


| Basic Information | |
|---|---|
| Family ID | F036903 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VLVKQGKIKDALAKYDEALKYAPNWKQLKDVREAAAKQKT |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.98 % |
| % of genes near scaffold ends (potentially truncated) | 66.86 % |
| % of genes from short scaffolds (< 2000 bps) | 82.84 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.864 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (24.260 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.136 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.663 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF13676 | TIR_2 | 2.96 |
| PF13495 | Phage_int_SAM_4 | 2.37 |
| PF00248 | Aldo_ket_red | 1.78 |
| PF10503 | Esterase_PHB | 1.78 |
| PF13336 | AcetylCoA_hyd_C | 1.18 |
| PF00583 | Acetyltransf_1 | 1.18 |
| PF01546 | Peptidase_M20 | 1.18 |
| PF00625 | Guanylate_kin | 1.18 |
| PF01850 | PIN | 1.18 |
| PF04237 | YjbR | 1.18 |
| PF13414 | TPR_11 | 1.18 |
| PF01170 | UPF0020 | 1.18 |
| PF13683 | rve_3 | 1.18 |
| PF07638 | Sigma70_ECF | 1.18 |
| PF00072 | Response_reg | 0.59 |
| PF00106 | adh_short | 0.59 |
| PF01124 | MAPEG | 0.59 |
| PF13458 | Peripla_BP_6 | 0.59 |
| PF02050 | FliJ | 0.59 |
| PF05368 | NmrA | 0.59 |
| PF03795 | YCII | 0.59 |
| PF13410 | GST_C_2 | 0.59 |
| PF13474 | SnoaL_3 | 0.59 |
| PF03062 | MBOAT | 0.59 |
| PF05598 | DUF772 | 0.59 |
| PF02472 | ExbD | 0.59 |
| PF00440 | TetR_N | 0.59 |
| PF07992 | Pyr_redox_2 | 0.59 |
| PF00486 | Trans_reg_C | 0.59 |
| PF00135 | COesterase | 0.59 |
| PF04333 | MlaA | 0.59 |
| PF08818 | DUF1801 | 0.59 |
| PF05199 | GMC_oxred_C | 0.59 |
| PF04972 | BON | 0.59 |
| PF13280 | WYL | 0.59 |
| PF14384 | BrnA_antitoxin | 0.59 |
| PF02954 | HTH_8 | 0.59 |
| PF12779 | WXXGXW | 0.59 |
| PF02129 | Peptidase_S15 | 0.59 |
| PF01565 | FAD_binding_4 | 0.59 |
| PF00563 | EAL | 0.59 |
| PF11453 | DUF2950 | 0.59 |
| PF01638 | HxlR | 0.59 |
| PF13673 | Acetyltransf_10 | 0.59 |
| PF01678 | DAP_epimerase | 0.59 |
| PF07642 | BBP2 | 0.59 |
| PF13181 | TPR_8 | 0.59 |
| PF04828 | GFA | 0.59 |
| PF16491 | Peptidase_M48_N | 0.59 |
| PF14534 | DUF4440 | 0.59 |
| PF07719 | TPR_2 | 0.59 |
| PF13520 | AA_permease_2 | 0.59 |
| PF02690 | Na_Pi_cotrans | 0.59 |
| PF01872 | RibD_C | 0.59 |
| PF00753 | Lactamase_B | 0.59 |
| PF00069 | Pkinase | 0.59 |
| PF13502 | AsmA_2 | 0.59 |
| PF09851 | SHOCT | 0.59 |
| PF08386 | Abhydrolase_4 | 0.59 |
| PF13291 | ACT_4 | 0.59 |
| PF09360 | zf-CDGSH | 0.59 |
| PF01987 | AIM24 | 0.59 |
| PF13193 | AMP-binding_C | 0.59 |
| PF13378 | MR_MLE_C | 0.59 |
| PF04185 | Phosphoesterase | 0.59 |
| PF13453 | zf-TFIIB | 0.59 |
| PF03458 | Gly_transporter | 0.59 |
| PF15902 | Sortilin-Vps10 | 0.59 |
| PF00561 | Abhydrolase_1 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.37 |
| COG2882 | Flagellar biosynthesis chaperone FliJ | Cell motility [N] | 1.78 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 1.18 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 1.18 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.18 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.18 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 1.18 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.18 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 0.59 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.59 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.59 |
| COG1283 | Na+/phosphate symporter | Inorganic ion transport and metabolism [P] | 0.59 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.59 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.59 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.59 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.59 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.59 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.59 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.59 |
| COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.59 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.59 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.59 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.59 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.59 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.86 % |
| Unclassified | root | N/A | 33.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001396|JGI20175J14863_1018200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 950 | Open in IMG/M |
| 3300001471|JGI12712J15308_10181535 | Not Available | 550 | Open in IMG/M |
