Rhizosphere | GPQLTFTAPADGRLYLLINDDNYSDNGGVFRVKIKY* |
| Ga0105248_128000581 | 3300009177 | Switchgrass Rhizosphere | IRNVNGSLSPAYLVGSNLTTSVPMDGRLILAVNDDNYNDNSGTFRVTVRY* |
| Ga0126309_105659372 | 3300010039 | Serpentine Soil | IGDQMTLTASTDGRLFLLVNDDNYNDNSGSFSARVVYPEYR* |
| Ga0134070_102034131 | 3300010301 | Grasslands Soil | GALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIRY* |
| Ga0126370_111659871 | 3300010358 | Tropical Forest Soil | SNLSSSVPMDGRLILAVNDDNYNDNSGSFSVRVRY* |
| Ga0126378_124022202 | 3300010361 | Tropical Forest Soil | YLVGSNLSSSVPMDGRLILAVNDDNYNDNSGSFSVRVRY* |
| Ga0126377_128728621 | 3300010362 | Tropical Forest Soil | LIGYLRTPDGQQTPAFLIGTQMTYTAQADGRLYLAINDDDYSDNGGSFSVTIRY* |
| Ga0105239_105251642 | 3300010375 | Corn Rhizosphere | RQPNGQASQAFLVGTQLTLSVPADGRLYLAINDDDYSDNGGAFKVRIRY* |
| Ga0126383_132348742 | 3300010398 | Tropical Forest Soil | FLIGSNQSTTVPMDGRLILAVNDDNYSDNTGSFSVKIKY* |
| Ga0134121_129721961 | 3300010401 | Terrestrial Soil | QTSQAYLIGSNLTTTVPTDGRLFLAVNDDDYSDNSGAFSVRIRY* |
| Ga0134123_110579752 | 3300010403 | Terrestrial Soil | NGQLSPPYLVGSNLSTSVPMDGRLILAVNDDNYNDNSGSFSVRIRY* |
| Ga0105246_112955361 | 3300011119 | Miscanthus Rhizosphere | GPGALIGYIRQQNGQASQPFLVGTQLSFSVPVDGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0137393_108941341 | 3300011271 | Vadose Zone Soil | GQQSQPFLIGSQLTFTVPADGRLYLEINDDDYSDNGGSFSVKIRY* |
| Ga0137389_102053531 | 3300012096 | Vadose Zone Soil | YIRTTDGQQSQPFLIGTQLTLTIPTDGRLYLAINDDDYSDNGGSFSVKIRY* |
| Ga0136619_101730601 | 3300012185 | Polar Desert Sand | VGPQLTFTAQSDGRLILLINDDNYNDNSGNFSVRINVN* |
| Ga0137383_109081232 | 3300012199 | Vadose Zone Soil | GQTTQPFLVGNQVTLTAASDGRLFLLVNDDNYSDNSGSFSARIQYPDNR* |
| Ga0137362_105356783 | 3300012205 | Vadose Zone Soil | GQQTQAFLIGSQLAFTVPVDGRLYLAINDDDYSDNGGSFSVKIRY* |
| Ga0137362_109740512 | 3300012205 | Vadose Zone Soil | MSNGQLSQPYLIGSQLSTSVPVDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0137362_110491721 | 3300012205 | Vadose Zone Soil | PGALIAYIRMSNGQLSQPYLIGSQLSTSVPVDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0137381_111887521 | 3300012207 | Vadose Zone Soil | GPGALIGYIRTPDGQQSPAFLIGSQLTFTVPVDGRLYLAINDDDYSDNGGSFSVRIRY* |
| Ga0137449_10189151 | 3300012227 | Soil | SQLSSTVPVDGRLILAINDDNYNDNSGSFSVRIRY* |
| Ga0137370_105455441 | 3300012285 | Vadose Zone Soil | IGSQSTFTVPVDGRLYLAINDDDYSDNSGSFSVRIKY* |
