


| Basic Information | |
|---|---|
| Family ID | F036360 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATRAIAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVALFVM |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.88 % |
| % of genes near scaffold ends (potentially truncated) | 99.41 % |
| % of genes from short scaffolds (< 2000 bps) | 90.59 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.412 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.412 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 8.70% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF00174 | Oxidored_molyb | 84.12 |
| PF01292 | Ni_hydr_CYTB | 1.76 |
| PF01641 | SelR | 1.18 |
| PF03358 | FMN_red | 1.18 |
| PF01790 | LGT | 0.59 |
| PF00072 | Response_reg | 0.59 |
| PF03976 | PPK2 | 0.59 |
| PF05402 | PqqD | 0.59 |
| PF05995 | CDO_I | 0.59 |
| PF11412 | DsbC | 0.59 |
| PF02614 | UxaC | 0.59 |
| PF13620 | CarboxypepD_reg | 0.59 |
| PF02566 | OsmC | 0.59 |
| PF03737 | RraA-like | 0.59 |
| PF11154 | DUF2934 | 0.59 |
| PF00378 | ECH_1 | 0.59 |
| PF00589 | Phage_integrase | 0.59 |
| PF13533 | Biotin_lipoyl_2 | 0.59 |
| PF10282 | Lactonase | 0.59 |
| PF13649 | Methyltransf_25 | 0.59 |
| PF01192 | RNA_pol_Rpb6 | 0.59 |
| PF03733 | YccF | 0.59 |
| PF00326 | Peptidase_S9 | 0.59 |
| PF07040 | DUF1326 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 84.12 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 84.12 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 1.76 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 1.76 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 1.76 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 1.76 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 1.76 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.18 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.59 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.59 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.59 |
| COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.59 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.59 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 0.59 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.59 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001131|JGI12631J13338_1022231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300001356|JGI12269J14319_10011171 | All Organisms → cellular organisms → Bacteria | 7172 | Open in IMG/M |
| 3300001356|JGI12269J14319_10163613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300001979|JGI24740J21852_10174447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100609097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 969 | Open in IMG/M |
| 3300002568|C688J35102_118577330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300003321|soilH1_10333869 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005177|Ga0066690_10363760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300005180|Ga0066685_10898073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005332|Ga0066388_105029040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300005344|Ga0070661_100935111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300005435|Ga0070714_102118835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005437|Ga0070710_11385743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300005444|Ga0070694_101650426 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005447|Ga0066689_10824725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005466|Ga0070685_10472366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300005518|Ga0070699_100993131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300005530|Ga0070679_100302205 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300005542|Ga0070732_10195499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1208 | Open in IMG/M |
| 3300005542|Ga0070732_10988633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005575|Ga0066702_10971285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 508 | Open in IMG/M |
| 3300005578|Ga0068854_100451868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300005602|Ga0070762_10118628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
