


| Basic Information | |
|---|---|
| Family ID | F036324 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 43 residues |
| Representative Sequence | WFAKRGMFALSIALDEGDGDKLVDAVEEFAQTRAPLFDGVGAG |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.88 % |
| % of genes from short scaffolds (< 2000 bps) | 91.76 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.588 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.941 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.353 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF01063 | Aminotran_4 | 19.41 |
| PF01979 | Amidohydro_1 | 10.59 |
| PF00496 | SBP_bac_5 | 8.82 |
| PF15919 | HicB_lk_antitox | 6.47 |
| PF01435 | Peptidase_M48 | 3.53 |
| PF00202 | Aminotran_3 | 2.94 |
| PF00012 | HSP70 | 1.76 |
| PF00106 | adh_short | 1.18 |
| PF00211 | Guanylate_cyc | 1.18 |
| PF07883 | Cupin_2 | 1.18 |
| PF14325 | DUF4383 | 0.59 |
| PF12694 | cpYpsA | 0.59 |
| PF00127 | Copper-bind | 0.59 |
| PF03681 | Obsolete Pfam Family | 0.59 |
| PF02775 | TPP_enzyme_C | 0.59 |
| PF08388 | GIIM | 0.59 |
| PF02798 | GST_N | 0.59 |
| PF01007 | IRK | 0.59 |
| PF04828 | GFA | 0.59 |
| PF02517 | Rce1-like | 0.59 |
| PF13738 | Pyr_redox_3 | 0.59 |
| PF12681 | Glyoxalase_2 | 0.59 |
| PF02530 | Porin_2 | 0.59 |
| PF00753 | Lactamase_B | 0.59 |
| PF13676 | TIR_2 | 0.59 |
| PF07396 | Porin_O_P | 0.59 |
| PF00326 | Peptidase_S9 | 0.59 |
| PF02653 | BPD_transp_2 | 0.59 |
| PF00300 | His_Phos_1 | 0.59 |
| PF13473 | Cupredoxin_1 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 38.82 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 1.76 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.18 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.59 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.59 % |
| Unclassified | root | N/A | 9.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101551436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300003219|JGI26341J46601_10000058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 31591 | Open in IMG/M |
| 3300003219|JGI26341J46601_10023010 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300003223|JGI26343J46809_1022068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300004080|Ga0062385_10057813 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300004081|Ga0063454_100679067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300004082|Ga0062384_100370204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300004082|Ga0062384_100992798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300004092|Ga0062389_100946301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300004092|Ga0062389_104034080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300005179|Ga0066684_10833855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 607 | Open in IMG/M |
| 3300005186|Ga0066676_10026349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3107 | Open in IMG/M |
| 3300005332|Ga0066388_108381755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300005435|Ga0070714_101077069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 783 | Open in IMG/M |
| 3300005436|Ga0070713_100507542 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005437|Ga0070710_11263365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 548 | Open in IMG/M |
| 3300005467|Ga0070706_100964582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005549|Ga0070704_101731121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 578 | Open in IMG/M |
| 3300005560|Ga0066670_10103119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300005764|Ga0066903_106097502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 631 | Open in IMG/M |
| 3300006028|Ga0070717_11740602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300006046|Ga0066652_101502399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 625 | Open in IMG/M |
| 3300006176|Ga0070765_101428945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 652 | Open in IMG/M |
| 3300006176|Ga0070765_101767397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300006791|Ga0066653_10223659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300006804|Ga0079221_10745538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 691 | Open in IMG/M |
