


| Basic Information | |
|---|---|
| Family ID | F036488 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.23 % |
| % of genes near scaffold ends (potentially truncated) | 93.53 % |
| % of genes from short scaffolds (< 2000 bps) | 88.82 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.235 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 25.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF09834 | DUF2061 | 4.12 |
| PF13759 | 2OG-FeII_Oxy_5 | 4.12 |
| PF08291 | Peptidase_M15_3 | 0.59 |
| PF02803 | Thiolase_C | 0.59 |
| PF07486 | Hydrolase_2 | 0.59 |
| PF05050 | Methyltransf_21 | 0.59 |
| PF01068 | DNA_ligase_A_M | 0.59 |
| PF02018 | CBM_4_9 | 0.59 |
| PF04055 | Radical_SAM | 0.59 |
| PF02086 | MethyltransfD12 | 0.59 |
| PF04325 | DUF465 | 0.59 |
| PF00924 | MS_channel | 0.59 |
| PF05118 | Asp_Arg_Hydrox | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.59 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.59 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.59 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.59 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.59 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.24 % |
| All Organisms | root | All Organisms | 41.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352018|QLA_contig21192.21192 | Not Available | 705 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10133101 | Not Available | 760 | Open in IMG/M |
| 3300001355|JGI20158J14315_10209687 | Not Available | 551 | Open in IMG/M |
| 3300001419|JGI11705J14877_10035426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1851 | Open in IMG/M |
| 3300001419|JGI11705J14877_10113953 | Not Available | 776 | Open in IMG/M |
| 3300001450|JGI24006J15134_10173942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 682 | Open in IMG/M |
| 3300001943|GOS2226_1022999 | Not Available | 1783 | Open in IMG/M |
| 3300004097|Ga0055584_100284277 | Not Available | 1694 | Open in IMG/M |
| 3300004461|Ga0066223_1233827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 773 | Open in IMG/M |
| 3300005512|Ga0074648_1173610 | Not Available | 626 | Open in IMG/M |
| 3300006027|Ga0075462_10061618 | Not Available | 1185 | Open in IMG/M |
| 3300006350|Ga0099954_1477632 | Not Available | 747 | Open in IMG/M |
| 3300006403|Ga0075514_1022545 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300006735|Ga0098038_1180304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 691 | Open in IMG/M |
| 3300006789|Ga0098054_1237659 | Not Available | 659 | Open in IMG/M |
| 3300006802|Ga0070749_10103464 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
| 3300006868|Ga0075481_10141082 | Not Available | 880 | Open in IMG/M |
| 3300006916|Ga0070750_10029038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 2757 | Open in IMG/M |
| 3300006919|Ga0070746_10180352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1015 | Open in IMG/M |
| 3300006921|Ga0098060_1049840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1240 | Open in IMG/M |
| 3300006921|Ga0098060_1162905 | Not Available | 616 | Open in IMG/M |
| 3300006924|Ga0098051_1021928 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
| 3300006924|Ga0098051_1138964 | Not Available | 644 | Open in IMG/M |
| 3300006924|Ga0098051_1146476 | Not Available | 625 | Open in IMG/M |
| 3300007229|Ga0075468_10057219 | Not Available | 1310 | Open in IMG/M |
| 3300007234|Ga0075460_10272811 | Not Available | 559 | Open in IMG/M |
| 3300007236|Ga0075463_10016493 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 2428 | Open in IMG/M |
| 3300007276|Ga0070747_1225971 | Not Available | 654 | Open in IMG/M |
| 3300007523|Ga0105052_10157505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1543 | Open in IMG/M |
| 3300007541|Ga0099848_1080768 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300007542|Ga0099846_1048124 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1621 | Open in IMG/M |
| 3300007542|Ga0099846_1100181 | Not Available | 1066 | Open in IMG/M |
| 3300007725|Ga0102951_1003906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 5331 | Open in IMG/M |
| 3300007725|Ga0102951_1040344 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300007778|Ga0102954_1233170 | Not Available | 547 | Open in IMG/M |
| 3300007960|Ga0099850_1044382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1911 | Open in IMG/M |