| 3300005602|Ga0070762_10729647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300005614|Ga0068856_101038509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300005843|Ga0068860_100279418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1631 | Open in IMG/M |
| 3300005921|Ga0070766_10832479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300006028|Ga0070717_10452500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300006034|Ga0066656_11018388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300006034|Ga0066656_11144961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300006050|Ga0075028_100528249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300006174|Ga0075014_100369880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300006175|Ga0070712_100166757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1705 | Open in IMG/M |
| 3300006354|Ga0075021_10143831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
| 3300006354|Ga0075021_11120179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300006796|Ga0066665_10387306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300006903|Ga0075426_11540942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300009012|Ga0066710_100666320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
| 3300009012|Ga0066710_103731074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300009038|Ga0099829_11025573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300009090|Ga0099827_11363899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300009137|Ga0066709_101210919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300009174|Ga0105241_12432942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300009521|Ga0116222_1208520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300009549|Ga0116137_1199013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300009623|Ga0116133_1065561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300009645|Ga0116106_1255738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300009665|Ga0116135_1148684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300009665|Ga0116135_1196075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300009672|Ga0116215_1335991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300009762|Ga0116130_1021493 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300009764|Ga0116134_1198823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300009839|Ga0116223_10224717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300010048|Ga0126373_11531019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010304|Ga0134088_10196674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300010321|Ga0134067_10375436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300010336|Ga0134071_10088070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300010343|Ga0074044_10187257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300010343|Ga0074044_10335485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300010360|Ga0126372_10863122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300010360|Ga0126372_12991100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300010361|Ga0126378_11022543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300010366|Ga0126379_11590231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300010366|Ga0126379_12850035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300010366|Ga0126379_13746670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010379|Ga0136449_102128239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300010396|Ga0134126_12094684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300011269|Ga0137392_10936652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300011269|Ga0137392_11104479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300011271|Ga0137393_10546783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300012096|Ga0137389_10108843 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300012189|Ga0137388_10587425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300012199|Ga0137383_10185314 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300012206|Ga0137380_10083910 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300012206|Ga0137380_11757457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012210|Ga0137378_10009379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8493 | Open in IMG/M |