| 3300006854|Ga0075425_100960801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 976 | Open in IMG/M |
| 3300007258|Ga0099793_10108834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300009038|Ga0099829_10204946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1597 | Open in IMG/M |
| 3300009088|Ga0099830_10706769 | Not Available | 830 | Open in IMG/M |
| 3300009792|Ga0126374_10104985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1613 | Open in IMG/M |
| 3300009792|Ga0126374_11175152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 613 | Open in IMG/M |
| 3300009792|Ga0126374_11388861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300010043|Ga0126380_11055685 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010046|Ga0126384_10726001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300010343|Ga0074044_10719326 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010359|Ga0126376_11511400 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010361|Ga0126378_13322353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300010369|Ga0136643_10752577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300010373|Ga0134128_13008209 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010379|Ga0136449_101581474 | Not Available | 997 | Open in IMG/M |
| 3300010398|Ga0126383_11992200 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010403|Ga0134123_11483760 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300011120|Ga0150983_13733066 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300011270|Ga0137391_10880393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300011271|Ga0137393_10141399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2001 | Open in IMG/M |
| 3300012096|Ga0137389_11324816 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012209|Ga0137379_10799141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300012209|Ga0137379_11498182 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012211|Ga0137377_11840935 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012212|Ga0150985_101676125 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012363|Ga0137390_10518788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300012469|Ga0150984_111320326 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012923|Ga0137359_10267277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300012925|Ga0137419_10402753 | Not Available | 1069 | Open in IMG/M |
| 3300012925|Ga0137419_11203377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300012927|Ga0137416_10372769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
| 3300012960|Ga0164301_11595982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300012971|Ga0126369_11363924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → unclassified Acidisoma → Acidisoma sp. S159 | 799 | Open in IMG/M |
| 3300012971|Ga0126369_11367319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300012971|Ga0126369_13490040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300013296|Ga0157374_12225513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300014501|Ga0182024_10687507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300014654|Ga0181525_10637541 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300015054|Ga0137420_1487697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1380 | Open in IMG/M |
| 3300015242|Ga0137412_10864597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300015264|Ga0137403_10282331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1560 | Open in IMG/M |
| 3300015373|Ga0132257_102941824 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300015374|Ga0132255_101672590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 965 | Open in IMG/M |
| 3300016270|Ga0182036_11225040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300016294|Ga0182041_10203112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1579 | Open in IMG/M |
| 3300016294|Ga0182041_11396869 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300016357|Ga0182032_11512367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300016357|Ga0182032_11966418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300016371|Ga0182034_11842026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300016404|Ga0182037_10093363 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300016404|Ga0182037_11449012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