| 3300009001|Ga0102963_1365543 | Not Available | 566 | Open in IMG/M |
| 3300009027|Ga0102957_1143419 | Not Available | 845 | Open in IMG/M |
| 3300009027|Ga0102957_1155478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 811 | Open in IMG/M |
| 3300009027|Ga0102957_1313675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 575 | Open in IMG/M |
| 3300009071|Ga0115566_10171315 | Not Available | 1342 | Open in IMG/M |
| 3300009149|Ga0114918_10388997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 762 | Open in IMG/M |
| 3300009437|Ga0115556_1174070 | Not Available | 784 | Open in IMG/M |
| 3300009442|Ga0115563_1112433 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300009495|Ga0115571_1103343 | Not Available | 1233 | Open in IMG/M |
| 3300009495|Ga0115571_1158828 | Not Available | 943 | Open in IMG/M |
| 3300009550|Ga0115013_10485353 | Not Available | 804 | Open in IMG/M |
| 3300009909|Ga0132222_1000005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 3813 | Open in IMG/M |
| 3300009911|Ga0132221_1003166 | Not Available | 952 | Open in IMG/M |
| 3300010149|Ga0098049_1146513 | Not Available | 730 | Open in IMG/M |
| 3300010153|Ga0098059_1075543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 1345 | Open in IMG/M |
| 3300010297|Ga0129345_1099513 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1078 | Open in IMG/M |
| 3300010297|Ga0129345_1185912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 741 | Open in IMG/M |
| 3300010297|Ga0129345_1350610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 508 | Open in IMG/M |
| 3300010300|Ga0129351_1352682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 552 | Open in IMG/M |
| 3300012520|Ga0129344_1316220 | Not Available | 622 | Open in IMG/M |
| 3300012928|Ga0163110_11536414 | Not Available | 541 | Open in IMG/M |
| 3300012954|Ga0163111_10406636 | Not Available | 1236 | Open in IMG/M |
| 3300013010|Ga0129327_10295256 | Not Available | 838 | Open in IMG/M |
| 3300016737|Ga0182047_1308714 | Not Available | 815 | Open in IMG/M |
| 3300016745|Ga0182093_1053329 | Not Available | 857 | Open in IMG/M |
| 3300016745|Ga0182093_1296989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 622 | Open in IMG/M |
| 3300016747|Ga0182078_10850058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 918 | Open in IMG/M |
| 3300016747|Ga0182078_10859808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1061 | Open in IMG/M |
| 3300016776|Ga0182046_1340825 | Not Available | 676 | Open in IMG/M |
| 3300017697|Ga0180120_10128342 | Not Available | 1086 | Open in IMG/M |
| 3300017728|Ga0181419_1051536 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300017728|Ga0181419_1151109 | Not Available | 556 | Open in IMG/M |
| 3300017730|Ga0181417_1131859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 604 | Open in IMG/M |
| 3300017732|Ga0181415_1073861 | Not Available | 770 | Open in IMG/M |
| 3300017740|Ga0181418_1161289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 537 | Open in IMG/M |
| 3300017753|Ga0181407_1045069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1162 | Open in IMG/M |
| 3300017755|Ga0181411_1203115 | Not Available | 556 | Open in IMG/M |
| 3300017758|Ga0181409_1154164 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 671 | Open in IMG/M |
| 3300017759|Ga0181414_1114108 | Not Available | 709 | Open in IMG/M |
| 3300017762|Ga0181422_1140718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 742 | Open in IMG/M |
| 3300017765|Ga0181413_1070443 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300017779|Ga0181395_1163477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 699 | Open in IMG/M |
| 3300017782|Ga0181380_1063925 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300017949|Ga0181584_10096656 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 2023 | Open in IMG/M |
| 3300017949|Ga0181584_10876842 | Not Available | 527 | Open in IMG/M |
| 3300017951|Ga0181577_10604174 | Not Available | 676 | Open in IMG/M |
| 3300017952|Ga0181583_10401489 | Not Available | 853 | Open in IMG/M |
| 3300017952|Ga0181583_10680157 | Not Available | 613 | Open in IMG/M |
| 3300017957|Ga0181571_10154717 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300017958|Ga0181582_10215419 | Not Available | 1299 | Open in IMG/M |