| 3300012210|Ga0137378_11303941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300012349|Ga0137387_10299066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300012362|Ga0137361_11688524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300012363|Ga0137390_11731170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012410|Ga0134060_1508415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012683|Ga0137398_10276887 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300012685|Ga0137397_11113868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012929|Ga0137404_10388973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300012929|Ga0137404_10442922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
| 3300012958|Ga0164299_11027547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012971|Ga0126369_10090924 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300013104|Ga0157370_10683324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300013764|Ga0120111_1155885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300014157|Ga0134078_10387339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300014745|Ga0157377_11091113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300015373|Ga0132257_100002458 | All Organisms → cellular organisms → Bacteria | 16759 | Open in IMG/M |
| 3300015374|Ga0132255_103487449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300017822|Ga0187802_10074636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300017823|Ga0187818_10131808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300017823|Ga0187818_10207257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300017933|Ga0187801_10057895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1418 | Open in IMG/M |
| 3300017933|Ga0187801_10407556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300017938|Ga0187854_10144946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300017940|Ga0187853_10396768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300017943|Ga0187819_10085031 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300017943|Ga0187819_10450588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300017943|Ga0187819_10529999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300017970|Ga0187783_10088605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2280 | Open in IMG/M |
| 3300017970|Ga0187783_10270150 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300017974|Ga0187777_11298157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300018012|Ga0187810_10071439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
| 3300018021|Ga0187882_1049663 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300018024|Ga0187881_10405234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300018043|Ga0187887_10179074 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300018057|Ga0187858_10075333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2347 | Open in IMG/M |
| 3300018060|Ga0187765_10307137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300018064|Ga0187773_10288681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300018086|Ga0187769_11524976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018090|Ga0187770_10730487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300018433|Ga0066667_12107754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300018468|Ga0066662_12707111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300019082|Ga0187852_1161830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300019870|Ga0193746_1023693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300019877|Ga0193722_1125607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300020022|Ga0193733_1052430 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300021170|Ga0210400_10991134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021178|Ga0210408_10244979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300021377|Ga0213874_10114098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300021432|Ga0210384_11826320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300021433|Ga0210391_11488023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021477|Ga0210398_11211570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021478|Ga0210402_11549893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300021479|Ga0210410_11632749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300021559|Ga0210409_11552111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300022504|Ga0242642_1087269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300025459|Ga0208689_1012265 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