| 3300016404|Ga0182037_11991666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300016422|Ga0182039_10840707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 817 | Open in IMG/M |
| 3300016422|Ga0182039_12264945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300016445|Ga0182038_10133744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1865 | Open in IMG/M |
| 3300017961|Ga0187778_10853920 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300017970|Ga0187783_10775010 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300018062|Ga0187784_11691479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300018431|Ga0066655_10714424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300020582|Ga0210395_11397061 | Not Available | 511 | Open in IMG/M |
| 3300020583|Ga0210401_10605068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300021170|Ga0210400_11212589 | Not Available | 607 | Open in IMG/M |
| 3300021384|Ga0213876_10238435 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021403|Ga0210397_10282108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1215 | Open in IMG/M |
| 3300021444|Ga0213878_10087175 | Not Available | 1256 | Open in IMG/M |
| 3300021476|Ga0187846_10117361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1138 | Open in IMG/M |
| 3300021560|Ga0126371_13423531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 536 | Open in IMG/M |
| 3300022523|Ga0242663_1013378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → unclassified Rhizobiaceae → Rhizobiaceae bacterium | 1140 | Open in IMG/M |
| 3300022531|Ga0242660_1158408 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300022533|Ga0242662_10000386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4878 | Open in IMG/M |
| 3300022726|Ga0242654_10235484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300025916|Ga0207663_11682767 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025928|Ga0207700_10715269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 894 | Open in IMG/M |
| 3300025929|Ga0207664_11394551 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026142|Ga0207698_11329906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300026557|Ga0179587_10836980 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026984|Ga0208732_1002237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1414 | Open in IMG/M |
| 3300027119|Ga0209522_1023523 | Not Available | 732 | Open in IMG/M |
| 3300027633|Ga0208988_1072463 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300027651|Ga0209217_1104126 | Not Available | 809 | Open in IMG/M |
| 3300027684|Ga0209626_1064920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
| 3300027698|Ga0209446_1000419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9614 | Open in IMG/M |
| 3300027698|Ga0209446_1013090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2036 | Open in IMG/M |
| 3300027773|Ga0209810_1113994 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300027869|Ga0209579_10415639 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027889|Ga0209380_10246386 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300028536|Ga0137415_10324632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1343 | Open in IMG/M |
| 3300028906|Ga0308309_10041227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3260 | Open in IMG/M |
| 3300028906|Ga0308309_11093626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 689 | Open in IMG/M |
| 3300031231|Ga0170824_106354769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031234|Ga0302325_12750376 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031446|Ga0170820_11773924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 532 | Open in IMG/M |
| 3300031546|Ga0318538_10681490 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031549|Ga0318571_10284093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
| 3300031561|Ga0318528_10500112 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300031681|Ga0318572_10165586 | Not Available | 1282 | Open in IMG/M |