| 3300001593|JGI12635J15846_10110005 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100948284 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300004091|Ga0062387_100652393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 763 | Open in IMG/M |
| 3300004092|Ga0062389_102347570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300004092|Ga0062389_102956543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 635 | Open in IMG/M |
| 3300005437|Ga0070710_10759806 | Not Available | 689 | Open in IMG/M |
| 3300005467|Ga0070706_100883433 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005591|Ga0070761_10285762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300005938|Ga0066795_10000888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6377 | Open in IMG/M |
| 3300005938|Ga0066795_10007339 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
| 3300005944|Ga0066788_10172267 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005947|Ga0066794_10031663 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300005947|Ga0066794_10235855 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005994|Ga0066789_10007469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4851 | Open in IMG/M |
| 3300005994|Ga0066789_10178471 | Not Available | 898 | Open in IMG/M |
| 3300006059|Ga0075017_100231074 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300006059|Ga0075017_100292612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300006059|Ga0075017_100535673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 891 | Open in IMG/M |
| 3300006086|Ga0075019_10608548 | Not Available | 685 | Open in IMG/M |
| 3300006102|Ga0075015_100861102 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006102|Ga0075015_100916746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 532 | Open in IMG/M |
| 3300006172|Ga0075018_10055551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1660 | Open in IMG/M |
| 3300006237|Ga0097621_101347518 | Not Available | 675 | Open in IMG/M |
| 3300006638|Ga0075522_10053488 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300006638|Ga0075522_10195635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300006893|Ga0073928_11180039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas bacteroides | 516 | Open in IMG/M |
| 3300009029|Ga0066793_10118256 | Not Available | 1542 | Open in IMG/M |
| 3300009029|Ga0066793_10210636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300009029|Ga0066793_10500790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300009177|Ga0105248_12449527 | Not Available | 595 | Open in IMG/M |
| 3300009500|Ga0116229_10795735 | Not Available | 767 | Open in IMG/M |
| 3300009520|Ga0116214_1239074 | Not Available | 688 | Open in IMG/M |
| 3300009700|Ga0116217_10915127 | Not Available | 538 | Open in IMG/M |
| 3300009709|Ga0116227_10129651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 2009 | Open in IMG/M |
| 3300010341|Ga0074045_10472226 | Not Available | 808 | Open in IMG/M |
| 3300010859|Ga0126352_1142309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300010876|Ga0126361_10516958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300010880|Ga0126350_10206086 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011271|Ga0137393_10758707 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012096|Ga0137389_10143402 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300012203|Ga0137399_10701535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300012917|Ga0137395_10908340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 636 | Open in IMG/M |
| 3300012925|Ga0137419_11527850 | Not Available | 566 | Open in IMG/M |
| 3300012929|Ga0137404_11996910 | Not Available | 541 | Open in IMG/M |
| 3300014168|Ga0181534_10042830 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300014201|Ga0181537_10766528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 655 | Open in IMG/M |
| 3300014489|Ga0182018_10110470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1602 | Open in IMG/M |
| 3300014489|Ga0182018_10183579 | Not Available | 1178 | Open in IMG/M |
| 3300014489|Ga0182018_10344790 | Not Available | 803 | Open in IMG/M |
| 3300014495|Ga0182015_10045868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 3231 | Open in IMG/M |
| 3300014495|Ga0182015_10288732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1075 | Open in IMG/M |
| 3300014495|Ga0182015_10781150 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300014495|Ga0182015_10811052 | Not Available | 588 | Open in IMG/M |