| Ga0137387_107833482 | 3300012349 | Vadose Zone Soil | PGALIAYIRMSNGQLSQAYLIGSQLSTTVPVDGRLILAINDDDYSDNSGSFSVKIRY* |
| Ga0137372_107963132 | 3300012350 | Vadose Zone Soil | QQTQAFLIGSQLTFTAPADGRLYLAINDDDYSDNGGTFSVRIRY* |
| Ga0137386_111408371 | 3300012351 | Vadose Zone Soil | SQSTFTVPVDGRLYLAINDDDYSDNSGSFSVKIRY* |
| Ga0137367_101229182 | 3300012353 | Vadose Zone Soil | NAGPGALIGYIRLLDGQQMQAFLIGSQLSFTAPADGRLFLAINDDNYSDNSGSFSVRIRY |
| Ga0137366_104692941 | 3300012354 | Vadose Zone Soil | IVGTKPVPSAGPGALIGYIRTPDGQQTQAFLIGSQLTFTAPSDGRLYLAINDDDYSDNGGTFSVRIRY* |
| Ga0137366_108351881 | 3300012354 | Vadose Zone Soil | IVGTKPVPSAGPGALIGYIRTPDGQQTQAFLIGSQLTFTAPADGRLYLAINDDDYSDNGGTFSVRIRY* |
| Ga0137366_111600992 | 3300012354 | Vadose Zone Soil | IGFIRMSDGQNSQPFFIGSQLSFTAQTEGRLVLAINDDDYSDNGGSFTVRIRY* |
| Ga0137384_105752761 | 3300012357 | Vadose Zone Soil | GTKPVPSAGPGALIGYIRTSDGQQSQAFLIGSQSTFTVPVDGRLYLAINDDDYSDNSGSFSVRIKY* |
| Ga0137384_106830411 | 3300012357 | Vadose Zone Soil | QTQAFLIGSQLTFTAPADGRLYLAINDDDYSDNGGTFSVRIRY* |
| Ga0137375_114048312 | 3300012360 | Vadose Zone Soil | GSNLTTSVPVDGRLILAINDDDFSDNSGSFSVRIRY* |
| Ga0137373_110426182 | 3300012532 | Vadose Zone Soil | RTPDGQQTQAFLIGSQLTFTAPADGRLYLAINDDDYSDNGGSFSVRIRY* |
| Ga0137373_112408031 | 3300012532 | Vadose Zone Soil | IGSQLTFTAPADGRLYLAINDDDYSDNGGTFSVRIRY* |
| Ga0136614_112210881 | 3300012684 | Polar Desert Sand | FYIGSQQTLTAPADGRLILLINDDNYNDNGGSFVVRIRVN* |
| Ga0157298_104259301 | 3300012913 | Soil | RPLPNSGPGALIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0137359_103908604 | 3300012923 | Vadose Zone Soil | GQLSQPYLIGSQLSTSVPVDGRLILAINDDDYSDNSGSFSVRIRY* |
| Ga0137359_103969884 | 3300012923 | Vadose Zone Soil | PVPNAGPGALIGYIRTSDGQQTQAFLIGSQLAFTVPVDGRLYLAINDDDYSDNGGSFSVKIRY* |
| Ga0137416_102850162 | 3300012927 | Vadose Zone Soil | YIRMPNGQLSQAYLIGSQLTTTVPADGRLILAINDDDYSDNGGSFTVRIRY* |
| Ga0126369_120461721 | 3300012971 | Tropical Forest Soil | GPGALIGYIRQANGQSSQVFLVGTQLNLSVPADGRLYLAINDDDYSDNSGAFKVKISY* |
| Ga0134087_102014732 | 3300012977 | Grasslands Soil | AYIRDANGQMSQPFLVGPSLTTTVPMDGRLILAVNDDDYSDNSGSFSVRIRY* |
| Ga0157378_124771941 | 3300013297 | Miscanthus Rhizosphere | DQMTLTVPSDGRLFLLVNDDNYSDNTGSFSVRIQYPDNR* |
| Ga0157378_133059961 | 3300013297 | Miscanthus Rhizosphere | SPPYLVGSNLTTSVPMDGRLILAVNDDNYNDNSGSFSVRIRY* |
| Ga0163162_113112741 | 3300013306 | Switchgrass Rhizosphere | YFFIGSQATFTIPVDGRLFLAVNDDNYSDNSGSFSVRLVYPAFR* |