| 3300031681|Ga0318572_10239355 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031681|Ga0318572_10822988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031682|Ga0318560_10635591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300031682|Ga0318560_10700538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031708|Ga0310686_106667656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2096 | Open in IMG/M |
| 3300031708|Ga0310686_108842563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300031770|Ga0318521_10414837 | Not Available | 803 | Open in IMG/M |
| 3300031778|Ga0318498_10196914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 914 | Open in IMG/M |
| 3300031781|Ga0318547_10387471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300031781|Ga0318547_10819352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300031793|Ga0318548_10126196 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031795|Ga0318557_10116838 | Not Available | 1191 | Open in IMG/M |
| 3300031797|Ga0318550_10539361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300031821|Ga0318567_10512980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300031835|Ga0318517_10398865 | Not Available | 621 | Open in IMG/M |
| 3300031880|Ga0318544_10428960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031890|Ga0306925_10041218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4776 | Open in IMG/M |
| 3300031890|Ga0306925_10350139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1586 | Open in IMG/M |
| 3300031890|Ga0306925_11768096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031890|Ga0306925_11936889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300031893|Ga0318536_10168510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300031910|Ga0306923_10656101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1172 | Open in IMG/M |
| 3300031941|Ga0310912_10317560 | Not Available | 1207 | Open in IMG/M |
| 3300031941|Ga0310912_10877323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300031942|Ga0310916_10115816 | Not Available | 2174 | Open in IMG/M |
| 3300031947|Ga0310909_11392899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300031959|Ga0318530_10234465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
| 3300032001|Ga0306922_10112020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2896 | Open in IMG/M |
| 3300032001|Ga0306922_10712346 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300032001|Ga0306922_11975874 | Not Available | 569 | Open in IMG/M |
| 3300032009|Ga0318563_10455654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300032025|Ga0318507_10108120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1165 | Open in IMG/M |
| 3300032035|Ga0310911_10842343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300032059|Ga0318533_10385569 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300032060|Ga0318505_10156177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300032066|Ga0318514_10315183 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300032076|Ga0306924_10549172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300032076|Ga0306924_11839475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300032076|Ga0306924_12430557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300032091|Ga0318577_10150340 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032094|Ga0318540_10580782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300032261|Ga0306920_100797060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1387 | Open in IMG/M |
| 3300032421|Ga0310812_10172906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 928 | Open in IMG/M |
| 3300032828|Ga0335080_11863418 | Not Available | 586 | Open in IMG/M |
| 3300032893|Ga0335069_11693050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 675 | Open in IMG/M |
| 3300032955|Ga0335076_10926337 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300033134|Ga0335073_11166102 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300033134|Ga0335073_11388324 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.06% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.18% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.59% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.59% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.59% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1015514361 | 3300002245 | Forest Soil | RGIWFAKRGMFALSIALDDTDSDKLVDAVDEFAQTRAPLFDETEAG* |
