


| Basic Information | |
|---|---|
| Family ID | F036201 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.59 % |
| % of genes near scaffold ends (potentially truncated) | 95.88 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.529 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (18.824 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.882 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.471 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.83% Coil/Unstructured: 79.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF01391 | Collagen | 1.18 |
| PF16778 | Phage_tail_APC | 0.59 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.59 |
| PF00534 | Glycos_transf_1 | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.53 % |
| All Organisms | root | All Organisms | 46.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001243|B570J13890_103752 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300001968|GOS2236_1102512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1589 | Open in IMG/M |
| 3300002294|B570J29584_1003334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
| 3300003388|JGI25910J50241_10080474 | Not Available | 932 | Open in IMG/M |
| 3300003411|JGI25911J50253_10019774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2522 | Open in IMG/M |
| 3300003430|JGI25921J50272_10079349 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300003497|JGI25925J51416_10021557 | Not Available | 1899 | Open in IMG/M |
| 3300005417|Ga0068884_1463616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Glaciibacter → Glaciibacter superstes | 539 | Open in IMG/M |
| 3300005528|Ga0068872_10058536 | All Organisms → Viruses → Predicted Viral | 2388 | Open in IMG/M |
| 3300005565|Ga0068885_1885327 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005662|Ga0078894_10013666 | All Organisms → cellular organisms → Bacteria | 6432 | Open in IMG/M |
| 3300005805|Ga0079957_1128418 | Not Available | 1326 | Open in IMG/M |
| 3300005805|Ga0079957_1293155 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005940|Ga0073913_10056828 | Not Available | 630 | Open in IMG/M |
| 3300006641|Ga0075471_10053004 | Not Available | 2253 | Open in IMG/M |
| 3300006641|Ga0075471_10396853 | Not Available | 692 | Open in IMG/M |
| 3300007544|Ga0102861_1183554 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300007551|Ga0102881_1037706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 1358 | Open in IMG/M |
| 3300007561|Ga0102914_1146703 | Not Available | 730 | Open in IMG/M |
| 3300007562|Ga0102915_1310298 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 509 | Open in IMG/M |
| 3300007625|Ga0102870_1148846 | Not Available | 674 | Open in IMG/M |
| 3300007630|Ga0102903_1226548 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 506 | Open in IMG/M |
| 3300007653|Ga0102868_1124999 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300007862|Ga0105737_1136809 | Not Available | 632 | Open in IMG/M |
| 3300007974|Ga0105747_1312793 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 533 | Open in IMG/M |
| 3300008108|Ga0114341_10272303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 898 | Open in IMG/M |
| 3300008110|Ga0114343_1218097 | Not Available | 536 | Open in IMG/M |
| 3300008113|Ga0114346_1111511 | Not Available | 1233 | Open in IMG/M |
| 3300008116|Ga0114350_1179967 | Not Available | 544 | Open in IMG/M |
| 3300008119|Ga0114354_1062562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3352 | Open in IMG/M |
| 3300008120|Ga0114355_1000751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33122 | Open in IMG/M |
| 3300008120|Ga0114355_1224275 | Not Available | 577 | Open in IMG/M |
| 3300008261|Ga0114336_1002269 | Not Available | 26941 | Open in IMG/M |
| 3300008266|Ga0114363_1176911 | Not Available | 681 | Open in IMG/M |
| 3300008450|Ga0114880_1141831 | Not Available | 876 | Open in IMG/M |
| 3300009026|Ga0102829_1297711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300009051|Ga0102864_1145570 | Not Available | 648 | Open in IMG/M |
| 3300009059|Ga0102830_1234827 | Not Available | 536 | Open in IMG/M |
| 3300009155|Ga0114968_10764407 | Not Available | 503 | Open in IMG/M |
| 3300009158|Ga0114977_10511073 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300009159|Ga0114978_10245308 | Not Available | 1114 | Open in IMG/M |
| 3300009180|Ga0114979_10429471 | Not Available | 770 | Open in IMG/M |
| 3300009233|Ga0103856_10101098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300009243|Ga0103860_10088853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300010309|Ga0102890_1013528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300010354|Ga0129333_11463873 | Not Available | 560 | Open in IMG/M |
| 3300010370|Ga0129336_10585860 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 596 | Open in IMG/M |
| 3300010885|Ga0133913_12126508 | Not Available | 1388 | Open in IMG/M |
| 3300010885|Ga0133913_12570110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
| 3300011268|Ga0151620_1200729 | Not Available | 603 | Open in IMG/M |