| Ga0157375_104173511 | 3300013308 | Miscanthus Rhizosphere | LIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY* |
| Ga0157375_113959882 | 3300013308 | Miscanthus Rhizosphere | AIVGTRPLPTSGPGALIGYIRQPNGQVSQPFLLGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0167660_10104031 | 3300015078 | Glacier Forefield Soil | GALIAYIRQANGQLSAAYLVGSQLSTSVPADGRLILAINDDNYGDNSGSFSVRIRY* |
| Ga0137418_111119951 | 3300015241 | Vadose Zone Soil | AYVRMANGQLSQPYLVGSQLDGTVPVDGRLILAINDDNYSDNSGSFSVRIRY* |
| Ga0134072_102408212 | 3300015357 | Grasslands Soil | PTAGPGALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIRY* |
| Ga0132258_107710391 | 3300015371 | Arabidopsis Rhizosphere | TRPVPTAGPGALIGYIRMTNGQTSQPFLIGSQLTFTVPSDGRLYLAVNDDDYSDNGGAFKVTIKY* |
| Ga0132257_1003899902 | 3300015373 | Arabidopsis Rhizosphere | SGPGALIGYIRQPNGQASQPFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVKIRY* |
| Ga0182032_101155641 | 3300016357 | Soil | PYLIGSNLSSSVPMDGRLILAVNDDNYNDNSGSFSVRVRY |
| Ga0134112_103143482 | 3300017656 | Grasslands Soil | MSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIRY |
| Ga0163161_108069501 | 3300017792 | Switchgrass Rhizosphere | MANGQLSPPYLVGSNLTTSVPMDGRLILAVNDDNYSDNSGSFSVRIRY |
| Ga0184618_104343161 | 3300018071 | Groundwater Sediment | LTATAPSDGRLFLLVNDDNYTDNSGSFSVRIQYPDNR |
| Ga0184609_103647212 | 3300018076 | Groundwater Sediment | SAGPGALIGYIRLANGQVSQPFLVGSQLTLTMPADGRLYLAINDDDYSDNGGGFKVRIKY |
| Ga0184628_104543981 | 3300018083 | Groundwater Sediment | GSNLTTSVPMDGRLILAVNDDNYNDNSGTFRVTVRY |
| Ga0190265_103261072 | 3300018422 | Soil | GGGTTQPFLVGSQLVFTAQTDGRLYLLVNDDDYGDNSGSFSVRIVYQDIR |
| Ga0190272_101688822 | 3300018429 | Soil | LIGSQMTFTAPVDGRLYLLVNDDNYGDNSGSFSARIVYPENR |
| Ga0066669_124269581 | 3300018482 | Grasslands Soil | PDGQTSQPFLIGSQLTFTVPADGRWYLAINDDDFSDNSGSFSVRIRY |
| Ga0190267_110935991 | 3300019767 | Soil | QNSQPFFVGSSLVWTATADGRLYLLVNDDNYNDNSGSFSVRIRLN |
| Ga0193725_10679331 | 3300019883 | Soil | AGSQVTLTVPADGRLYLLVNDDNYSDNSGSFSVRIVYPDYR |
| Ga0193747_10103761 | 3300019885 | Soil | IRMSNGQLSPAYLIGSQLTTTVPADGRLILAINDDDYSDNGGSFSVRIRY |
| Ga0193755_10601401 | 3300020004 | Soil | VFLVGSQATLTTPVDGRLYLMVNDDNYSDNSGSFSARVVYPDYR |
| Ga0196964_100311641 | 3300020202 | Soil | GANFSATAPADGRLILLINDDNYSDNGGSFEVRITVN |
| Ga0247667_10699583 | 3300024290 | Soil | YLIGSQLTTSVPVDGRLILAINDDDYSDNSGSFNVIVRY |