| 3300014501|Ga0182024_10071639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5244 | Open in IMG/M |
| 3300014501|Ga0182024_10098542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4267 | Open in IMG/M |
| 3300014501|Ga0182024_10692423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1259 | Open in IMG/M |
| 3300014501|Ga0182024_10986912 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300014501|Ga0182024_12872271 | Not Available | 511 | Open in IMG/M |
| 3300014838|Ga0182030_11086967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300015195|Ga0167658_1006746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3799 | Open in IMG/M |
| 3300017938|Ga0187854_10460586 | Not Available | 530 | Open in IMG/M |
| 3300017970|Ga0187783_10359325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Wenzhouxiangellaceae → Wenzhouxiangella → unclassified Wenzhouxiangella → Wenzhouxiangella sp. XN24 | 1060 | Open in IMG/M |
| 3300018019|Ga0187874_10321099 | Not Available | 629 | Open in IMG/M |
| 3300018030|Ga0187869_10262882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300018033|Ga0187867_10560116 | Not Available | 627 | Open in IMG/M |
| 3300018034|Ga0187863_10362078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 807 | Open in IMG/M |
| 3300018047|Ga0187859_10849473 | Not Available | 526 | Open in IMG/M |
| 3300019786|Ga0182025_1186333 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300019789|Ga0137408_1403422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4009 | Open in IMG/M |
| 3300019888|Ga0193751_1093713 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300020581|Ga0210399_11413910 | Not Available | 543 | Open in IMG/M |
| 3300020582|Ga0210395_10136553 | Not Available | 1826 | Open in IMG/M |
| 3300020583|Ga0210401_11060509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 669 | Open in IMG/M |
| 3300021420|Ga0210394_10094177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2589 | Open in IMG/M |
| 3300021432|Ga0210384_10042896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4143 | Open in IMG/M |
| 3300021433|Ga0210391_11192418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300021475|Ga0210392_11186065 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300022873|Ga0224550_1021249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 917 | Open in IMG/M |
| 3300025581|Ga0208355_1107393 | Not Available | 584 | Open in IMG/M |
| 3300025619|Ga0207926_1025113 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300025905|Ga0207685_10694998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 553 | Open in IMG/M |
| 3300025910|Ga0207684_10763623 | Not Available | 819 | Open in IMG/M |
| 3300026223|Ga0209840_1112037 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300026271|Ga0209880_1034031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 1175 | Open in IMG/M |
| 3300026291|Ga0209890_10001936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9260 | Open in IMG/M |
| 3300026294|Ga0209839_10038887 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300027370|Ga0209010_1025056 | Not Available | 1031 | Open in IMG/M |
| 3300027370|Ga0209010_1044504 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027497|Ga0208199_1106995 | Not Available | 576 | Open in IMG/M |
| 3300027590|Ga0209116_1012343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1720 | Open in IMG/M |
| 3300027633|Ga0208988_1085449 | Not Available | 789 | Open in IMG/M |
| 3300027645|Ga0209117_1019251 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300027745|Ga0209908_10133255 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300027853|Ga0209274_10659021 | Not Available | 540 | Open in IMG/M |
| 3300027854|Ga0209517_10544763 | Not Available | 624 | Open in IMG/M |
| 3300027855|Ga0209693_10335956 | Not Available | 734 | Open in IMG/M |
| 3300027884|Ga0209275_10368093 | Not Available | 807 | Open in IMG/M |
| 3300027895|Ga0209624_10583648 | Not Available | 742 | Open in IMG/M |
| 3300027898|Ga0209067_10486662 | Not Available | 699 | Open in IMG/M |
| 3300027911|Ga0209698_10073901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus alkaliphilus | 2907 | Open in IMG/M |
| 3300027911|Ga0209698_10264706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1369 | Open in IMG/M |