| 3300025911|Ga0207654_10029017 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300025915|Ga0207693_10833608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300025920|Ga0207649_10933002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300025926|Ga0207659_10962501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300025932|Ga0207690_10453783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300026277|Ga0209350_1007921 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300026308|Ga0209265_1115300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300026328|Ga0209802_1275783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300026335|Ga0209804_1015244 | All Organisms → cellular organisms → Bacteria | 4077 | Open in IMG/M |
| 3300026361|Ga0257176_1082321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026532|Ga0209160_1137731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300026532|Ga0209160_1272681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300026557|Ga0179587_10039872 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300027570|Ga0208043_1070366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300027604|Ga0208324_1040353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300027604|Ga0208324_1103389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300027629|Ga0209422_1085214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300027660|Ga0209736_1050847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300027727|Ga0209328_10212870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300027853|Ga0209274_10304514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300027884|Ga0209275_10147881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300027911|Ga0209698_10860623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300028673|Ga0257175_1116035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300029990|Ga0311336_10173117 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300030494|Ga0310037_10093381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300030659|Ga0316363_10095401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300030659|Ga0316363_10118678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300031090|Ga0265760_10236340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300031708|Ga0310686_103212045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300032160|Ga0311301_11509136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300032783|Ga0335079_11085139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300032783|Ga0335079_12146011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300032828|Ga0335080_10134360 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
| 3300032828|Ga0335080_11272013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300032829|Ga0335070_10009332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11504 | Open in IMG/M |
| 3300032955|Ga0335076_10524175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300033402|Ga0326728_10593982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300033433|Ga0326726_12113434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.18% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.18% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.59% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12631J13338_10222313 | 3300001131 | Forest Soil | MSTQVIAVENAKTQEITEAVYEHPFIVRLCHWVNAV |
| JGI12269J14319_100111711 | 3300001356 | Peatlands Soil | MATRAIEIIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVAL |
| JGI12269J14319_101636131 | 3300001356 | Peatlands Soil | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSL |
| JGI24740J21852_101744472 | 3300001979 | Corn Rhizosphere | MPASTVAIENTKTGEVTEAAYEHPFIVRLCHWVNAVSLVVMV |
| JGIcombinedJ26739_1006090973 | 3300002245 | Forest Soil | MATRAIAIEDAKTGEVTEAVYEHPFVVRLCHWVNAVVLFVMIGSG |
| C688J35102_1185773302 | 3300002568 | Soil | MPGHVVAIEDVKAGGRTEIVYEHPFIVRLCHWVNAVALFVLIGSGL |
| soilH1_103338693 | 3300003321 | Sugarcane Root And Bulk Soil | MAARSIIIEDTKTGTETPAVFEHPFVVRLCHWVNAVALFVLVGSGL |
| Ga0066690_103637602 | 3300005177 | Soil | MATQAVSIEDAKTGETTEAVYEHPFAVRLCHWINAVALFVMVGS |
| Ga0066685_108980732 | 3300005180 | Soil | MSTQIAAITNVKTGAISEAVYEHPFIVRLCHWVNALALLVLVF |
| Ga0066388_1050290401 | 3300005332 | Tropical Forest Soil | MATSVIAIENSKTGEVNEAVYEHPFIVRLCHWVNAVALFVM |
| Ga0070661_1009351112 | 3300005344 | Corn Rhizosphere | MATRVVEIEETKNGEITQAVYEHPFIVRLCHWVNAVALFV |
| Ga0070714_1021188351 | 3300005435 | Agricultural Soil | MASHAVEIENPKTGEVTEAVYEHPFIVRLCHWVNAISLFV |
| Ga0070710_113857431 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAIAIEDAKTGDITEAVYEHPFVVRLCHWVNAISLFVMVGSGLQIFR |
| Ga0070694_1016504262 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRATAIEDAKTGDITEAVYEHPFVVRLCHWLNAISLFVMVGSG |
| Ga0066689_108247252 | 3300005447 | Soil | MATRATAIEDVRTGEVTQAVYEHPFVVRLCHWVNAVSLFVM |
| Ga0070685_104723662 | 3300005466 | Switchgrass Rhizosphere | MAKPAVVIENTKNDEVSEAIYEHPFIVRLCHWVNAVALFVMVGSGLQIF |
| Ga0070699_1009931311 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTSAVAIEDTKTGEITEAVYEHPFIVRLCHWVNAVALFVMVG |
| Ga0070679_1003022053 | 3300005530 | Corn Rhizosphere | MATRVVEIEDTKDGEITQAVYEHPFIVRLCHWVNAVALFVMIGSGLQ |
| Ga0070732_101954993 | 3300005542 | Surface Soil | MSSRAIEIDDPKTGEMGEAVYEHPFIVRLCHWVNAVALFVLAGSGLQI |
| Ga0070732_109886331 | 3300005542 | Surface Soil | MASRAVEIDDPKTGEMGEAVYEHPFIVRLCHWVNAVALFVLAGSGLQI |
| Ga0066702_109712852 | 3300005575 | Soil | MATQAITSIDPKGGEATEAVYEHPYIVRLCHWINTVALFVLIGSGLQ |
| Ga0068854_1004518682 | 3300005578 | Corn Rhizosphere | MATRVVEIEETKNGEITQAVYEHPFIVRLCHWVNAVALFVMIG |
| Ga0070762_101186281 | 3300005602 | Soil | MATRAIAVEDVKTGETIEAVYEHPFIVRFCHWLNAVALF |
| Ga0070762_107296471 | 3300005602 | Soil | MATRAIAIEDVKTGEVTEAVYEHPLVVRICHWVNAVALFVMIG |
| Ga0068856_1010385091 | 3300005614 | Corn Rhizosphere | MATRATAIEDAKTGDITEAVYEHPFVVRLCHWLNAISLFVMVGSGL |
| Ga0068860_1002794183 | 3300005843 | Switchgrass Rhizosphere | MPASTVAIENTKTGEVTEAAYEHPFIVRLCHWVNAVSLVVMVGSG |
| Ga0070766_108324792 | 3300005921 | Soil | MSTQAIAIENAKRGKVSEAVYEHPLVIRICHWVNAV |
| Ga0070717_104525001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAIAIEDVKTGEVTEAVYEHPFVVRLCHWVNAV |
| Ga0066656_110183882 | 3300006034 | Soil | MATRTMAIEDVKTGEVTQAVYEHPFVVRLCHWVNAVSLFVMVGSGFQ |
| Ga0066656_111449612 | 3300006034 | Soil | MSTQIAAITNVKTGAISEAVYEHPFIVRLCHWVNALA |
| Ga0075028_1005282491 | 3300006050 | Watersheds | MATRAVAIEDVKTGEVAQAVYEHPFLVRLCHWVNAVSLF |
| Ga0075014_1003698801 | 3300006174 | Watersheds | MATRAIAIEDVKTGEVTQAVYEHPLVVRLCHWVNAVSLFVM |
| Ga0070712_1001667573 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAVAIEDAKTGKVTQAVYEHPSIVRLCHWVNAVALFVMVGS |
| Ga0075021_101438311 | 3300006354 | Watersheds | VSSHGIAIENAKTGEVTEAVYEHPLVVRLCHWVNAVS |
| Ga0075021_111201791 | 3300006354 | Watersheds | MATRAMAIEDAKTGDITEAVYEHPFVVRLCHWVNAISL |
| Ga0066665_103873061 | 3300006796 | Soil | MSTRAIAVENVKTGEVTEAVYEHPLVVRLCHWVNVVSLFV |
| Ga0075426_115409421 | 3300006903 | Populus Rhizosphere | MATRATAIEDAKTGDITEAVYEHPFVVRLCHWLNAISLFV |
| Ga0066710_1006663201 | 3300009012 | Grasslands Soil | MATRAIEVENLKTGEVTEAVYEHPLVVRLCHWVNA |
| Ga0066710_1037310742 | 3300009012 | Grasslands Soil | MATRATAIEDVRTGEVTQAVYEHPFVVRLCHWVNAVSLFVMVGSGFQIFRAF |
| Ga0099829_110255732 | 3300009038 | Vadose Zone Soil | MPTQAIAIENAKTGEVTEAVYEHPLVVRLCHWVNAVSLFVMVG |
| Ga0099827_113638991 | 3300009090 | Vadose Zone Soil | MSTRAIAVENVKTGEVTEAVYEHPFVVRLCHWVNVVSLFVL |
| Ga0066709_1012109191 | 3300009137 | Grasslands Soil | MATSLAIENAKTDEVTEAVYEHPFIVRLCHWVNAVSLFVMV |
| Ga0105241_124329421 | 3300009174 | Corn Rhizosphere | MATRVLDIENPKTGEVTPAVYEHPFIVRLCHWVNAV |
| Ga0116222_12085202 | 3300009521 | Peatlands Soil | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVALFEMVRSGLQ |
| Ga0116137_11990131 | 3300009549 | Peatland | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVSLFVM |
| Ga0116133_10655611 | 3300009623 | Peatland | MATRAIAVEDVKTGEETIAVYEHPFVVRLCHWVNAVALFVMAGSGLQIFR |
| Ga0116106_12557381 | 3300009645 | Peatland | MATRAIAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVALFVMI |
| Ga0116135_11486841 | 3300009665 | Peatland | MSTQAIAIENAKTGEITEAVYEHPFVVRLCHWVNAVSLFVMVGS |
| Ga0116135_11960751 | 3300009665 | Peatland | MATRAIAIENVKTGEVTEAVYEHPFVVRLFHWVNAISLFVMAGSGL |
| Ga0116215_13359911 | 3300009672 | Peatlands Soil | MASRAIEIEDVKTGEVTEAVYEHPLVVRLCHWVNAVSLFVMVGSGFQI |
| Ga0116130_10214936 | 3300009762 | Peatland | MATRAIAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVALFVM |
| Ga0116134_11988231 | 3300009764 | Peatland | MATRAKAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVALFVM |
| Ga0116223_102247171 | 3300009839 | Peatlands Soil | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMVGSGFQIFRAFP |
| Ga0126373_115310191 | 3300010048 | Tropical Forest Soil | MATRAISIENGKSGEVTPAVYEHPFIVRLCHWVNAVALFVLVGSGLQIF |
| Ga0134088_101966741 | 3300010304 | Grasslands Soil | MATRATAIEDVRTGEVTQAVYEHPFVVRLCHWVNAVSLFVMVGSGFQ |
| Ga0134067_103754362 | 3300010321 | Grasslands Soil | MSTQIAAITNVKTGAIDEAVYEHPFIVRLCHWVNAVAPLVLVFSGLQIF |
| Ga0134071_100880701 | 3300010336 | Grasslands Soil | MATRATAISDVRTGEVTQAVYEHPFVVRLCHWVNAVSLFVM |
| Ga0074044_101872573 | 3300010343 | Bog Forest Soil | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVALFVMVGSGLQ |
| Ga0074044_103354852 | 3300010343 | Bog Forest Soil | MATRAIAIEDVKTGEVTAAVYEHPFVVRLCHWVNAVALFVMVGS |
| Ga0126372_108631221 | 3300010360 | Tropical Forest Soil | MATRAIAIEDRKTGEVAPAVYEHPFVVRLCHWVNAVALFVMV |
| Ga0126372_129911002 | 3300010360 | Tropical Forest Soil | MASRALEVDDPKTGEVTEAAYEHPLIVRLCHWGNAVALFVLVGSGLQIFR |
| Ga0126378_110225432 | 3300010361 | Tropical Forest Soil | MATRTIAIEDGKTGEVAPAAYEHPFIVRLCHWVNAVALFV |
| Ga0126379_115902311 | 3300010366 | Tropical Forest Soil | MATPAVVIENTKTDEVSEAVYEHPFIVRLCHWVNAVALFVMVGSG |
| Ga0126379_128500351 | 3300010366 | Tropical Forest Soil | MATRTLTIDNKETGASTQAVYEHPFIVRLCHWLNAASLF |
| Ga0126379_137466702 | 3300010366 | Tropical Forest Soil | MATQAIEIENPKTGEVMEAVYEHPFVVRLCHWINAVA |
| Ga0136449_1021282391 | 3300010379 | Peatlands Soil | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVALFVM |
| Ga0134126_120946841 | 3300010396 | Terrestrial Soil | MRSAFITNPKTGKTASAVYEHPYVVRLCHWLNTISLFVMIGSGLQI |
| Ga0137392_109366522 | 3300011269 | Vadose Zone Soil | MATRAIAFENVKTGEVTEAVYEHPLLVRLCHWVNAVSLLVMVGSGFQI |
| Ga0137392_111044791 | 3300011269 | Vadose Zone Soil | MASRAIEIENAKTGEIAEAVYEHPFIVRLCHWVNAVSLFVMVGSGLQIFRAF |
| Ga0137393_105467831 | 3300011271 | Vadose Zone Soil | MATRAIEIENIKTGEVTEAVYEHPFIVRLCHWVNAISLFVLVG |
| Ga0137389_101088431 | 3300012096 | Vadose Zone Soil | MSTHAIAIKNVKTGEVTTADSEHPLVVRLCDWLDTVALGVRVGSG |
| Ga0137388_105874252 | 3300012189 | Vadose Zone Soil | MATRAIEIENIKTGEVTEAVYEHPFIVRLCHWVNAISLFVLIGSGLQI |
| Ga0137383_101853141 | 3300012199 | Vadose Zone Soil | MFMATRAIEIEDAKAKNGEVVEAVYEHPFIVRLCHWVNATAL |
| Ga0137380_100839101 | 3300012206 | Vadose Zone Soil | MSTRAIAVENVKTGEVTEAVYEHPFVVRLCHWVNV |
| Ga0137380_117574572 | 3300012206 | Vadose Zone Soil | MATRAMEVENVKTGEVTEAVYEHPLVVRLCHWVNAVALFVMVGSGLQ |
| Ga0137378_100093791 | 3300012210 | Vadose Zone Soil | MATRAIEIEDAKTGAIVEAVYEHPLIVRLCHWINTVSLFVLVGSGLQ |
| Ga0137378_113039412 | 3300012210 | Vadose Zone Soil | MASRVIEIDNPKTGEVVEAVYEHPFIVRLCHWVNAVSLFVMVG |
| Ga0137387_102990661 | 3300012349 | Vadose Zone Soil | VATRTLEVENLKTGEVTEAVYEHPLVVRLCHWVNAVALFVM |
| Ga0137361_116885241 | 3300012362 | Vadose Zone Soil | MASRAIEIEDAKTGEVVEAVYEHPFIVRLCHWINAV |
| Ga0137390_117311701 | 3300012363 | Vadose Zone Soil | MATRAIEITDARTGEVTEAVYEHPFIVRLCHWVNAVSLF |
| Ga0134060_15084151 | 3300012410 | Grasslands Soil | MSTQIAAITNVKTGAISEAVYEHPFIVRLCHWVNAVALLVL |
| Ga0137398_102768871 | 3300012683 | Vadose Zone Soil | MKMATQVITIDNPKTGEATEAVREHPLIVRLCHWVNAV |
| Ga0137397_111138682 | 3300012685 | Vadose Zone Soil | MATRAMEVEDVKTGEVTEAVYEHPFLVRLCHWVNAVSLFV |
| Ga0137404_103889731 | 3300012929 | Vadose Zone Soil | MATRTVEVENVNTGEVTEAVHQHPFVVRLSHWVKAVALFVMEDIGLQLD |
| Ga0137404_104429221 | 3300012929 | Vadose Zone Soil | MATQVITIENTKTGDAAQAVREHPLIVRLCHWVNAIALFIMIGSGL |