| Ga0207697_103823322 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | QNGQASQPFLVGTQLTFSVPVDGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0209341_105382162 | 3300025325 | Soil | IGSQLTITIQVDGRLYLAINDDDYSDNGGSFNVKISYR |
| Ga0207660_105084253 | 3300025917 | Corn Rhizosphere | LPTSGPGALIGYIRQQNGQASQPFLVGTQLTFSVPVDGRLYLLINDDNYSDNGGTFNVRIRY |
| Ga0207662_105676452 | 3300025918 | Switchgrass Rhizosphere | LIGYIRQPNGQASQPFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0207646_117922852 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVGSQATFTTPVDGRLYLLVNDDNYGDNSGSFTARIVYPDYR |
| Ga0207694_112211162 | 3300025924 | Corn Rhizosphere | MSQPFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVRIR |
| Ga0207659_112136151 | 3300025926 | Miscanthus Rhizosphere | SQPFLVGTQLTFSVPVDGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0207701_109657601 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | IRMANGNLSPPYLIGSNLATSAPMDGRLILAVNDDNYNDNTGSFSVRIRY |
| Ga0207706_101719083 | 3300025933 | Corn Rhizosphere | QPNGQTSQAFLVGSQLTFTVPVDGRLYLLINDDNYSDNGGTFNVRIRY |
| Ga0207670_108686821 | 3300025936 | Switchgrass Rhizosphere | SQATFTTPVDGRLYLAINDDNYTDNSGSFSVRLVYPSFR |
| Ga0207691_111907961 | 3300025940 | Miscanthus Rhizosphere | PLPNSGPGALIGYIRQPSGQPSQVFLVGPQLTFTAPADGRLYLLINDDNYSDNGGVFKVKIKY |
| Ga0207711_104114411 | 3300025941 | Switchgrass Rhizosphere | VGTRPLPNSGPGALIGYIRQPNGQASQPFLVGTQLVLSVPIEGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0207703_104333561 | 3300026035 | Switchgrass Rhizosphere | PFLVGTQLTFSVPVDGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0207641_109280911 | 3300026088 | Switchgrass Rhizosphere | GTRPLPNSGPGALIGYIRQPNGQASQAFLVGTQLILSVPADGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0207648_102784351 | 3300026089 | Miscanthus Rhizosphere | LVGSNLSTSVPMDGRLILAVNDDNYNDNSGSFSVRIRY |
| Ga0207698_109683911 | 3300026142 | Corn Rhizosphere | IGSQATFTIPVDGRLFLAVNDDNYSDNSGSFSVRLVYPAFR |
| Ga0209234_11757411 | 3300026295 | Grasslands Soil | PTAGPGALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIR |
| Ga0209055_11392871 | 3300026309 | Soil | YFIGSQLSTTVPADGRLILAINDDDYSDNSGSFSVRIRH |
| Ga0209761_11370071 | 3300026313 | Grasslands Soil | AGPGALIGYIRMSNGQLSSAYLIGSQLSASAPADGRLILAINDDDYSDNSGSFSVKIRY |
| Ga0209804_10751511 | 3300026335 | Soil | GSQLTLTIPADGRLYLAINDDDYSDNSGSFSVRIRY |
| Ga0209213_11000512 | 3300027383 | Forest Soil | MPDGQMSQAYLIGSQLSSTVPVDGRLILAINDDDYSDNGGSFTVRIRY |