| 3300017962|Ga0181581_10421401 | Not Available | 836 | Open in IMG/M |
| 3300017964|Ga0181589_10575035 | Not Available | 719 | Open in IMG/M |
| 3300017969|Ga0181585_10321682 | Not Available | 1072 | Open in IMG/M |
| 3300017991|Ga0180434_10506797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 926 | Open in IMG/M |
| 3300018036|Ga0181600_10374621 | Not Available | 696 | Open in IMG/M |
| 3300018041|Ga0181601_10681340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 520 | Open in IMG/M |
| 3300018413|Ga0181560_10434541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 600 | Open in IMG/M |
| 3300018415|Ga0181559_10578049 | Not Available | 607 | Open in IMG/M |
| 3300018420|Ga0181563_10290949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 959 | Open in IMG/M |
| 3300018421|Ga0181592_10964247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 551 | Open in IMG/M |
| 3300018428|Ga0181568_11128041 | Not Available | 591 | Open in IMG/M |
| 3300018876|Ga0181564_10505822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 647 | Open in IMG/M |
| 3300019283|Ga0182058_1194879 | Not Available | 659 | Open in IMG/M |
| 3300020189|Ga0181578_10472322 | Not Available | 527 | Open in IMG/M |
| 3300020385|Ga0211677_10221355 | Not Available | 778 | Open in IMG/M |
| 3300020446|Ga0211574_10268793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 738 | Open in IMG/M |
| 3300020469|Ga0211577_10770738 | Not Available | 557 | Open in IMG/M |
| 3300020474|Ga0211547_10454404 | Not Available | 643 | Open in IMG/M |
| 3300021347|Ga0213862_10211922 | Not Available | 682 | Open in IMG/M |
| 3300021364|Ga0213859_10216772 | Not Available | 884 | Open in IMG/M |
| 3300021365|Ga0206123_10421951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 545 | Open in IMG/M |
| 3300021958|Ga0222718_10003083 | Not Available | 14473 | Open in IMG/M |
| 3300021958|Ga0222718_10047760 | All Organisms → Viruses → Predicted Viral | 2741 | Open in IMG/M |
| 3300021958|Ga0222718_10114404 | Not Available | 1570 | Open in IMG/M |
| 3300021958|Ga0222718_10567559 | Not Available | 537 | Open in IMG/M |
| 3300021959|Ga0222716_10173150 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300021960|Ga0222715_10007097 | Not Available | 9355 | Open in IMG/M |
| 3300021960|Ga0222715_10233407 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300021960|Ga0222715_10554957 | Not Available | 600 | Open in IMG/M |
| 3300021960|Ga0222715_10588430 | Not Available | 576 | Open in IMG/M |
| 3300021960|Ga0222715_10648057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 538 | Open in IMG/M |
| 3300021961|Ga0222714_10030667 | All Organisms → Viruses → Predicted Viral | 4007 | Open in IMG/M |
| 3300021961|Ga0222714_10122029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1607 | Open in IMG/M |
| 3300021961|Ga0222714_10347131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 799 | Open in IMG/M |
| 3300021964|Ga0222719_10210569 | Not Available | 1321 | Open in IMG/M |
| 3300022183|Ga0196891_1076243 | Not Available | 596 | Open in IMG/M |
| 3300022851|Ga0222691_1037734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 678 | Open in IMG/M |
| 3300022923|Ga0255783_10098653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1552 | Open in IMG/M |
| 3300022928|Ga0255758_10406432 | Not Available | 539 | Open in IMG/M |
| 3300022929|Ga0255752_10433492 | Not Available | 507 | Open in IMG/M |
| 3300022937|Ga0255770_10286748 | Not Available | 769 | Open in IMG/M |
| 3300023108|Ga0255784_10301290 | Not Available | 798 | Open in IMG/M |
| 3300023108|Ga0255784_10472904 | Not Available | 578 | Open in IMG/M |
| 3300023116|Ga0255751_10141575 | Not Available | 1426 | Open in IMG/M |
| 3300023117|Ga0255757_10438379 | Not Available | 588 | Open in IMG/M |
| 3300023170|Ga0255761_10359622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 736 | Open in IMG/M |
| 3300023172|Ga0255766_10015674 | Not Available | 5635 | Open in IMG/M |
| 3300023176|Ga0255772_10363933 | Not Available | 741 | Open in IMG/M |
| 3300023176|Ga0255772_10477420 | Not Available | 606 | Open in IMG/M |
| 3300023178|Ga0255759_10663052 | Not Available | 583 | Open in IMG/M |
| 3300023180|Ga0255768_10028349 | All Organisms → Viruses → Predicted Viral | 4485 | Open in IMG/M |