| Ga0164299_110275471 | 3300012958 | Soil | MSTRALTIEDPKTGEVTEAVYEHPYIVRLCHWVNTVALFVLVGSGLQI |
| Ga0126369_100909241 | 3300012971 | Tropical Forest Soil | MAASSILIADKKTGAETPAVYEHPFLVRLCHWMNAVA |
| Ga0157370_106833241 | 3300013104 | Corn Rhizosphere | LTGRAALIEDQKTGKTTTAVYEHPYIVRLCHWLNTVSLFVMIG |
| Ga0120111_11558852 | 3300013764 | Permafrost | MASRAIEIENVKTGEVVDAVHEHPFIVRLCHWVNAV |
| Ga0134078_103873392 | 3300014157 | Grasslands Soil | MSTRIIEIEDAKDGEITEVVYEHPFIVRLCHWVNA |
| Ga0157377_110911131 | 3300014745 | Miscanthus Rhizosphere | MAKPAVVIENTKNDEVSEAIYEHPFIVRLCHWVNAVALFVMVGSGLQIFR |
| Ga0132257_10000245819 | 3300015373 | Arabidopsis Rhizosphere | MATRATTIKDAKTGDITEAVYEHPFVVRLCHWLNAIS |
| Ga0132255_1034874491 | 3300015374 | Arabidopsis Rhizosphere | MATRAMAIEDVKTGEVTQAVYEHPLVVRLCHWVNAVSL |
| Ga0187802_100746361 | 3300017822 | Freshwater Sediment | MATRAIAIEDAKTGEIIEAVYEHPFVVRLCHWVNAVSLFVMV |
| Ga0187818_101318081 | 3300017823 | Freshwater Sediment | MATRAMAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMVGSGLQI |
| Ga0187818_102072572 | 3300017823 | Freshwater Sediment | MATRAIAIEDVKTGEVTEAVYEHPLVVRLCHWVNAIALFVMVGS |
| Ga0187801_100578951 | 3300017933 | Freshwater Sediment | MSTQALTIEDAKTGEVIEAVYEHPFVIRLCHWVNAVSLFV |
| Ga0187801_104075562 | 3300017933 | Freshwater Sediment | MASRAIVIEDVKTGEVTEAVYEHPLVVRLCHWVNAVSLFVMVGSGFQIFR |
| Ga0187854_101449462 | 3300017938 | Peatland | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNA |
| Ga0187853_103967681 | 3300017940 | Peatland | MATRAIAIEDVKTGEATEAVYEHPLVVRLCHWVNAVAL |
| Ga0187819_100850311 | 3300017943 | Freshwater Sediment | MATRAIAIEDAKTGDITEAVYEHPFVVRLCHWVNA |
| Ga0187819_104505882 | 3300017943 | Freshwater Sediment | MASRAIEIEDVKTGEVTEAVYEHPLVVRLCHWVNAVSLFVMVGSGFQIFR |
| Ga0187819_105299991 | 3300017943 | Freshwater Sediment | MSTQAIAIENVNTGEVTEAVYEHPLVVRLCHWVNAVSLFVMVGS |
| Ga0187783_100886051 | 3300017970 | Tropical Peatland | MEMTTHGIAIEDTKSGKVTEAVYEHPFVVRLCHWVNA |
| Ga0187783_102701503 | 3300017970 | Tropical Peatland | MEMVTRGIAIEDTKSGKVTEAVYEHPFVVRLCHWVNAVSLF |
| Ga0187777_112981572 | 3300017974 | Tropical Peatland | MRTRAFSTAIEVENVKTCEVSQAVYEHPFVVRLCHWVNTVSLFA |
| Ga0187810_100714393 | 3300018012 | Freshwater Sediment | MATRTITIEEARSGEVTEAVYEHPFVVRLCHWVNAISLFVMVGSGLQ |
| Ga0187882_10496631 | 3300018021 | Peatland | MATRAIAIEDVKTGEVTEAVYEHPFVVRLCHWVNAVAL |
| Ga0187881_104052342 | 3300018024 | Peatland | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMVGSGFQIFRAFPSFGAK |
| Ga0187887_101790741 | 3300018043 | Peatland | MATRGIEIENVKTREVTEAVYEHLFVVRLCHWVNAVSLFVMAGS |
| Ga0187858_100753332 | 3300018057 | Peatland | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVRCS |
| Ga0187765_103071371 | 3300018060 | Tropical Peatland | MATQTIAIENTKTGQVTEVVYEHPFIVRLCHWVNAVSLFVMAGSGLQVF |
| Ga0187773_102886812 | 3300018064 | Tropical Peatland | MTTSAVTIENTKTGEVTLAVHEHPLIVRLCHWVNAVALFVMVGSGLQI |
| Ga0187769_115249761 | 3300018086 | Tropical Peatland | MATRTLAIEDVKTGELTDAVYEHPFVVRLCHWVNAVSLFVMVASGLR |
| Ga0187770_107304871 | 3300018090 | Tropical Peatland | MATRALGIEDAKTGEVTVAAYEHPFLVRLCHWANAISLFV |
| Ga0066667_121077542 | 3300018433 | Grasslands Soil | MATRAIEIEDPKNGEVTLAVNEHPLVVRLCHWINAVALFVLVGSGLQIFKAF |
| Ga0066662_127071112 | 3300018468 | Grasslands Soil | MATRAIEIENIKTGEVTQAVYEHPFIVLLCHWVNAILLLVLVGC |
| Ga0187852_11618302 | 3300019082 | Peatland | MATRAIAIEDVKTGEATEAVYEHPFVVRFCHWVNAVALFVMIGSGLQ |
| Ga0193746_10236932 | 3300019870 | Soil | MKSPMLEIEDAKTGEVLEAVYEHPFIVRFCHWVNAVSLFVMVGSGMQIFRA |
| Ga0193722_11256072 | 3300019877 | Soil | MAARVLDIENPKTGEVTPAVYEHPFIVRLCHWVNAVALFVLV |
| Ga0193733_10524303 | 3300020022 | Soil | MASRAIEIEDAKTGEVTEAAYEHPFIVRLCHWVNS |
| Ga0210400_109911341 | 3300021170 | Soil | MATRLIAIEDLKTGEITKAVYEHPFVVRLCHWLNAISLFVMVGSGFQIC |
| Ga0210408_102449791 | 3300021178 | Soil | MSRQAIAIENAKTGEISEAVYEHPLVVRLCHWVNAVALFV |
| Ga0213874_101140982 | 3300021377 | Plant Roots | VGMSAKEVTIENRKTGDITDAVYEHPLIIRYCHWLNAVALFVL |
| Ga0210384_118263201 | 3300021432 | Soil | MTVATRAIAIENVKTGEVTEAVYEHPFVVRLCHWV |
| Ga0210391_114880231 | 3300021433 | Soil | MATGVIAIEDVKTGEITEAVYEHPFVVRLCHWLNAISLFVMVGSGFQIF |