| 3300027911|Ga0209698_10411326 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300027915|Ga0209069_10095423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300028047|Ga0209526_10077401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2341 | Open in IMG/M |
| 3300028731|Ga0302301_1026499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1682 | Open in IMG/M |
| 3300028747|Ga0302219_10032303 | Not Available | 1955 | Open in IMG/M |
| 3300028773|Ga0302234_10176514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300028775|Ga0302231_10169003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 913 | Open in IMG/M |
| 3300028780|Ga0302225_10102243 | Not Available | 1400 | Open in IMG/M |
| 3300028780|Ga0302225_10164682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 1073 | Open in IMG/M |
| 3300028789|Ga0302232_10283941 | Not Available | 818 | Open in IMG/M |
| 3300028863|Ga0302218_10056483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1232 | Open in IMG/M |
| 3300028906|Ga0308309_11587925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300029882|Ga0311368_10121451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2187 | Open in IMG/M |
| 3300029910|Ga0311369_10075348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3518 | Open in IMG/M |
| 3300029910|Ga0311369_10247479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1623 | Open in IMG/M |
| 3300029944|Ga0311352_11288414 | Not Available | 552 | Open in IMG/M |
| 3300029954|Ga0311331_10818907 | Not Available | 836 | Open in IMG/M |
| 3300029993|Ga0302304_10319151 | Not Available | 567 | Open in IMG/M |
| 3300029999|Ga0311339_10183889 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300029999|Ga0311339_10302796 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300029999|Ga0311339_10343273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 1583 | Open in IMG/M |
| 3300029999|Ga0311339_11792399 | Not Available | 533 | Open in IMG/M |
| 3300030007|Ga0311338_10144835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2841 | Open in IMG/M |
| 3300030007|Ga0311338_11239195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 705 | Open in IMG/M |
| 3300030043|Ga0302306_10323408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300030053|Ga0302177_10571380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300030058|Ga0302179_10494750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Telmatocola → Telmatocola sphagniphila | 537 | Open in IMG/M |
| 3300030294|Ga0311349_11369808 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300030503|Ga0311370_12040324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 571 | Open in IMG/M |
| 3300030503|Ga0311370_12274137 | Not Available | 530 | Open in IMG/M |
| 3300030509|Ga0302183_10067374 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300030520|Ga0311372_10174356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3661 | Open in IMG/M |
| 3300030524|Ga0311357_11707608 | Not Available | 526 | Open in IMG/M |
| 3300030687|Ga0302309_10501904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 579 | Open in IMG/M |
| 3300030693|Ga0302313_10211164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300030706|Ga0310039_10199420 | Not Available | 789 | Open in IMG/M |
| 3300030739|Ga0302311_10728991 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300030746|Ga0302312_10073596 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300031027|Ga0302308_10392919 | Not Available | 835 | Open in IMG/M |
| 3300031028|Ga0302180_10161388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1235 | Open in IMG/M |
| 3300031057|Ga0170834_103572826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300031090|Ga0265760_10142072 | Not Available | 782 | Open in IMG/M |
| 3300031233|Ga0302307_10451057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300031234|Ga0302325_11548240 | Not Available | 850 | Open in IMG/M |
| 3300031234|Ga0302325_12714633 | Not Available | 583 | Open in IMG/M |
| 3300031236|Ga0302324_100108079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4687 | Open in IMG/M |
| 3300031236|Ga0302324_100137712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4034 | Open in IMG/M |
| 3300031524|Ga0302320_10188692 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
| 3300031525|Ga0302326_10823780 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300031708|Ga0310686_102573036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1583 | Open in IMG/M |
| 3300031753|Ga0307477_10717996 | Not Available | 667 | Open in IMG/M |
| 3300031837|Ga0302315_10586028 | Not Available | 597 | Open in IMG/M |