| 3300024281|Ga0228610_1060826 | Not Available | 545 | Open in IMG/M |
| 3300024297|Ga0228658_1135059 | Not Available | 597 | Open in IMG/M |
| 3300024420|Ga0228632_1073204 | Not Available | 802 | Open in IMG/M |
| 3300024428|Ga0233396_1050148 | Not Available | 1154 | Open in IMG/M |
| 3300025099|Ga0208669_1041719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1077 | Open in IMG/M |
| 3300025127|Ga0209348_1144226 | Not Available | 704 | Open in IMG/M |
| 3300025632|Ga0209194_1049729 | Not Available | 1209 | Open in IMG/M |
| 3300025641|Ga0209833_1169539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 556 | Open in IMG/M |
| 3300025653|Ga0208428_1034083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1609 | Open in IMG/M |
| 3300025685|Ga0209095_1063431 | Not Available | 1273 | Open in IMG/M |
| 3300025696|Ga0209532_1110807 | Not Available | 920 | Open in IMG/M |
| 3300025696|Ga0209532_1118631 | Not Available | 872 | Open in IMG/M |
| 3300025712|Ga0209305_1225747 | Not Available | 540 | Open in IMG/M |
| 3300025759|Ga0208899_1046167 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1900 | Open in IMG/M |
| 3300025816|Ga0209193_1152213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 535 | Open in IMG/M |
| 3300025840|Ga0208917_1196730 | Not Available | 674 | Open in IMG/M |
| 3300025849|Ga0209603_1151435 | Not Available | 943 | Open in IMG/M |
| 3300025874|Ga0209533_1258085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 694 | Open in IMG/M |
| 3300025889|Ga0208644_1122300 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300025889|Ga0208644_1334030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 586 | Open in IMG/M |
| 3300026183|Ga0209932_1082420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 730 | Open in IMG/M |
| 3300026187|Ga0209929_1028192 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300029319|Ga0183748_1038198 | Not Available | 1472 | Open in IMG/M |
| 3300031594|Ga0302131_1278966 | Not Available | 528 | Open in IMG/M |
| 3300031775|Ga0315326_11009575 | Not Available | 508 | Open in IMG/M |
| 3300032462|Ga0335396_10787832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 23.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.24% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.06% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.12% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.53% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.53% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.94% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 2.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.18% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 1.18% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.18% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.18% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.18% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.59% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.59% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.59% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.59% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.59% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.59% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.59% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352018 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009909 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 3m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009911 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023117 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| QLA_00640500 | 2199352018 | Saline Water | LISKTEINYENADGFRVFNEIVYAGESHHLEEDSTGKGSSFYVMEGDEV |
| DelMOSum2011_101331012 | 3300000115 | Marine | EYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV* |
| JGI20158J14315_102096871 | 3300001355 | Pelagic Marine | MDKLKIRYTDADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDDV* |
| JGI11705J14877_100354261 | 3300001419 | Saline Water And Sediment | CDGFKCFNEIEYDGEIHYLQEDSTGKSSSFYVMEGDDV* |
| JGI11705J14877_101139531 | 3300001419 | Saline Water And Sediment | ENAEGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA* |
| JGI24006J15134_101739421 | 3300001450 | Marine | KVFSCIEYDGETYDLEEDSTGKSSSFYVNCGDRIDG* |