| JGI26341J46601_1000005839 | 3300003219 | Bog Forest Soil | FDLVARGIWFAKRGMFALSIALDDNDGDKLVDALDEFAETRAPLFDGVGTR* |
| JGI26341J46601_100230103 | 3300003219 | Bog Forest Soil | FDLVARGIWFAKRGMFALSIALDDNDGDKLVDAVEEFAETRAPLFDRIGAGISSVT* |
| JGI26343J46809_10220681 | 3300003223 | Bog Forest Soil | LVARGIWFAKRGMFALSIALDDNDGDKLVDAVEEFAETRAPLFDRIGAGISSVT* |
| Ga0062385_100578131 | 3300004080 | Bog Forest Soil | GMFALSIALDDNDGDKLVDAVEEFAETRAPLFDRIGAGISSVT* |
| Ga0063454_1006790672 | 3300004081 | Soil | WFAKRGMFALSIALDEADGDKLVEAVEEFAQTRTPLFDLSSSDS* |
| Ga0062384_1003702043 | 3300004082 | Bog Forest Soil | WFAKRGMFALSIALDEGDGDKLVDAVEEFAQTRAPLFAAVAAG* |
| Ga0062384_1009927982 | 3300004082 | Bog Forest Soil | FDLLARGIWFAKRGMFALSIALDEADGDKLADAVEDFAQTRAPLFHGTGSS* |
| Ga0062389_1009463011 | 3300004092 | Bog Forest Soil | WFAKRGMFALSIALDDRDADQLAGAVEEFAQTRAGLFSDFGE* |
| Ga0062389_1040340801 | 3300004092 | Bog Forest Soil | DLLARGIWFAKRGMFALSIALGEGDGDKLVEAVEEFAQTRTPLFDGIRPE* |
| Ga0066684_108338552 | 3300005179 | Soil | AKRGMMALSIALDESGADKLVAAVEEFAETRAPLFGGLQ* |
| Ga0066676_100263491 | 3300005186 | Soil | ARGIWFAKRGMFALSIALDENDGDKLADAVEEFAQTRAPLFEGVGAK* |
| Ga0066388_1083817551 | 3300005332 | Tropical Forest Soil | GIWFAKRGMFALSIALDEADCEKLVDAVEEFAQTRTPLFAHLKAAG* |
| Ga0070714_1010770692 | 3300005435 | Agricultural Soil | AKRGMMALSIALDDSDADKLAAAVEEFAETRAPLFSGGGR* |
| Ga0070713_1005075422 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFALSLALDDADHDKLVDAVEEFAQTRAPLLEGLGNQLTLSQ* |
| Ga0070710_112633651 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FYFDLLARGIWFAKRGMFALSLALDEADSDKLVEAAEEFAQTRIPLFEVSSSRV* |
| Ga0070706_1009645821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RGIWFAKRGMFALSIALDEEDGDKLVEAVDEFAQTRAPLFEAIAST* |
| Ga0070704_1017311212 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KRGMMALSIALEPEDADKLVAAVEDFCDTRAPLFEGGHR* |
| Ga0066670_101031191 | 3300005560 | Soil | RGIWFAKRGMMALSIALDESGADKLVAAVEEFAETRAPLFGGLQ* |
| Ga0066903_1060975021 | 3300005764 | Tropical Forest Soil | WFAKRGMFALSIALDEGDGDRLVDAVDEFAQSRARLFEGVGAQ* |
| Ga0070717_117406022 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GIWFAKRGMFALSIALDEANGDKLVEAVEEFAQTRTPLFELSSRDA* |
| Ga0066652_1015023992 | 3300006046 | Soil | GMMALSIALDEADADKLIAAVEEFAETRAPLFGADQT* |
| Ga0070765_1014289451 | 3300006176 | Soil | GIWFAKRGMMALSIALDDADGDHLVGAVEEFADTRAPLFGGVA* |
| Ga0070765_1017673972 | 3300006176 | Soil | FDLTARGVWFAKRGMMALSIALDDADADELVSSVEEFAETRAPLFRCIA* |
| Ga0066653_102236593 | 3300006791 | Soil | MMALSIALDESGADKLVAAVEEFAETRAPLFGGLQ* |
| Ga0079221_107455381 | 3300006804 | Agricultural Soil | DLLARGIWFAKRGMFALSIALDEANGDKLVEAVEEFAQTRTPLFELSSRDA* |
| Ga0075425_1009608011 | 3300006854 | Populus Rhizosphere | DLVARGTWFAKRGMMALSIALDDTDADKLLAAVEDFAETRAPLFQGASR* |
| Ga0099793_101088341 | 3300007258 | Vadose Zone Soil | LSIALDDTDGDKLVDAVEEFAQTRAPLFDGIEAG* |
| Ga0099829_102049461 | 3300009038 | Vadose Zone Soil | ALSIALDERDGDKLVEAVDNFAQTRAPLFQGIGAG* |
| Ga0099830_107067691 | 3300009088 | Vadose Zone Soil | FAKRGMMALSIALDAADADRLIAAVEEFAESRRPLFI* |
| Ga0126374_101049853 | 3300009792 | Tropical Forest Soil | ALSIALGERDGDKLVDAVEEFAETRAPLFDSIGAS* |
| Ga0126374_111751522 | 3300009792 | Tropical Forest Soil | LVARGIWFAKRGMMALSIALDETDAGKLLAAVEEFAKTRVPLFEGASA* |
| Ga0126374_113888612 | 3300009792 | Tropical Forest Soil | FAKRGMFALSIALDEADQDKLVGAIEDFAETRASLFG* |
| Ga0126380_110556851 | 3300010043 | Tropical Forest Soil | KRGMMALSIALDEADGDHLVGAVQEFAETRAPLFGGLQ* |
| Ga0126384_107260012 | 3300010046 | Tropical Forest Soil | WFAKRGMFALSIALDERDGDKLVDAVDEFIETRAPLFDSIGES* |
| Ga0074044_107193261 | 3300010343 | Bog Forest Soil | WFAKRGMFALSIALDEGDGDKLVDAVEEFAQTRAPLFDGVGAG* |
| Ga0126376_115114003 | 3300010359 | Tropical Forest Soil | FWFDLTARGIWFAKRGMFALSIALEEADGDRLAEAVEDFAQTRAPLFAAA* |
| Ga0126378_133223532 | 3300010361 | Tropical Forest Soil | FAKRGMFALSFALDDQDGDKLADAVEEFAETRAPLFEGVGLN* |