| Ga0210398_112115702 | 3300021477 | Soil | MATRLIAIEDLKTGEITKAVYEHPFVVRLCHWLNAISLFVMVGSGFQIFRA |
| Ga0210402_115498931 | 3300021478 | Soil | MSTQVIAIENAKTGEITEAVYEHPFVVRLCHWVNAMSLF |
| Ga0210410_116327491 | 3300021479 | Soil | MSIQAIAIENAKTGEVTEAVYEHPLVVRLCHWVNTVALFVMVGSGL |
| Ga0210409_115521111 | 3300021559 | Soil | MSTQAIAIENAKTGEVSEAVYEHPLVVRLCHWVNA |
| Ga0242642_10872691 | 3300022504 | Soil | MATRAIAIENAKTGEVTEAVYEHPFVVRLCHWVNA |
| Ga0208689_10122651 | 3300025459 | Peatland | MATRAIAIENVKTGEVTEAVYEHPFVVRLCHWVNAVALFVMIGSGFQIF |
| Ga0207654_100290171 | 3300025911 | Corn Rhizosphere | MATRVVEIEETKNGEITQAVYEHPFIVRLCHWVNAVALF |
| Ga0207693_108336082 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAMAIEDVKTGEVTKAVHEHPLVVRLCHWANAVSLFVMVGSGLQIFR |
| Ga0207649_109330021 | 3300025920 | Corn Rhizosphere | MATRVVEIEETKNGEIAQAVYEHPFIVRLCHWVNAVALF |
| Ga0207659_109625011 | 3300025926 | Miscanthus Rhizosphere | MAKPAVVIENTKNDEVSEAIYEHPFIVRLCHWVNAVALF |
| Ga0207690_104537832 | 3300025932 | Corn Rhizosphere | MAKPAVVIENTKNDEVSEAIYEHPFIVRLCHWVNAVALFVMVG |
| Ga0209350_10079215 | 3300026277 | Grasslands Soil | MSTQIAAITNVKTGAISEAVYEHPFIVRLCHWVNALALLV |
| Ga0209265_11153002 | 3300026308 | Soil | MSTQIAAITNVKTGVIDEAVYEHPFIVRLCHWVNAMALLVM |
| Ga0209802_12757832 | 3300026328 | Soil | MEKFYLAVRAIEIENIKTGEVTEAVNQHPFIVRLCHWLNAISLFVLVGSG |
| Ga0209804_10152444 | 3300026335 | Soil | MSTQIAAITNVKTGAIDEAVYEHPFIVRLCHWVNA |
| Ga0257176_10823212 | 3300026361 | Soil | MATRAIEIENLKTGEVTEAVYEHPLIVRLCHWINAVAL |
| Ga0209160_11377312 | 3300026532 | Soil | MSTRAIAIENVKTGEVTEAVYEHPFAVRLCHWVNVVSLFVLVGSGL |
| Ga0209160_12726812 | 3300026532 | Soil | MSTQIAAITNVKTGAISEAVYEHPFIVRLCHWVNAVALLVLVFSGLQ |
| Ga0179587_100398721 | 3300026557 | Vadose Zone Soil | MATQVITIDNPKTGEATEAVREHPLIVRLCHWVNAVA |
| Ga0208043_10703661 | 3300027570 | Peatlands Soil | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVALFVMV |
| Ga0208324_10403531 | 3300027604 | Peatlands Soil | MATRAIAIEDVKTGEATEAVYEHPFVVRLCHWVNAVALFVMVG |
| Ga0208324_11033891 | 3300027604 | Peatlands Soil | MATRVIAIEDVKTGEITEAVYEHPFVVRLCHWLNAIS |
| Ga0209422_10852142 | 3300027629 | Forest Soil | MATRAIAIEDAKTGDITEAVYEHPFVVRLCHWMNAIS |
| Ga0209736_10508471 | 3300027660 | Forest Soil | MSTQAIAIENAKTGEVTEAVYEHPLIVRLCHWINAVALFVMV |
| Ga0209328_102128702 | 3300027727 | Forest Soil | MATRVIAIENVKTGKITGAVYEHPFVVRLCHWLNAISLFVMVGSGFQIFRAFPRFGA |
| Ga0209274_103045142 | 3300027853 | Soil | MSAPAITIENAKTGEITEAVYEHPLVIRICHWVNAVSLFVMVGS |
| Ga0209275_101478813 | 3300027884 | Soil | MATRAIAVEDVKTGETIEAVYEHPFIVRFCHWLNAVALFV |
| Ga0209698_108606231 | 3300027911 | Watersheds | MATRAVTIEDAKTGEVTTAVCEHPFIVRLCHWVNAIALFV |
| Ga0257175_11160352 | 3300028673 | Soil | MATRAIAIENVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMAGSGLQIFRAF |
| Ga0311336_101731171 | 3300029990 | Fen | MATQAIAVEDAKTGEVISAVYEHPFIVRFCHWVNAVA |
| Ga0310037_100933812 | 3300030494 | Peatlands Soil | MSTQAISIENVKTGEVTEAVYEHPLVVRICHWVNAVSLFVMVGSGL |
| Ga0316363_100954011 | 3300030659 | Peatlands Soil | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMVGSGFQIFRAFPS |
| Ga0316363_101186782 | 3300030659 | Peatlands Soil | MATRVIAIEDVKTGEITEAVYEHPFVVRLCHWLNAISLFVMVASGFQIFRA |
| Ga0265760_102363401 | 3300031090 | Soil | MATRVIAIEDMKTGEITEAVYEHPFVVRLCHWLNA |
| Ga0310686_1032120452 | 3300031708 | Soil | MSTQAIAIENAKTGEISEAVYEHPLVVRLCHWVNAVALFVMVGSGL |
| Ga0311301_115091361 | 3300032160 | Peatlands Soil | MATRAIAVEDVKTGEVTEAVYEHPFMVRLCHWLNAVALF |
| Ga0335079_110851391 | 3300032783 | Soil | MATRAIAVEDVKTGEETIAVYEHPFVVRLCHWVNAVALFVMVGSG |
| Ga0335079_121460111 | 3300032783 | Soil | MTTRAIAIEDAKKGEVIVAAYEHPLIVRLCHWSNTVSLFVMVGSGLQIFRA |
| Ga0335080_101343601 | 3300032828 | Soil | MASHAIDVIEIEDGKTSEVTEAVYEHPYLVRLCHWVNAVALFVMVG |
| Ga0335080_112720131 | 3300032828 | Soil | MATRAIAIEDAKTGEITPAVYEHPFIVRLCHWVNLIALFVMV |
| Ga0335070_100093321 | 3300032829 | Soil | MAIRTVTIDEPKTGASTQAVYEHPLVVRLCHWLNAVALF |
| Ga0335076_105241751 | 3300032955 | Soil | MATRAITIENAKSGEVVEAIYEHPSVVRLCHWLNTVSLFVMVGSGLQI |
| Ga0326728_105939821 | 3300033402 | Peat Soil | MASRAIEIEDVKTGEVTEAVYEHPFVVRLCHWVNAVSLFVMVGSGFQIFRAFPSF |
| Ga0326726_121134342 | 3300033433 | Peat Soil | MATRAMAIEDVKTGEVTQAVYEHPLVVRLCHWVNAVSLFVMVGS |
| ⦗Top⦘ |