| GOS2226_10229996 | 3300001943 | Marine | KLKIRYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0055584_1002842777 | 3300004097 | Pelagic Marine | ADGFNVFNEIIYDNEPYYLEEDSMGKSSSFYVNAGENVQESQ* |
| Ga0066223_12338272 | 3300004461 | Marine | FDFKKMSIKYENADGFKVFNSFDYDGAECYLEEDSSGKGSSFYVMAGDDV* |
| Ga0074648_11736101 | 3300005512 | Saline Water And Sediment | ENADGFKCFNEIEYDGTGYYLEEDSTGKSSSFYVGAGADV* |
| Ga0075462_100616181 | 3300006027 | Aqueous | IEIDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK* |
| Ga0099954_14776323 | 3300006350 | Marine | IEMDKLKIRYTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVNCGEKLS* |
| Ga0075514_10225451 | 3300006403 | Aqueous | IDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK* |
| Ga0098038_11803041 | 3300006735 | Marine | EIDKLKIRYTDADGFKVFNEVEYDGEPYYLEEDSTGKSSSFYVAIGDNLNG* |
| Ga0098054_12376591 | 3300006789 | Marine | IDKLTIEMTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDKV* |
| Ga0070749_101034646 | 3300006802 | Aqueous | FRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0070749_103867883 | 3300006802 | Aqueous | IDFRKMAIRYENADGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDV* |
| Ga0075481_101410821 | 3300006868 | Aqueous | NADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0070750_100290386 | 3300006916 | Aqueous | ENADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0070746_101803524 | 3300006919 | Aqueous | MAIRYENADGFKCFNEIEYDGTGYYLEEDSTGKSSAFYVGAGADI* |
| Ga0098060_10498401 | 3300006921 | Marine | ADGFKVFNEIEYDGEAYYLEEDSTGKSSSFYVNCGEKVQESQ* |
| Ga0098060_11629052 | 3300006921 | Marine | DADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDKV* |
| Ga0098051_10219281 | 3300006924 | Marine | KLTIEMTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDKV* |
| Ga0098051_11389641 | 3300006924 | Marine | KLTIEMTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK* |
| Ga0098051_11464761 | 3300006924 | Marine | TIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLE* |
| Ga0075468_100572191 | 3300007229 | Aqueous | GIEIDKLTIEYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0075460_102728112 | 3300007234 | Aqueous | DGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDV* |
| Ga0075463_100164931 | 3300007236 | Aqueous | ADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0070747_12259712 | 3300007276 | Aqueous | YLTDADGFKVFSEVEYDSESYYLEEDSTGKSSSFYVGEGDDV* |
| Ga0105052_101575051 | 3300007523 | Freshwater | KKMEINYENADGFRVFNDIIYAGEAHPLEEDSTGKSSAFYVMAGDAV* |
| Ga0099848_10807681 | 3300007541 | Aqueous | NADGFKVFNEIEYDGTGYYLEEDSTGKSSSFYVGMGDDV* |
| Ga0099846_10481241 | 3300007542 | Aqueous | NADGFKVFNELIYNGTGYYLDEDSTGKSSAFYVMEGDNV* |
| Ga0099846_11001811 | 3300007542 | Aqueous | KTDHKGFDFKKVKIDYENADGFKVFHSVNYDGTEYYLEEDSTGKSSAFYVMEGDDV* |
| Ga0102951_100390613 | 3300007725 | Water | EYCDGFKVFNEFLYNGDSYYLEEDSTGKSSSFYVAEGDDV* |
| Ga0102951_10403444 | 3300007725 | Water | RYENADGFRCFNEIEYDGTASYLEEDSTGKSSSFYVMEGDDV* |
| Ga0102951_11801211 | 3300007725 | Water | IDFRKMAIRYENAEGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA* |
| Ga0102954_12331702 | 3300007778 | Water | YENADGFKCFNEIQYDGTAYYLEEDSTGKSSSFYVGAGDDV* |
| Ga0099850_10443826 | 3300007960 | Aqueous | GFKCFNEIEYDGEIHYLQEDSTGKSSSFYVMEGDDV* |
| Ga0102963_13655432 | 3300009001 | Pond Water | RCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0102957_11434191 | 3300009027 | Pond Water | CDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV* |
| Ga0102957_11554783 | 3300009027 | Pond Water | FKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV* |
| Ga0102957_13136752 | 3300009027 | Pond Water | DFKKMSINYENADGFKVFGDILYDGDSFYLEEDSTGKSSCFYVMEGDDV* |
| Ga0115566_101713151 | 3300009071 | Pelagic Marine | TGPDGIEIDKLTIEYTDADGFKVFNEIEYQGEVYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0114918_103889971 | 3300009149 | Deep Subsurface | RYENADGFRVFNEIEYDGTGYYLEEDSTGKSSSFYVGMGDDV* |
| Ga0115556_11740701 | 3300009437 | Pelagic Marine | RYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMAGDNL* |
| Ga0115563_11124331 | 3300009442 | Pelagic Marine | TDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0115571_11033431 | 3300009495 | Pelagic Marine | FNVFNEIIYDNEPYYLEEDSMGKSSSFYVNAGENVQESQ* |
| Ga0115571_11588283 | 3300009495 | Pelagic Marine | KVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK* |