| 3300031910|Ga0306923_12174621 | Not Available | 557 | Open in IMG/M |
| 3300031962|Ga0307479_11004014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300031964|Ga0311373_11697952 | Not Available | 568 | Open in IMG/M |
| 3300032160|Ga0311301_10776111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 1324 | Open in IMG/M |
| 3300032397|Ga0315287_10016895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7619 | Open in IMG/M |
| 3300032515|Ga0348332_14273651 | Not Available | 1067 | Open in IMG/M |
| 3300033829|Ga0334854_009003 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300033829|Ga0334854_026346 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300033829|Ga0334854_095437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300034124|Ga0370483_0092832 | Not Available | 988 | Open in IMG/M |
| 3300034124|Ga0370483_0121347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Sapientia → Sapientia aquatica | 869 | Open in IMG/M |
| 3300034125|Ga0370484_0000262 | Not Available | 8627 | Open in IMG/M |
| 3300034163|Ga0370515_0032413 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300034199|Ga0370514_070290 | Not Available | 886 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 24.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 6.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.14% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 4.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.18% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.18% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.18% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.59% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.59% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.59% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031964 | III_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20175J14863_10182001 | 3300001396 | Arctic Peat Soil | GNIKDALAKYDEALKYAPNWKELKEVRDALAKQKT* |
| JGI12712J15308_101815352 | 3300001471 | Forest Soil | NRTEALAKYDEASKYAPNWKQLTDARQAAGNQKL* |
| JGI12635J15846_101100053 | 3300001593 | Forest Soil | VLAKQGKTGDALVKYDEALKYAPNWKQLQDARDAAAGAQP* |
| JGIcombinedJ26739_1009482842 | 3300002245 | Forest Soil | GDVLVKQGKIKDALAKYDEALKYAPNWKQLKDVREAAAKQKT* |
| Ga0062387_1006523932 | 3300004091 | Bog Forest Soil | VLVKQGNNREALAKYEEALKYTPNWKELKEAREALSKQKS* |
| Ga0062389_1023475702 | 3300004092 | Bog Forest Soil | KAWGDLLMKQGKTTAALAKYDEALRYAPNWKQLKDAQQAAKGIATP* |
| Ga0062389_1029565431 | 3300004092 | Bog Forest Soil | VLLKEGNAREAVAKYDEALLYAPNWAQLKEARAAAKQKN* |
| Ga0070710_107598062 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | WGDVLVKRGHTKEALAKYDEALKYAPNWKELKDAREAAAKQKS* |
| Ga0070706_1008834332 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVLAREGRTKQALAKYGHALKLAPNWTQLKDAREALAKQRT* |
| Ga0070761_102857622 | 3300005591 | Soil | VLVKLGHVKEALAKYGEALEHAPNWEELKDLREALAKHAG* |
| Ga0066795_100008883 | 3300005938 | Soil | VLVKQGYSKDALAKYDETLKYAPDGKQLKEAREAAANQNT* |
| Ga0066795_100073394 | 3300005938 | Soil | VLAKQGHRKEALVKYDEALKYAPSWKQLKEAREAVAKQKT* |
| Ga0066788_101722671 | 3300005944 | Soil | GKAKDALAKYDEALKYSPNWKQLKNSREALAKQRG* |
| Ga0066794_100316632 | 3300005947 | Soil | LKALGDVLVKQGKTKEALKYAPNWKQLNETREAVAKQKP* |
| Ga0066794_102358551 | 3300005947 | Soil | PLKAWGDVLAKQGHTKEALVKYTEALKYAPNWKQLKEAHEAAAKQKS* |
| Ga0066789_100074692 | 3300005994 | Soil | VLVKQGYSKDALAKYDETLKYAPNGKQLKEAREAAANQNT* |
| Ga0066789_101784711 | 3300005994 | Soil | GNTKDALAKYDEALKYAPNWKQLKETREAIAKQKS* |
| Ga0075017_1002310743 | 3300006059 | Watersheds | QGNTKGALVKYDEALKYAPNWKQLKDARGALAKHAS* |
| Ga0075017_1002926122 | 3300006059 | Watersheds | LRGDVLAKQGNTEGALGTYDETVKLAPNWKQLKEAREALAKQ* |
| Ga0075017_1005356733 | 3300006059 | Watersheds | VKQGKPAEARATYDEALQYAPNWKQLYEARDALAKQAGD* |
| Ga0075019_106085482 | 3300006086 | Watersheds | LVKQGKTRDALIKYDEALKFAPNWKQLKEARAALAKQKI* |
| Ga0075015_1008611022 | 3300006102 | Watersheds | DPLKAWGDVLVKRGRTREALAKYAEALNDAPNWRQLREAREAAAKQKS* |
| Ga0075015_1009167462 | 3300006102 | Watersheds | VLVQQGQAKEALAKYNEALKYAPNWKELKDVHEALAKQAG* |
| Ga0075018_100555512 | 3300006172 | Watersheds | MEQNRSIEVLAKYDGALKYAPNWKQLKEAREAAAKQET* |
| Ga0097621_1013475182 | 3300006237 | Miscanthus Rhizosphere | NNSKDALVKYDKALKYAPNWKQLREAREAAAKSQLY* |
| Ga0075522_100534882 | 3300006638 | Arctic Peat Soil | VLVKQRHSKEALAKYDQALKYAPNWKQLKDAREAAAK* |
| Ga0075522_101956351 | 3300006638 | Arctic Peat Soil | DVLAKQGRPTEALAKYGEALKYAPNWATLKEAREAAAKQKNGL* |