| Ga0209733_10090314 | 3300027591 | Forest Soil | TSQAFLIGSQLTFTAPTDGRLYLAINDDNYSDNSGSFSVRIRY |
| Ga0209011_10111624 | 3300027678 | Forest Soil | KPVPSAGPGALIGYLRLADGQTTAAFLIGSQLIYTATADGRLFLAINDDDYSDNGGSFSVKIKY |
| Ga0209074_101328461 | 3300027787 | Agricultural Soil | IGSSLTYNATTDGRLYLAINDDNYNDNSGSFTVRIRY |
| Ga0209283_101544674 | 3300027875 | Vadose Zone Soil | FLIGSQLTFTVPVDGRLYLAINDDDYSDNGGSFSVKIRY |
| Ga0209283_105177532 | 3300027875 | Vadose Zone Soil | RTSDGQQSQPFLIGSQLTFTVPVDGRLYLAINDDDYSDNGGSFSVKIRY |
| Ga0207428_113013772 | 3300027907 | Populus Rhizosphere | AIVGTRPVPNAGAGALIGFIRQPNGQTSQAFLVGSQLTFTVPVDGRLYLLINDDNYSDNGGAFKVTIRY |
| Ga0209382_102553582 | 3300027909 | Populus Rhizosphere | PGALIGYIRQPNGQASQVFLVGTQLTLSVPVDGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0137415_103964332 | 3300028536 | Vadose Zone Soil | YIRMPNGQLSQAYLIGSQLTTTVPADGRLILAINDDDYSDNGGSFTVRIRY |
| (restricted) Ga0255312_11125341 | 3300031248 | Sandy Soil | VGTRPVPTAGPGALIGYIRMDNGQMSQPFLIGSQLTLSVPADGRLYLAVNDDDYSDNGGAFKVTIRY |
| Ga0307513_111120921 | 3300031456 | Ectomycorrhiza | QATLTTPVDGRLYLMVNDDNFSDNSGSFSARIVYPEFRQ |
| Ga0307468_1005039252 | 3300031740 | Hardwood Forest Soil | LPSSGPGALIGYIRQPDGQTSQPFLVGTQLTFSVPIDGRLYLAINDDDYSDNGSGFKVRVRY |
| Ga0307468_1005829731 | 3300031740 | Hardwood Forest Soil | SQATITIPADGRLYLMVNDDNFSDNSGSFTVVVTYPDYR |
| Ga0307473_106227371 | 3300031820 | Hardwood Forest Soil | GALIGYIRTLDGQQAPAFLIGTQMTYTVQADGRLFLAINDDDYSDNGGSFSVRIRY |
| Ga0310893_102706681 | 3300031892 | Soil | SQLTFTVPVDGRLYLLINDDNYSDNGGTFNVRIRY |
| Ga0307407_103380121 | 3300031903 | Rhizosphere | SGPGALIGYIRQPNGQASQAFLVGTQLTLSVPADGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0307471_1005637511 | 3300032180 | Hardwood Forest Soil | GYIRQSNGQASQPFLVGTQLTLSVPVDGRLYLVINDDDYSDNGGAFKVKIRY |
| Ga0307471_1040765611 | 3300032180 | Hardwood Forest Soil | QSPAFLIGNQLTYTVPVDGRLYLAINDDDYSDNGGSFSVTIRR |
| Ga0307472_1002941392 | 3300032205 | Hardwood Forest Soil | TNAGPGALIGYIRTPDGQQSPAFLIGSQLTLTVPVDGRLYLAINDDDYSDNGGSFSVRIR |
| Ga0310810_103326831 | 3300033412 | Soil | GQASQPFLVGTQLTLTAPADGRLYLAINDDDYSDNGGGFKVKIRY |
| Ga0334913_056763_2_169 | 3300034172 | Sub-Biocrust Soil | LIGFIRTSSGQISQPFLIGNQLTFNAQTDGRLILAINDDDYSDNGGNFAVRIRVN |
| Ga0334937_229664_2_115 | 3300034221 | Biocrust | GNQLTFNAQTDGRLILAINDDDYSDNGGNFAVRIRVN |
| ⦗Top⦘ |