| Ga0115572_102184452 | 3300009507 | Pelagic Marine | KTGPDGIEIDKLRIGYTDADGFKVFSEVEYDGESYYLEEDSTGKSSSFYVAKGDKV* |
| Ga0115013_104853531 | 3300009550 | Marine | KLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK* |
| Ga0132222_100000513 | 3300009909 | Meromictic Pond | YENCDGFRVFNELIYDGENLYLEEDSTGKGSSFYVMAGDAV* |
| Ga0132221_10031663 | 3300009911 | Meromictic Pond | YENCDGFRVFNEFTYDGESHYLEEDSTGKSSAFYVGAGDDV* |
| Ga0098049_11465133 | 3300010149 | Marine | DGIEIDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLE* |
| Ga0098059_10755431 | 3300010153 | Marine | IEIDKLKISYVNADGFKVFNEVEYDGEVYYLEEDSTGKSSSFYVNCGDRIDG* |
| Ga0129345_10995131 | 3300010297 | Freshwater To Marine Saline Gradient | NYENADGFKVFNEFMYDGESYYLEEDSTGKSSSFYVMEGDDI* |
| Ga0129345_11859121 | 3300010297 | Freshwater To Marine Saline Gradient | NYENADGFKVFNEFMYDGESYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0129345_13506103 | 3300010297 | Freshwater To Marine Saline Gradient | YENCDGFKCFNEIEYDGEIHYLQEDSTGKSSSFYVMEGDDV* |
| Ga0129351_13526821 | 3300010300 | Freshwater To Marine Saline Gradient | TGPEGFNFKKLEINYENADGFRVFNSFVYDGEEHYLQEDSTGKSSSFYVGAGDDV* |
| Ga0129344_13162201 | 3300012520 | Aqueous | KVFNEFTYDGNSYYLQEDSTGKSSSFYVMEGDEV* |
| Ga0163110_115364143 | 3300012928 | Surface Seawater | DGIEIDKLKISYIDADGFKVFNEVLYDNELYYLEEDSTGKSSSFYVNKGDNL* |
| Ga0163111_104066361 | 3300012954 | Surface Seawater | MDKLKIRYTNADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVAKGANF* |
| Ga0129327_102952561 | 3300013010 | Freshwater To Marine Saline Gradient | KLKIRYTDADGFKVFSEVEYDGESYYLEEDSTGKSSSFYVMEGDDV* |
| Ga0182047_13087143 | 3300016737 | Salt Marsh | RIGYENADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0182093_10533291 | 3300016745 | Salt Marsh | FRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0182093_12969893 | 3300016745 | Salt Marsh | FNFKKLEINYENADGFRVFNSFIYDGEEHYLQEDSTGKSSSFYVGAGDDV |
| Ga0182078_108500583 | 3300016747 | Salt Marsh | YENADGFRVFNEIEYDGEMYYLEEDSTGKSSSFYVAKGDKL |
| Ga0182078_108598081 | 3300016747 | Salt Marsh | DGIDFKKMAIKYENADGFRVFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0182046_13408253 | 3300016776 | Salt Marsh | FKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGADV |
| Ga0180120_101283421 | 3300017697 | Freshwater To Marine Saline Gradient | GFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181419_10515361 | 3300017728 | Seawater | GFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181419_11511091 | 3300017728 | Seawater | NADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181417_11318591 | 3300017730 | Seawater | GPDGIEIDKLKIRYTNADGFKVFNDIEYDGEEYYLEEDSTGKSSSFYVAKGDNLNG |
| Ga0181415_10738611 | 3300017732 | Seawater | LMDKLKIRYTDADGFKVFNEAEYDGEMYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181418_11612891 | 3300017740 | Seawater | DKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVNRGEKLDG |
| Ga0181407_10450691 | 3300017753 | Seawater | GFKVFSCIEYDGETYDLEEDSTGKSSSFYVNCGDRIDG |
| Ga0181411_12031151 | 3300017755 | Seawater | DKLTIEMTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181409_11541641 | 3300017758 | Seawater | YVNADGFKVFNDIEYNGEEYYLEEDSTGKSSSFYVSCGDKI |
| Ga0181414_11141083 | 3300017759 | Seawater | IEMTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDNL |
| Ga0181422_11407183 | 3300017762 | Seawater | RYTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVNRGEKLDG |
| Ga0181413_10704431 | 3300017765 | Seawater | DKLTIEMTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNL |
| Ga0181395_11634771 | 3300017779 | Seawater | VNADGFKVFNDIEYNGEEYYLEEDSTGKSSSFYVGCGDKI |
| Ga0181380_10639253 | 3300017782 | Seawater | MVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181584_100966568 | 3300017949 | Salt Marsh | ADGFKVFNEFLYDGNNHYLEEDSTGKSSSFYVMEGDDV |
| Ga0181584_108768421 | 3300017949 | Salt Marsh | RYEDADGFKVFNEIEYDGTAYYLEEDSTGKSSCFYVGAGDDA |
| Ga0181577_106041741 | 3300017951 | Salt Marsh | FKKMVIRYENADGFRCFNEIEYDGTGYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181583_104014893 | 3300017952 | Salt Marsh | DGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181583_106801572 | 3300017952 | Salt Marsh | ADGFRVFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181571_101547171 | 3300017957 | Salt Marsh | LKIEMVNADGFKVFNDIEYDGEVYYLEEDSTGKSSSFYVNCGEKLNG |