| Ga0136643_107525771 | 3300010369 | Termite Gut | LGVAKSGMFALSSALDEAECDKLADAVDEFAETRALLFDGNRRA* |
| Ga0134128_130082091 | 3300010373 | Terrestrial Soil | KRGMMALSIALDRTDADKLVAAVEEFCDTRAPLFEGTHR* |
| Ga0136449_1015814741 | 3300010379 | Peatlands Soil | IWFAKRGMFALSIALDDEDGDKLVAAVEEFAQTRAPLFAAADG* |
| Ga0126383_119922002 | 3300010398 | Tropical Forest Soil | IWFAKRGMFALSIALGEADHDKLVGAVEDFAETRAPLFR* |
| Ga0134123_114837601 | 3300010403 | Terrestrial Soil | WFAKRGMMALSVALDEADADKFVAAVDEFAETRKPLFASAGAPQ* |
| Ga0150983_137330664 | 3300011120 | Forest Soil | VARGIWFAKRGMFALSIALDEGDGDRLVDAVEEFAQTHTPLFAAIGSNH* |
| Ga0137391_108803933 | 3300011270 | Vadose Zone Soil | AKRGMFALSIALDETDGDKLVDTVEEFAQTRATLFRESGSS* |
| Ga0137393_101413991 | 3300011271 | Vadose Zone Soil | KRGMMALSIALDAADGDKLVAAVGEFAETRAPLFA* |
| Ga0137389_113248162 | 3300012096 | Vadose Zone Soil | VVHGIWFAKRGMFALSLALDEKDGDKLVDAVEEFAQTRAPLFQGIEAG* |
| Ga0137379_107991413 | 3300012209 | Vadose Zone Soil | ARGIWFAKRGMFALSIALDDADGDKLVDAVEEFAQTRAPLFDGVNLALSAGLR* |
| Ga0137379_114981822 | 3300012209 | Vadose Zone Soil | RGMMALSIALDEADADRLVAAVEEFAESRRPLFV* |
| Ga0137377_118409352 | 3300012211 | Vadose Zone Soil | WFAKRGMMALSIALDEADADKLIAAVEEFAETRAPLFGADQT* |
| Ga0150985_1016761252 | 3300012212 | Avena Fatua Rhizosphere | LPICLLARGLWFAKRGMMALSIALDDADADKLVATVEEFAETRAPLFGGVQ* |
| Ga0137390_105187882 | 3300012363 | Vadose Zone Soil | VARGIWFAKRGMFALSIALDHADGDKLVDAVEEFAQTRAPPFQRIGAG* |
| Ga0150984_1113203262 | 3300012469 | Avena Fatua Rhizosphere | FAKRGMMALSIALDDADADKLVATVEEFAETRAPLFGGVQ* |
| Ga0137359_102672771 | 3300012923 | Vadose Zone Soil | KRGMFALSIALEENDGDTLADAVEEFAQTRAPLFEGVGAG* |
| Ga0137419_104027532 | 3300012925 | Vadose Zone Soil | KRGMMALSIALDEADSDKLIAAVEEFAETRAPLFGADQT* |
| Ga0137419_112033772 | 3300012925 | Vadose Zone Soil | MFALSIALDEGDGDKLVDAVEEFAQTRTPLFEGLRAK* |
| Ga0137416_103727691 | 3300012927 | Vadose Zone Soil | RCRSPLDDTDGDKLVDAVEEFAQTRAPLFQRIGAA* |
| Ga0164301_115959821 | 3300012960 | Soil | KRGMFALSIALDDADHDKLVDTVEDFAQTRAPLFQRSGSG* |
| Ga0126369_113639242 | 3300012971 | Tropical Forest Soil | WFAKRGMFALSIALEEADADRLVEAVEEFAQTRAPLFEATPSS* |
| Ga0126369_113673191 | 3300012971 | Tropical Forest Soil | IWFAKRGMFALSIALEEADHDKLVGAVEDFAETRASLFGGLG* |
| Ga0126369_134900402 | 3300012971 | Tropical Forest Soil | LARGVWFAKRGMFALSIALEDRDGDKLVDAVEEFALTRAPLFAA* |
| Ga0157374_122255132 | 3300013296 | Miscanthus Rhizosphere | LDLIYFDLLARGVWFAKRGMIALSIALDRNDTDKLVVHVEEFFDKRAPLFEGTHR* |
| Ga0182024_106875073 | 3300014501 | Permafrost | ARGVWLAKRGMISLSVALDDKDGDQLIGAVEEFAETRAPLFGGLS* |
| Ga0181525_106375411 | 3300014654 | Bog | GIWFAKRGMFALSIALDEADGDHLVGAVEEFAETRAPLFGGVR* |
| Ga0137420_14876974 | 3300015054 | Vadose Zone Soil | MMALSIALDEADADKLIAAVEEFVETRAPLFGADQT* |
| Ga0137412_108645971 | 3300015242 | Vadose Zone Soil | WFDLVARGIWFAKRGMFALSIALDDTDGDKLVDAVEEFAQTRAPLFDGIEAG* |
| Ga0137403_102823311 | 3300015264 | Vadose Zone Soil | FSVALDEGDGEKLIDAVEEFAQTRTPLFTAIGNKG* |
| Ga0132257_1029418241 | 3300015373 | Arabidopsis Rhizosphere | LSVALDEADADKFVAAVDEFAETRKPLFASAGAPQ* |
| Ga0132255_1016725901 | 3300015374 | Arabidopsis Rhizosphere | LLARGIWFAKRGMMALSIALDQADAGKLVAAVEDFCDTRAPLFEGGHR* |
| Ga0182036_112250402 | 3300016270 | Soil | FAKRGMFALSIALDETDGDKLVEAVEEFTQTRAPLFAKVRTG |
| Ga0182041_102031121 | 3300016294 | Soil | RGIWFAKRGMFALSIALDEKDAGKLAGAVEEFVETRAPLFGAVGAR |
| Ga0182041_113968692 | 3300016294 | Soil | FDLVARGIWFAKRGMFALSIALDESDGDKLVEAVEEFTQTRAPLFART |
| Ga0182032_115123672 | 3300016357 | Soil | GMFALSIALDEQDGDKLAEAVEEFAETRAALFDSIGAS |
| Ga0182032_119664182 | 3300016357 | Soil | MRGMFALSIALDEADGDKLVDAVEEFAQTRAQLFA |
| Ga0182034_118420262 | 3300016371 | Soil | GIWFAKRGMFALSIALGEADHDKLVGAVEDFAETRAPLFG |
| Ga0182037_100933633 | 3300016404 | Soil | AKRGMFALSIALDEQDGDKLADAVEEFADTRAPLFEGVGLN |
| Ga0182037_114490122 | 3300016404 | Soil | LVARCIWFAKHGMFALSIALDETDGDKLVEAVEEFTQTRAPLFAKVRTG |
| Ga0182037_119916661 | 3300016404 | Soil | RGIWFAKRGMFALSIALDEQDGDKLADAVEEFAETRAPLFEAVGLN |
| Ga0182039_108407072 | 3300016422 | Soil | ALSITLGEQDGNKLVDAVEEFAETRAPLFAGIQFG |
| Ga0182039_122649452 | 3300016422 | Soil | ALSITLGEQDGNKLVDAVEEFAETRAPLFDGVRTEAAAEAG |