| Ga0073928_111800391 | 3300006893 | Iron-Sulfur Acid Spring | VWGDVLVKQGKTKEALVKYDEALKYAPNWKDLREEREALAKR* |
| Ga0066793_101182562 | 3300009029 | Prmafrost Soil | MLRAWGDVLAKQRHTKEALVNYDDALKFAPNWKDLKDAREALGSRRV* |
| Ga0066793_102106363 | 3300009029 | Prmafrost Soil | LKAWGDVLAKKGKTKEALAKYDEALKYAPNWKQLKEAREAAAKRKT* |
| Ga0066793_105007901 | 3300009029 | Prmafrost Soil | RGPYLSDPLKAVVDVLANQGHTNESLVKYDAALKYAPNWKQLKEAREAAAIVTP* |
| Ga0105248_124495272 | 3300009177 | Switchgrass Rhizosphere | GDVLMKQNNSKDALVKYDKALKYAPNWKQLREAREAAAKSQLY* |
| Ga0116229_107957351 | 3300009500 | Host-Associated | AWGDVLVKLGKNEDALAKYDEALKYAPNWKQLKESRAAAAKQSH* |
| Ga0116214_12390742 | 3300009520 | Peatlands Soil | GETREALRKYEEALNYAPNWKQLKESHDAAAKQKT* |
| Ga0116217_109151271 | 3300009700 | Peatlands Soil | VLAKQGNTKEALAKYGEALKYAPNWKQLKEAREALAKRKS* |
| Ga0116227_101296512 | 3300009709 | Host-Associated | LKAWGDVLVKQGNTKDALAKYDEALKYAPNWMQLKEAGDTLAKPST* |
| Ga0074045_104722262 | 3300010341 | Bog Forest Soil | WKLWGDVLAKQGKSKEALANYDEALKFAPHWKQLQDARAAVAKQKT* |
| Ga0126352_11423092 | 3300010859 | Boreal Forest Soil | VLTKQHQTREALDIYDQPLKYAPNWKQLKQAREAVVKQKP* |
| Ga0126361_105169581 | 3300010876 | Boreal Forest Soil | WADPLKALGDVLVKQGKTRDALVKYDEALKYAPNLKQLKQAREELVKQKS* |
| Ga0126350_102060861 | 3300010880 | Boreal Forest Soil | LASQGKFKEALAKYEQALKYAPNWKQLKEARAAAATQQP* |
| Ga0137393_107587071 | 3300011271 | Vadose Zone Soil | AWGDVLVKMGSPKEALAKYDEALKYAPNWKQLKEAREAAAKQKS* |
| Ga0137389_101434023 | 3300012096 | Vadose Zone Soil | GNTKDALAKYDEALKYAPEWKQLKEAREAVVKVTR* |
| Ga0137399_107015352 | 3300012203 | Vadose Zone Soil | VLVKQGKIKNGLVKYDQALKCASNWAALKVAREEAAKQKS* |
| Ga0137395_109083401 | 3300012917 | Vadose Zone Soil | VLVKQGKIKDALAKYDEALKYAPNWKQLKDVREAAAKQKT* |
| Ga0137419_115278502 | 3300012925 | Vadose Zone Soil | MLPKQGHAKEALTKFDEALKYAPHWVALKAAREAVAWHE |
| Ga0137404_119969102 | 3300012929 | Vadose Zone Soil | VLPEQGHSKGALAKYDEALKYSPNWSQLNEAREAAANQ |
| Ga0181534_100428304 | 3300014168 | Bog | MKQGKTKEALAKYDDALKYAPNWKQLHEARDAVTKQMI* |
| Ga0181537_107665281 | 3300014201 | Bog | LKAWGDVLVKQGDTKDALAKYNAASKYAANWQQLKDARAALAKKRN* |
| Ga0182018_101104703 | 3300014489 | Palsa | MRQQAATGKTKEALTKYNEALKYAPHWKQLQEAREAVAKQKT* |
| Ga0182018_101835792 | 3300014489 | Palsa | WGDVLARQGHVREALAKYGEALKYAPNWAALKAARDAAAKQKS* |
| Ga0182018_103447901 | 3300014489 | Palsa | GKTKEALAKYDEALKYAPHWKQLQDAREAVAKHAT* |
| Ga0182015_100458683 | 3300014495 | Palsa | VLLKHGKTRDALAKYDEALKYAPNWNQVKEARAALAKQKS* |
| Ga0182015_102887322 | 3300014495 | Palsa | DVLLKQGKTKEARAKYDEALKYAPHWKQLHDARAAAAQYKS* |
| Ga0182015_107811501 | 3300014495 | Palsa | AWGDVLVKRGNIKDALAKYDEALKYAPNWKQLKEARDATAKQKT* |
| Ga0182015_108110522 | 3300014495 | Palsa | LKAWGDVLAMQGHTKEALAKYDAALQYAPNWRQLKEARDATAKKKS* |
| Ga0182024_100716394 | 3300014501 | Permafrost | VKQRKTKQAFAKYDQALKYAPNWKQLKEAREGAAKQKT* |
| Ga0182024_100985423 | 3300014501 | Permafrost | VLVKQGKTKEAIVKYDAALKYAPNWQQLKEAREAAAKQKT* |
| Ga0182024_106924231 | 3300014501 | Permafrost | DLLAKQGKTKDALSKYDQALKYAPNWKQLKEARDSIAKQKS* |
| Ga0182024_109869121 | 3300014501 | Permafrost | DPLKAWGDVLVRQDKIKDALVKYDEALRYAPNWKQLKEARGAAAKQKS* |
| Ga0182024_128722711 | 3300014501 | Permafrost | GKLKEALAKYDEALMYAPNWKQLKEARAESAKQRS* |
| Ga0182030_110869672 | 3300014838 | Bog | VLVNQSKFKEALAKYDEALKHAPNWKQLKEAREAAAMQKT* |
| Ga0167658_10067464 | 3300015195 | Glacier Forefield Soil | VLAKQGKAKDALAKYEEALKYAPNWKQLKEAREAASKQTS* |
| Ga0187854_104605861 | 3300017938 | Peatland | HNGDAWKLWGDVLAKQEYTKDALAKYDRALKYAPNCKQLKEAREATAKQKS |
| Ga0187783_103593252 | 3300017970 | Tropical Peatland | MKQGYTKDALVKYDEALKYASNWKQLKKARETLAKQRS |
| Ga0187874_103210992 | 3300018019 | Peatland | VLVKEGHAKGALAKYGEALKHAPNWKELKNLREALAKHAG |
| Ga0187869_102628822 | 3300018030 | Peatland | VLVKEGHAKGALAKYGEALKHAPNWKELKNLREALA |
| Ga0187867_105601161 | 3300018033 | Peatland | NGDAWKLWGDVLAKQEYTKDALAKYDRALKYAPNCKQLKEAREATAKQKS |
| Ga0187863_103620782 | 3300018034 | Peatland | VLEQQGKIKDARAKDGQALKYAPNWKQLKKAREAAAKQKG |
| Ga0187859_108494731 | 3300018047 | Peatland | KAWGDLLARQGHAKQARAKYDEALQYAPNWAALKGARESAAKLN |
| Ga0182025_11863332 | 3300019786 | Permafrost | VLVKQGHPQEALAKYDEALKYAPNWKELKDVHEALAKTRRLIGSQ |
| Ga0137408_14034223 | 3300019789 | Vadose Zone Soil | VLAKLGQSKDALAKYDEALKYAPNWAALKEAREAAAKHAA |
| Ga0193751_10937131 | 3300019888 | Soil | MSCCVARSALAKQGKSREAPAKCDAALNYAPNWKQLKEAREVLAKQKS |
| Ga0210399_114139102 | 3300020581 | Soil | PDSLKAWGDVLVKQSKIKEALAKYDETLKHAPNWKQLKESREATAR |