| Ga0181582_102154191 | 3300017958 | Salt Marsh | YENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181581_104214013 | 3300017962 | Salt Marsh | KMAIRYENADGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGADV |
| Ga0181589_105750351 | 3300017964 | Salt Marsh | DGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGADV |
| Ga0181585_103216821 | 3300017969 | Salt Marsh | KLEIAYEDCDGFKVFNEFLYNGDSYHLEEDSTGKSSSFYVAEGDEV |
| Ga0180434_105067971 | 3300017991 | Hypersaline Lake Sediment | RKMAIRYENAEGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA |
| Ga0181600_103746211 | 3300018036 | Salt Marsh | NADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181601_106813401 | 3300018041 | Salt Marsh | ENADGFRCFNEIEYDGTGYYLEEDSTGKSSRFYVMEGDDV |
| Ga0181560_104345411 | 3300018413 | Salt Marsh | GIEMDKLKIRYTNADGFKVFNEVEYDGEAYYLEEDSTGKSSSFYVNCGEKLNG |
| Ga0181559_105780491 | 3300018415 | Salt Marsh | ENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0181563_102909493 | 3300018420 | Salt Marsh | FDMDKLKIRYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVSKGDNLK |
| Ga0181592_109642471 | 3300018421 | Salt Marsh | KMKIRYENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181568_111280413 | 3300018428 | Salt Marsh | DGFKCFNEIEYDGTGYYLEEDSTGKSSSFYVGAGADV |
| Ga0181564_105058221 | 3300018876 | Salt Marsh | ADGFRVFNEVEYDGEVYYLEEDSTGKSSSFYVNKGEKLDG |
| Ga0182058_11948791 | 3300019283 | Salt Marsh | GPDGLEIDKLKIRYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVMEGDDV |
| Ga0181578_104723221 | 3300020189 | Salt Marsh | GFRVFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0211677_102213551 | 3300020385 | Marine | KIRYTDADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDNL |
| Ga0211574_102687933 | 3300020446 | Marine | KLKISYVNADGFKVFNEIEYDGEAYYLEEDSTGKSSSFYVNCGKNI |
| Ga0211577_107707381 | 3300020469 | Marine | YTDADGFKVFNEVEYDGESYYLEEDSTGKSSSFYVMEGDDV |
| Ga0211547_104544042 | 3300020474 | Marine | DKLTIEMTNADGFRVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLE |
| Ga0213862_102119221 | 3300021347 | Seawater | KTGPDGLEIDKLKIRYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0213859_102167721 | 3300021364 | Seawater | DGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0206123_104219511 | 3300021365 | Seawater | IELDKLKIRYTNADGFKVFNDIEYNGEAYYLEEDSTGKSSSFYVNRGDSIDG |
| Ga0213863_104515372 | 3300021371 | Seawater | GIDFRKMAIRYENADGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDV |
| Ga0222718_100030831 | 3300021958 | Estuarine Water | EDCDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV |
| Ga0222718_100477605 | 3300021958 | Estuarine Water | ENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0222718_101144043 | 3300021958 | Estuarine Water | KMAIRYENADGFKCFNEIEYDGTGYYLEEDSTGKSSSFYVGAGADV |
| Ga0222718_105675593 | 3300021958 | Estuarine Water | EGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA |
| Ga0222716_101731504 | 3300021959 | Estuarine Water | GLDFKKMEIDYENCDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV |
| Ga0222716_103382202 | 3300021959 | Estuarine Water | RKMKVQYEDCDGFKVFNCIEYDGENYDLEEDSTGKSSSFYVMEGDDV |
| Ga0222715_1000709717 | 3300021960 | Estuarine Water | DFKKMEIDYEDCDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV |
| Ga0222715_102334073 | 3300021960 | Estuarine Water | DKLKIRYTDADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDNV |
| Ga0222715_105549572 | 3300021960 | Estuarine Water | IRYENAEGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA |
| Ga0222715_105884302 | 3300021960 | Estuarine Water | EIAYEDCDGFKVFNEFLYNGDSYYLEEDSTGKSSSFYVAEGDDV |
| Ga0222715_106480572 | 3300021960 | Estuarine Water | MKIRYENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0222714_100306671 | 3300021961 | Estuarine Water | YENCDGFRVFNSFDYDGENHYLEEDSTGKSSAFYVRAGDDV |
| Ga0222714_101220291 | 3300021961 | Estuarine Water | DFKKMAINYENCDGFQVFNSFDYDGENHYLEEDSTGKSSAFYVRAGDDV |
| Ga0222714_103471313 | 3300021961 | Estuarine Water | EGFNFKKLEINYENADGFRVFNSFIYDGEEHYLQEDSTGKSSSFYVGAGDDV |
| Ga0222719_102105692 | 3300021964 | Estuarine Water | GFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0196891_10762432 | 3300022183 | Aqueous | TDADGFKVFSEVEYDGESYYLEEDSTGKSSSFYVMAGDNL |
| Ga0222691_10377341 | 3300022851 | Saline Water | GIDFKKMKIDYENCDGFKCFSRIEYDGENYDLEEDSVGKSSSFYVMEGDDV |