| Ga0182038_101337441 | 3300016445 | Soil | RGIWFAKRGMFALSIALNEKDAGKLAGAVEEFVETRAPLFGAVGAR |
| Ga0187778_108539201 | 3300017961 | Tropical Peatland | WFAKRGMMALSIALDEADADKLIAAVEEFAESRAPLFA |
| Ga0187783_107750102 | 3300017970 | Tropical Peatland | FAKRGMMALSIALDEADADKLIAAVEEFAESRAPLFAGVRG |
| Ga0187784_116914792 | 3300018062 | Tropical Peatland | ARGVWFAKRGMMALSIALDETDADRLAGAVEEFTETRAPLFEGLQ |
| Ga0066655_107144242 | 3300018431 | Grasslands Soil | ALSIALDENDGDKLADAVEDFAQTRTPLFEGVGAR |
| Ga0210395_113970612 | 3300020582 | Soil | RGMFALSLALDEADGDKLVEAVEEFAQTRIRLFEVSSSYT |
| Ga0210401_106050681 | 3300020583 | Soil | YFDLLARGIWFAKRGMFALSIALDEKDGDKLVEAVEEFAETRAPLFDGVGTRRPPKPGEPSS |
| Ga0210400_112125892 | 3300021170 | Soil | ARGIWFAKRGMFALSLALDEADSDKLVEAVEEFAQTRIPLFEQSSSRV |
| Ga0213876_102384352 | 3300021384 | Plant Roots | ARGIWFAKRGMMALSIALEEADAAQLVAAVEDFAQTRATLFAGAA |
| Ga0210397_102821083 | 3300021403 | Soil | RGMFALSIALDDADGDKLADALDDFAQTRAPLFPGISQR |
| Ga0213878_100871751 | 3300021444 | Bulk Soil | LVARGIWFAKRGMFALSIALDEQDGDKLAEAVEEFSETRAPLLAHTQSG |
| Ga0187846_101173611 | 3300021476 | Biofilm | DLVARGIWFAKRGMFALSIALDEGDGDTLLSAVEEFAQTRALLFASLGR |
| Ga0126371_134235311 | 3300021560 | Tropical Forest Soil | FYFDLVARGIWFAKRGMFSLSIALDEQDGDKLADAVEEFTETRAPLFAARARD |
| Ga0242663_10133782 | 3300022523 | Soil | VASGIWFAKRGMFALSIALDEADGDKLAEAVEDFAHTRAPLFAG |
| Ga0242660_11584083 | 3300022531 | Soil | ARGIWFAKRGMFALSIALHEADHDKLADAVEDFAQTRAALFDRTGSS |
| Ga0242662_100003866 | 3300022533 | Soil | FALSIALDEGDGDRLVDAVEEFAQTRTPLFAAIGSNH |
| Ga0242654_102354842 | 3300022726 | Soil | FDLVAHGIWFAKRGMFALSIALDENDCDKLADAVEEFAQTRAPLFNNIDRR |
| Ga0207663_116827671 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VARGTWFAKRGMMALSIALDDTDADKLLAAVEDFAETRAPLFQGASR |
| Ga0207700_107152692 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFALSLALDDADHDKLVDAVEEFAQTRAPLLEGLGNQLTLSQ |
| Ga0207664_113945511 | 3300025929 | Agricultural Soil | GMMALSIALDDSDADKLAAAVEEFAETRAPLFSGGGR |
| Ga0207698_113299062 | 3300026142 | Corn Rhizosphere | MFALSIALEDADHDKLVDAVEEFAQTRAPLFETIVSG |
| Ga0179587_108369801 | 3300026557 | Vadose Zone Soil | FAKRGMFALSIALDEDDGETLVAAVEEFAQTRAPLFEGIGAE |
| Ga0208732_10022371 | 3300026984 | Forest Soil | FALSIALDEADHDKLADAVEDFAQTRAPLFDGTGSS |
| Ga0209522_10235232 | 3300027119 | Forest Soil | FALSIALDEADHGKLADAVEDFAQTRAPLFDGTGSS |
| Ga0208988_10724631 | 3300027633 | Forest Soil | FAKRGMMALSIALDEADADKLLAAVEDFADTRAPLFEGGRR |
| Ga0209217_11041262 | 3300027651 | Forest Soil | ARGIWFAKRGMFALSLALDEADSDKLVEAVEEFAQTRIPLFE |
| Ga0209626_10649201 | 3300027684 | Forest Soil | YFDLLARGIWFAKRGMFTLSLALDEADSDKLVEAVEEFAQTRIPLFEQSSSRV |
| Ga0209446_10004191 | 3300027698 | Bog Forest Soil | FDLVARGIWFAKRGMFALSIALDDNDGDKLVDALDEFAETRAPLFDGVGTR |
| Ga0209446_10130901 | 3300027698 | Bog Forest Soil | FDLVARGIWFAKRGMFALSIALDDNDGDKLVDAVEEFAETRAPLFDRIGAGISSVT |
| Ga0209810_11139941 | 3300027773 | Surface Soil | RGMMALSIALDQADADKLAAAVEEFCDTRAPLFEG |
| Ga0209579_104156392 | 3300027869 | Surface Soil | LARGIWFAKRGMMALSIALDERDADRLAAAVEEFAEIRAPLFAGARR |
| Ga0209380_102463863 | 3300027889 | Soil | ERGIWFAKRGMMALSIALDDADGDHLVGAVEEFADTRAPLFGGVA |
| Ga0137415_103246321 | 3300028536 | Vadose Zone Soil | GMFALSIALDDADGEKLADAVGEFAQTRAPLFQSIGTG |
| Ga0308309_100412271 | 3300028906 | Soil | DLVARGIWFAKRGMMALSIALDEADADNLVGAVEEFAETRAPLFEGL |
| Ga0308309_110936262 | 3300028906 | Soil | GIWFAKRGMMALSIALDDADGDHLVGAVEEFADTRAPLFGGVA |
| Ga0170824_1063547691 | 3300031231 | Forest Soil | MFALSIALDEQDGDKLADAVEEFAETRAPLFDRIAAS |
| Ga0302325_127503762 | 3300031234 | Palsa | MMALSIALDTADGDKLIGAVEEFVETRAPLFGGIQ |
| Ga0170820_117739241 | 3300031446 | Forest Soil | LVARGIWFAKRGMFALSIALDENDGDKLADTVEEFAETRAPLFAGIGAS |
| Ga0318538_106814902 | 3300031546 | Soil | LVARGIWFAKRGMFALSIALDKQDGDKLADAVEEFAQTRAPLFDGVGAG |
| Ga0318571_102840931 | 3300031549 | Soil | WFAKRGMFALSIALDESDGDKLVEAVEEFTQTRAPLFART |
| Ga0318528_105001121 | 3300031561 | Soil | LFYFDLVARAGIWFAKRGMFALSIALDETDGDKLVEAVEEFTQTRAPLFANVQFG |
| Ga0318572_101655862 | 3300031681 | Soil | KRGMFALSIALDEQDGDKLVEAVEEFAQTRAPLFEPR |
| Ga0318572_102393551 | 3300031681 | Soil | MFALSIALDEQDADQLVKAVEEFVETRAPLFAGRLDRIIG |
| Ga0318572_108229882 | 3300031681 | Soil | GIWFAKRGMFALSIALDEQDGDKLADAVEEFADTRAPLFEGVGLN |