| Ga0210395_101365531 | 3300020582 | Soil | KQGMPKKALAKYVEALKYAPNWRQLKDAREAAAKQKT |
| Ga0210401_110605091 | 3300020583 | Soil | KAWGDVLVKQGKPKKALAKYVEALKYAPNWRQLKDAREAAAKQKT |
| Ga0210394_100941773 | 3300021420 | Soil | EPLKAWGDVLVKQGKPKKALAKYVEALKYAPNWRLLKDAREAAAKQKT |
| Ga0210384_100428961 | 3300021432 | Soil | PLKAWGDVLVKQGKPKKALAKYVEALKYAPNWRLLKDAREAAAKQKT |
| Ga0210391_111924182 | 3300021433 | Soil | AWGDVLAKQGNIKEAIVKYDEAHKFAPNWKQLKDARDALAKGPG |
| Ga0210392_111860651 | 3300021475 | Soil | PLKAWGDVLVKQGKSKEALPKYDEALKYAPNWKQLKEAREAVAKQKS |
| Ga0224550_10212492 | 3300022873 | Soil | AWGDTLVKQGHTKEALGKYDEALKYAPNWSALKLARDSAANQKS |
| Ga0208355_11073932 | 3300025581 | Arctic Peat Soil | QGKTKEALAKYNEALKYAPNWKQLKETREAVAKQKP |
| Ga0207926_10251133 | 3300025619 | Arctic Peat Soil | LKAWGDVLVKQGKTKEALKYAPNWKQLKERREAMAKQKP |
| Ga0207685_106949981 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | DPLKAWGDVLTKQRHTKEALAKYNAALKYAPNWKELKEVREALAKRKS |
| Ga0207684_107636232 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAREGRTKQALAKYGHALKLAPNWTQLKDAREALAKQRT |
| Ga0209840_11120371 | 3300026223 | Soil | VLVKQGYSKDALAKYDETLKYAPDGKQLKEAREAAANQNT |
| Ga0209880_10340311 | 3300026271 | Soil | VLAKQGHRKEALVKYDEALKYAPSWKQLKEAREAVAKQKT |
| Ga0209890_100019364 | 3300026291 | Soil | VLVKQGYSKDALAKYDETLKYAPNGKQLKEAREAAANQNT |
| Ga0209839_100388871 | 3300026294 | Soil | LKALGDVLVKQGKTKEALKYAPNWKQLKETREAVAKQKP |
| Ga0209010_10250562 | 3300027370 | Forest Soil | VLAKQGKTGDALVKYDEALKYAPNWKQLQDARDAAAGAQP |
| Ga0209010_10445042 | 3300027370 | Forest Soil | KAWGDVLARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0208199_11069951 | 3300027497 | Peatlands Soil | GETREALRKYEEALNYAPNWKQLKESHDAAAKQKT |
| Ga0209116_10123433 | 3300027590 | Forest Soil | DPLKAWGDVLKAQRKIKEALGKYNAALKYAPNWKQLKEARDAALEQKS |
| Ga0208988_10854492 | 3300027633 | Forest Soil | VKQGNTKEALAKYDEALKCAPNWKQLKDARQALAKQKM |
| Ga0209117_10192511 | 3300027645 | Forest Soil | VLVKQGNAKDALVKYDEALKYAPNWKQLKEAREALVKQKG |
| Ga0209908_101332552 | 3300027745 | Thawing Permafrost | MPQHGAVQRAAWADPLKPWDVLGKQGKTKDSLVKYDEAIKYAPNWKQLKDARDAAAKQKS |
| Ga0209274_106590211 | 3300027853 | Soil | LLKQGNRKEALAKYDEALKYAPNWKQLRQAREAAAKQKT |
| Ga0209517_105447631 | 3300027854 | Peatlands Soil | LPSRGNAKEPLVKCDQALKYAPNWKQLKEVREVAAKQKS |
| Ga0209693_103359563 | 3300027855 | Soil | VKTREALAKYEEALKYAPNWKQLQDAREALAKQKT |
| Ga0209275_103680932 | 3300027884 | Soil | VLAKQGHVKEALAKYDDALKYAPNWKQLKEARELVAKLK |
| Ga0209624_105836481 | 3300027895 | Forest Soil | LLVKQGNTKDALDKYDEALKYAPNWKQLKEARQAIAKQKS |
| Ga0209067_104866622 | 3300027898 | Watersheds | WGDVLVKQGKTRDALIKYDEALKFAPNWKQLKEARAALAKQKI |
| Ga0209698_100739011 | 3300027911 | Watersheds | LVKQGKPKDALAKYDEALKYAPNWKQLKEAREAASQAKG |
| Ga0209698_102647061 | 3300027911 | Watersheds | RQGKTREALSKYDEALKYAPNWVALKEAREGAAKLKS |
| Ga0209698_104113261 | 3300027911 | Watersheds | KQGRPKEALAKYDEALKYAPNWKQLKEARAVLAKQKI |
| Ga0209069_100954231 | 3300027915 | Watersheds | VLVKQDNAKEALAKYDAALKYAPNWKQLKEAREAAAKQKT |
| Ga0209526_100774011 | 3300028047 | Forest Soil | KAWGDVLVKQGHPKEALLKYSDALKYAPNWAALKEARAVVAKRTT |
| Ga0302301_10264992 | 3300028731 | Palsa | MRQQAATGKTKEALTKYNEALKYAPHWKQLQEAREAVAKQKT |
| Ga0302219_100323032 | 3300028747 | Palsa | VKQRNIKQAFAKYDQALKYSPNWKQLKEAREAAAVQKI |
| Ga0302234_101765143 | 3300028773 | Palsa | WGDVLAKQEHAKEALAKYDEALKFAPKWKHLQEARAALVPHAT |
| Ga0302231_101690032 | 3300028775 | Palsa | MRQQAATGKTKEALTKYNEALKYAPHWKQLQEAREAVAK |
| Ga0302225_101022431 | 3300028780 | Palsa | LVRQRNTKDALVKYDEALKYAPNWKQLKDARDALAKQKV |
| Ga0302225_101646821 | 3300028780 | Palsa | VKRGNIKDALAKYDEALKYAPNWKQLKEARDATAKQKT |
| Ga0302232_102839412 | 3300028789 | Palsa | AWGDVLARQRHTKEALAKYDAALQYAPNWKQLKDAREATAKAR |
| Ga0302218_100564834 | 3300028863 | Palsa | DVLAKQEHAKEALAKYDEALKFAPKWKHLQEARAALVPHAT |
| Ga0308309_115879251 | 3300028906 | Soil | VKQGKTKDALAKYDEALKYAPNWKQLQDARETLAKQKT |
| Ga0311368_101214515 | 3300029882 | Palsa | QGKTKEALAKYDEALKYAPNWKQLQEARETLAKQKT |
| Ga0311369_100753481 | 3300029910 | Palsa | AKQAKTKDALAKYDEALKYAPNWKQLKEARNALAKQKG |
| Ga0311369_102474791 | 3300029910 | Palsa | DPLKAWGDVLLKEGKAKEALAKYDQALKYAPSWQQLKEARDAAVKQGS |
| Ga0311352_112884141 | 3300029944 | Palsa | GDMLARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0311331_108189072 | 3300029954 | Bog | MRQRQPKAALAKYDQALKYAPLWKQLHQARDAAARQAG |
| Ga0302304_103191511 | 3300029993 | Palsa | VKQRNIKQAFAKYDQALKYSPNWKQLKEAREAAAV |