| Ga0255783_100986536 | 3300022923 | Salt Marsh | GFKVFNEVEYDGEAYYLEEDSTGKSSSFYVNCGEKLNG |
| Ga0255758_104064321 | 3300022928 | Salt Marsh | KMAIRYENADGFRCFNEIEYDGTGYYLEEDSTGKSSSFYVMEGDDV |
| Ga0255752_104334922 | 3300022929 | Salt Marsh | VIRYENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0255770_102867483 | 3300022937 | Salt Marsh | DGFKVFNEIVYDNVPYYLEEDSTGKSSSFYVNKGTDV |
| Ga0255784_103012903 | 3300023108 | Salt Marsh | LKIRYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0255784_104729042 | 3300023108 | Salt Marsh | RYTDADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLE |
| Ga0255751_101415751 | 3300023116 | Salt Marsh | IRYENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0255757_104383792 | 3300023117 | Salt Marsh | EMDKLKIRYTDADGFKVFNEIEYDGEAYYLEEDSTGKSSSFYVAKGDKL |
| Ga0255761_103596222 | 3300023170 | Salt Marsh | LIKTDHRGLDFKKMEIDYENCDGFKVFHSVKYNAVDYFLQEDSTGKSSTFYVMEGDDV |
| Ga0255766_100156748 | 3300023172 | Salt Marsh | MSIDYENADGFKVFNEFMYDGESYYLEEDSTGKSSSFYVMEGDDI |
| Ga0255772_103639333 | 3300023176 | Salt Marsh | DFKKMRIKYENADGFRVFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0255772_104774202 | 3300023176 | Salt Marsh | NADGFKCFNEIEYDGTAYYLEEDSTGKSSSFYVGAGDDA |
| Ga0255759_106630522 | 3300023178 | Salt Marsh | KMRIKYENADGFRVFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0255768_100283491 | 3300023180 | Salt Marsh | KIRYENADGFRCFNEIEYDGTAYYLEEDSTGKSSSFYVMEGDDV |
| Ga0222650_10465473 | 3300023237 | Saline Water | FKKMKVQYEDAEGFKGFSCIEYDGETYDLEEDSTGKSSSFYVMEGDAV |
| Ga0228610_10608261 | 3300024281 | Seawater | LKIRYTDADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDNL |
| Ga0228658_11350592 | 3300024297 | Seawater | IKTGPDGIEIDKLTIEMTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLE |
| Ga0228632_10732043 | 3300024420 | Seawater | ADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0233396_10501484 | 3300024428 | Seawater | DGFKVFNDIEYNGEEYYLEEDSTGKSSSFYVGCGDKI |
| Ga0208669_10417191 | 3300025099 | Marine | FNEIEYDGEAYYLEEDSTGKSSSFYVNCGEKVQESQ |
| Ga0209348_11442263 | 3300025127 | Marine | DGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVSKGDNLK |
| Ga0209194_10497296 | 3300025632 | Pelagic Marine | NEIIYDNEPYYLEEDSMGKSSSFYVNAGENVQESQ |
| Ga0209833_11695392 | 3300025641 | Pelagic Marine | ELDKLKIRYTNADGFKVFNDIEYNGEAYYLEEDSTGKSSSFYVNRGDSIDG |
| Ga0208428_10340831 | 3300025653 | Aqueous | YENADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0209095_10634311 | 3300025685 | Pelagic Marine | DADGFKVFNEIEYQGEVYYLEEDSTGKSSSFYVMEGDDV |
| Ga0209532_11108071 | 3300025696 | Pelagic Marine | ADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0209532_11186313 | 3300025696 | Pelagic Marine | YTDADGFKVFNEVEYDGEVYYLEEDSTGKSSSFYVMEGDDV |
| Ga0209305_12257472 | 3300025712 | Pelagic Marine | IRYTDADGFKVFNEVEYDGEMYYLEEDSTGKSSSFYVMEGDNL |
| Ga0208150_12587652 | 3300025751 | Aqueous | TGPEGFDTKKMSIEYEDCDGFKVFNSFNYDGNNFYLEEDSTGKSSTFYVMEGDDV |
| Ga0208899_10461671 | 3300025759 | Aqueous | ADGFRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0209193_11522132 | 3300025816 | Pelagic Marine | NADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVNCGDRIDG |
| Ga0208917_11967302 | 3300025840 | Aqueous | DGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0209603_11514351 | 3300025849 | Pelagic Marine | DADGFKVFSEVEYDGESYYLEEDSTGKSSSFYVAKGDKV |
| Ga0209533_12580853 | 3300025874 | Pelagic Marine | KLKIRYTNADGFKVFNDIEYNGEAYYLEEDSTGKSSSFYVNRGDSIDG |
| Ga0208644_11223004 | 3300025889 | Aqueous | FRCFNEIEYDGEMYYLEEDSTGKSSSFYVMEGDDV |
| Ga0208644_13340302 | 3300025889 | Aqueous | GLDFKKMEINYENCDGFRVFNEITYDGENYFLEEDSTGKSSTFYVGAGDDV |
| Ga0209932_10824201 | 3300026183 | Pond Water | KMEIDYEDCDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV |
| Ga0209929_10281923 | 3300026187 | Pond Water | FKKMEIDYEDCDGFKVFHSIKYDAVDYFLQEDSTGKSSSFYVMEGDDV |
| Ga0183748_10381981 | 3300029319 | Marine | PEGIEIDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0302131_12789662 | 3300031594 | Marine | KKMNIDYEDADGFKVFSQVTIDGVDYYLQEDSSGKGSSFYVMEGDDV |
| Ga0315326_110095751 | 3300031775 | Seawater | EIDKLTIEMTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNLK |
| Ga0335396_107878323 | 3300032462 | Freshwater | EINYENADGFRVFNDIIYAGEAHPLEEDSTGKSSAFYVMAGDAV |
| ⦗Top⦘ |