| Ga0318560_106355911 | 3300031682 | Soil | FALSIALDETDGDKLVEAVEEFTQTRAPLFAKVRTG |
| Ga0318560_107005381 | 3300031682 | Soil | WFAKRGMFALSIALDEQDGDKLADAVEEFAETRAPLFEAVGLN |
| Ga0310686_1066676561 | 3300031708 | Soil | ARGLWFAKRGMFALSIALDDHDADQLADAVEEFAETRAPLFEGIGA |
| Ga0310686_1088425631 | 3300031708 | Soil | GMFALSIALDDEDGDKLVAAVEEFAQTRAPLFDGIGAR |
| Ga0318521_104148371 | 3300031770 | Soil | LVSRGIWFAKRGMFALSIALDEQDGDKLVDVVEEFAETRAPLFDSIGAT |
| Ga0318498_101969141 | 3300031778 | Soil | LLARGIWFAKRGMFALSIALDEQDGDKLADAVEEFAETRAPLFEAVGLN |
| Ga0318547_103874712 | 3300031781 | Soil | KRGMFAMSIALGEGDSDKLVDAVGEFADTRAPLFDGIGA |
| Ga0318547_108193522 | 3300031781 | Soil | LVTRGIWFAKRGMFALSIALDEKDAGKLAGAVEEFVETRAPLFGAVGAR |
| Ga0318548_101261962 | 3300031793 | Soil | KRGMFALSIALDEQDGDKLADAVEEFAETRAPLFEAVGLN |
| Ga0318557_101168381 | 3300031795 | Soil | RGMFALSIALDEQDGDKLVEAVEEFAQTRAPLFERR |
| Ga0318550_105393612 | 3300031797 | Soil | YFDLLARGIWFAKRGMFALSIALEEPDGDKLIEAVEEFAQTRTPLFTAVNAG |
| Ga0318567_105129801 | 3300031821 | Soil | GMFALSIALDEQDGDKLADAVEEFADTRAPLFEGVGLN |
| Ga0318517_103988652 | 3300031835 | Soil | LLARGIWFAKRGMFALSIALEEPDGDKLIEAVEEFAQTRTPLFTAVNAG |
| Ga0318544_104289602 | 3300031880 | Soil | LVARCIWFAKRGMFALSIALGEGDSDKLVDAVGEFADTRAPLFDGIGA |
| Ga0306925_100412181 | 3300031890 | Soil | ARGIWFAKRGMFALSIALDEQHGDKLVEAVDEFAQTRAPLFERR |
| Ga0306925_103501391 | 3300031890 | Soil | VTRGIWFAKRGMFALSIALDEKDAGKLAGAVEEFVETRAPLFGAVGAR |
| Ga0306925_117680961 | 3300031890 | Soil | YFDLLARGIWFAKRGMFALSIALDETDHDELVEAVEEFTETRAALFE |
| Ga0306925_119368891 | 3300031890 | Soil | VARGIWFAKRGMFALSIALDEQDCDKLAEAVEEFAETRAALFDSIGAS |
| Ga0318536_101685104 | 3300031893 | Soil | ARGIWFAKRGMFALSIALDEDDGEKLADAVEEFAQTRAPLFAAL |
| Ga0306923_106561012 | 3300031910 | Soil | KRGMFALSIAIEDGDADKLADAVEDFAQTRASLFG |
| Ga0310912_103175601 | 3300031941 | Soil | VARCIWFAKRGMFALSIALDETDGDKLVEAVEEFTQTRAPLFAKVRTG |
| Ga0310912_108773231 | 3300031941 | Soil | VARGIWFAKRGMFALSIALDESDGDKLVEAVEEFTQTRAPLFART |
| Ga0310916_101158164 | 3300031942 | Soil | GMFALSIALDENDGDRLVEAVEEFAQSRTRLFANVQSG |
| Ga0310909_113928992 | 3300031947 | Soil | MFALSITLGEQDGNKLVDAVEEFAETRAPLFAGIQFG |
| Ga0318530_102344652 | 3300031959 | Soil | LFVKRGMFALSIALDEQDGDKLADAVEEFADTRAPLFEGVGLN |
| Ga0306922_101120201 | 3300032001 | Soil | ALSIALDEKDGDKLVDAVEEFAETRAPLFDSVAAT |
| Ga0306922_107123461 | 3300032001 | Soil | LVARGIWFAKRGMFALSIALDEQDGDKLADAVEEFAETRAPLFEAVGLN |
| Ga0306922_119758742 | 3300032001 | Soil | ARGIWFAKRGMFALSIALDENDGDRLVEAVEEFAQSRTRLFANVQSG |
| Ga0318563_104556542 | 3300032009 | Soil | DLTTRGIWFAKRGMFALSIALEEADGDRLAEAVEDFAQTRAPLFAAI |
| Ga0318507_101081201 | 3300032025 | Soil | KRGMFALSIALDKQDGDKLADAVEEFAQTRAPLFDGVGAG |
| Ga0310911_108423431 | 3300032035 | Soil | MFALSIALDEQDGDKLVDVVEEFAETRAPLIDSIGAT |
| Ga0318533_103855693 | 3300032059 | Soil | KRGMFALSIALDEQDADQLVKAVEEFVETRAPLFAGRLDRIIG |
| Ga0318505_101561771 | 3300032060 | Soil | YDLTARGIWFAKRGMFALSIALDEDDGEKLADAVEEFAQTRAPLFAAL |
| Ga0318514_103151831 | 3300032066 | Soil | FDLLARGIWFAKRGMFALSIALDEQDGDKLADAVEEFADTRAPLFEGVGLN |
| Ga0306924_105491721 | 3300032076 | Soil | FALSIALDEQDGDKLAEAVEEFAETRAALFDSIGAS |
| Ga0306924_118394751 | 3300032076 | Soil | FAKRGMFALSLALGEADHDKLVSAVEDFAETRAPLFGSSDVVSHHTGPKE |
| Ga0306924_124305571 | 3300032076 | Soil | LVSRGIWFAKRGMFALSIALDEQDGDKLVDVVEEFAETRAPLIDSIGAT |
| Ga0318577_101503401 | 3300032091 | Soil | DLVARGIWFAKRGMFALSIALDESDGDKLVEAVEEFTQTRAPLFART |
| Ga0318540_105807822 | 3300032094 | Soil | YFDLLARGIWFAKRGMFALSIALGGADHDKLVGAVEDCAETRAPLFG |
| Ga0306920_1007970601 | 3300032261 | Soil | PIRSQADAERGMFALSIPLEDTDHDKLVDSVEEFAQTRAPLFERIDAG |
| Ga0310812_101729062 | 3300032421 | Soil | MMALSIALDETDADKLLAAVEDFAETRAPLFQGALR |
| Ga0335080_118634181 | 3300032828 | Soil | RGIWFAKRGMFALSIALEEADGDKLIDAVEEFAQTRAPLFETVSAAG |
| Ga0335069_116930502 | 3300032893 | Soil | KRGMMALSIALDDSDADRLVAAVEDFADTRAPLFRGLQ |
| Ga0335076_109263371 | 3300032955 | Soil | KRGMMALSIALDAADGDKLVGAVEEFAETRAPLFAGL |
| Ga0335073_111661022 | 3300033134 | Soil | RGIWFAKRGMFALSIALDEADGDRLVGAVEEFAETRAPLFGGIQ |
| Ga0335073_113883242 | 3300033134 | Soil | GIWFAKRGMMALSIALDEADGDKLVSAVEEFVETRAPLFTGL |
| ⦗Top⦘ |