| Ga0311339_101838894 | 3300029999 | Palsa | VLAKHGKIKDAIAKYDEALKFAPNWKQLKEAREAAAMQKT |
| Ga0311339_103027963 | 3300029999 | Palsa | MVMRGKLWGDVLAKQGETNDALVKYQEALKYAPHWKQLQRAREALAKS |
| Ga0311339_103432732 | 3300029999 | Palsa | LAKRGKIEEALANYDEALKYAPNWKQLKEARQAVAEQKS |
| Ga0311339_117923991 | 3300029999 | Palsa | EAGTHQRALDKYDEALKYAPNWKQLKGAREAVAKHKS |
| Ga0311338_101448353 | 3300030007 | Palsa | VLVKQGNIKGALAKYDEALRYAPNWKQLKEAREALAKQKS |
| Ga0311338_112391952 | 3300030007 | Palsa | VWGDVLAKQRHTRQALVKYNAALKYAPNWQQLKDARDALAKQTT |
| Ga0302306_103234081 | 3300030043 | Palsa | DVLVKQGKTKEALAKYDEALKYAPNWKQLQDARETLAKQKT |
| Ga0302177_105713802 | 3300030053 | Palsa | DKTKEALAKYDSALKYAPNWKQLKEARDFAAKQKS |
| Ga0302179_104947501 | 3300030058 | Palsa | KQARTKDALAKYDEALKYAPNWKQLKEARNAIAKQKR |
| Ga0311349_113698081 | 3300030294 | Fen | LVKQGNIKEALAKYNEALKYAPNWKQLKEARAAAAKAKA |
| Ga0311370_120403241 | 3300030503 | Palsa | DVLAKQRHTRQALVKYNAALKYAPNWQQLKDARDALAKQTT |
| Ga0311370_122741372 | 3300030503 | Palsa | LMKQSKPKDALAMYDEALKYAPNWQQLQAARAAAAKQSN |
| Ga0302183_100673743 | 3300030509 | Palsa | AWGDVLARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0311372_101743564 | 3300030520 | Palsa | WGDMLARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0311357_117076082 | 3300030524 | Palsa | PLKAWGDVLVRQRNTKDALVKYDEALKYAPNWKQLKDARDALAKQKV |
| Ga0302309_105019041 | 3300030687 | Palsa | VLVKRGNIKDALAKYDEALKYAPNWKQLKEARDATAKQKT |
| Ga0302313_102111642 | 3300030693 | Palsa | GDVLAKQGRPKEALWKYNEALKYAPNWKQLKEAREAAKHTD |
| Ga0310039_101994201 | 3300030706 | Peatlands Soil | VKQGETREALRKYEEALNYAPNWKQLKESHDAAAKQKT |
| Ga0302311_107289912 | 3300030739 | Palsa | KQEHAKEALAKYDEALKFAPKWKHLQEARAALVPHAT |
| Ga0302312_100735961 | 3300030746 | Palsa | VKQRNIKQAFAKYDQAPKYSPNWKQLKEAREAAAVQKI |
| Ga0302308_103929192 | 3300031027 | Palsa | AWGDVLARKERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0302180_101613882 | 3300031028 | Palsa | KAWGDVLVKQGHAREAAAKYDAALKYAPNWKQLKEARDFAAKQKS |
| Ga0170834_1035728261 | 3300031057 | Forest Soil | VLAKQGNTKDAIAKYDEAHKFAPNWKQLKDARDALALTPAKVY |
| Ga0265760_101420721 | 3300031090 | Soil | GNNREALAKYEEALKYAPNWKELKEAREALSKQKS |
| Ga0302307_104510572 | 3300031233 | Palsa | QGQVQQALVKYDQALKYAPNWQALHQARDAAAKQKA |
| Ga0302325_115482401 | 3300031234 | Palsa | WADPIKAWGDVLVKQDKAKQALAKYDDALKYAPNWKQLKEAREAAAKQKS |
| Ga0302325_127146332 | 3300031234 | Palsa | AWGDVLARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQ |
| Ga0302324_1001080795 | 3300031236 | Palsa | LARQERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0302324_1001377121 | 3300031236 | Palsa | GNRKDALAKYDEALKYAPNWKQLKDAREAAAKQKL |
| Ga0302320_101886922 | 3300031524 | Bog | VKQSKIKEALAKYDEALKHAPSWKQLNEAREAAAMQKT |
| Ga0302326_108237801 | 3300031525 | Palsa | DILARQGHAKEARAKYDEALQYAPNWAALKGARESAAKLN |
| Ga0310686_1025730361 | 3300031708 | Soil | LVKQDKAKQALAKYDDALKYAPNWKQLKEAREAAAKQKS |
| Ga0307477_107179961 | 3300031753 | Hardwood Forest Soil | GKPKKALAKYVEALKYAPNWRQLKDAREAAAKQKT |
| Ga0302315_105860281 | 3300031837 | Palsa | ARKERPKEALTKYDEALSYAPNWKQLKEARESAAKQKS |
| Ga0306923_121746212 | 3300031910 | Soil | GWGDALARRGQAQTALAKYEEALKYAPNWKELNEAREAVSKNR |
| Ga0307479_110040143 | 3300031962 | Hardwood Forest Soil | VQGFFTRAKYDEALEYAPNWKEVKAAREVVAKQKS |
| Ga0311373_116979521 | 3300031964 | Palsa | GKTKEALTKYNEALKYAPHWKQLQEAREAVAKQKT |
| Ga0311301_107761112 | 3300032160 | Peatlands Soil | VLAKQGKNREALAKYNEALKFAPNWRQLKEARAAPAAMQKS |
| Ga0315287_100168951 | 3300032397 | Sediment | WGDVLVKRGKTQEALVKYDEALKYAPNWQQLKEARGVAARNAT |
| Ga0348332_142736513 | 3300032515 | Plant Litter | GDLLSKQGKTKDALAKYDQALRYAPNWQQLQKARAALVKQES |
| Ga0334854_009003_1171_1290 | 3300033829 | Soil | MLAKQGNRNESPVKYDEALKYAPNWKQLKEAREALAKPA |
| Ga0334854_026346_1_126 | 3300033829 | Soil | GDLLVKQGHAKDALAKYDEALKYAPNWKQLREAREAAVPTK |
| Ga0334854_095437_19_135 | 3300033829 | Soil | VKLGQPKEALAKYDEALKYAPNWKQLKQAREAAANQKT |
| Ga0370483_0092832_1_138 | 3300034124 | Untreated Peat Soil | KAWGDVLAHQGKIKGALAKYDQALKYAPNWKQLKKAREAAAKQKS |
| Ga0370483_0121347_714_854 | 3300034124 | Untreated Peat Soil | LKAWGDILVKQGKTREALAKYDEALTYAPNWKHLQDAREALAKQKT |
| Ga0370484_0000262_5930_6061 | 3300034125 | Untreated Peat Soil | LASVLTKQRREKEALAKYDEALKFAPNWKQIHEAREAVAKQKS |
| Ga0370515_0032413_1594_1710 | 3300034163 | Untreated Peat Soil | VKQRNIKQAFANYDQALKYSPNWKQLKEAREAAAMQKT |
| Ga0370514_070290_2_109 | 3300034199 | Untreated Peat Soil | MKQRNIKQAFAKYDQALKYSPNWKQLKEAREAAAVQ |
| ⦗Top⦘ |