| 3300012717|Ga0157609_1128012 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012720|Ga0157613_1285736 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012725|Ga0157610_1161136 | Not Available | 803 | Open in IMG/M |
| 3300012731|Ga0157616_1332663 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012733|Ga0157606_1068436 | Not Available | 595 | Open in IMG/M |
| 3300012734|Ga0157615_1206912 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012752|Ga0157629_1005829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 1329 | Open in IMG/M |
| 3300012770|Ga0138291_1296721 | Not Available | 612 | Open in IMG/M |
| 3300012968|Ga0129337_1423402 | Not Available | 1750 | Open in IMG/M |
| 3300012970|Ga0129338_1052635 | Not Available | 1228 | Open in IMG/M |
| 3300012970|Ga0129338_1109969 | Not Available | 1437 | Open in IMG/M |
| 3300013005|Ga0164292_10292079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300013005|Ga0164292_10420420 | Not Available | 889 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10226546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300013295|Ga0170791_11916647 | Not Available | 1303 | Open in IMG/M |
| 3300017701|Ga0181364_1040279 | Not Available | 745 | Open in IMG/M |
| 3300017761|Ga0181356_1063908 | Not Available | 1247 | Open in IMG/M |
| 3300017761|Ga0181356_1156090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300017766|Ga0181343_1224442 | Not Available | 511 | Open in IMG/M |
| 3300017784|Ga0181348_1322564 | Not Available | 511 | Open in IMG/M |
| 3300020074|Ga0194113_10473934 | Not Available | 904 | Open in IMG/M |
| 3300020083|Ga0194111_10443868 | Not Available | 848 | Open in IMG/M |
| 3300020084|Ga0194110_10186723 | Not Available | 1581 | Open in IMG/M |
| 3300020151|Ga0211736_10345486 | Not Available | 746 | Open in IMG/M |
| 3300020172|Ga0211729_11325975 | Not Available | 583 | Open in IMG/M |
| 3300020179|Ga0194134_10258341 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300020197|Ga0194128_10159119 | Not Available | 1273 | Open in IMG/M |
| 3300020222|Ga0194125_10224274 | Not Available | 1317 | Open in IMG/M |
| 3300020486|Ga0208698_103522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
| 3300020511|Ga0208593_1040555 | Not Available | 523 | Open in IMG/M |
| 3300020519|Ga0208223_1041824 | Not Available | 548 | Open in IMG/M |
| 3300020555|Ga0208358_1014160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300020564|Ga0208719_1011491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1994 | Open in IMG/M |
| 3300020570|Ga0208465_1011519 | Not Available | 1226 | Open in IMG/M |
| 3300021141|Ga0214163_1054490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300021340|Ga0194041_10146246 | Not Available | 726 | Open in IMG/M |
| 3300021424|Ga0194117_10053394 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300021519|Ga0194048_10044842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1805 | Open in IMG/M |
| 3300021961|Ga0222714_10070793 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300021962|Ga0222713_10174571 | Not Available | 1460 | Open in IMG/M |
| 3300021962|Ga0222713_10223084 | Not Available | 1245 | Open in IMG/M |
| 3300021963|Ga0222712_10183943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
| 3300021963|Ga0222712_10196799 | Not Available | 1323 | Open in IMG/M |
| 3300022543|Ga0212119_1068230 | Not Available | 561 | Open in IMG/M |
| 3300022752|Ga0214917_10276658 | Not Available | 763 | Open in IMG/M |
| 3300023184|Ga0214919_10306477 | Not Available | 1091 | Open in IMG/M |
| 3300024306|Ga0255148_1028885 | Not Available | 1035 | Open in IMG/M |
| 3300024346|Ga0244775_11112334 | Not Available | 619 | Open in IMG/M |
| 3300024348|Ga0244776_10417404 | Not Available | 886 | Open in IMG/M |
| 3300024356|Ga0255169_1020744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300024487|Ga0255222_1020659 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 956 | Open in IMG/M |
| 3300024492|Ga0255189_1006960 | Not Available | 1535 | Open in IMG/M |
| 3300024503|Ga0255152_1038321 | Not Available | 877 | Open in IMG/M |
| 3300024506|Ga0255168_1014167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
| 3300024510|Ga0255187_1049350 | Not Available | 567 | Open in IMG/M |
| 3300024513|Ga0255144_1036057 | Not Available | 842 | Open in IMG/M |
| 3300024570|Ga0255276_1055561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
| 3300024574|Ga0255275_1047611 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300024852|Ga0255295_1012178 | Not Available | 1663 | Open in IMG/M |
| 3300024857|Ga0256339_1014979 | Not Available | 1659 | Open in IMG/M |
| 3300024864|Ga0255271_1070412 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 766 | Open in IMG/M |
| 3300024866|Ga0255272_1139305 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 603 | Open in IMG/M |
| 3300024867|Ga0255267_1090898 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 706 | Open in IMG/M |
| 3300026473|Ga0255166_1026535 | Not Available | 1220 | Open in IMG/M |
| 3300026566|Ga0256334_1011862 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300026571|Ga0255289_1024563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300026573|Ga0255269_1062341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300027121|Ga0255074_1028588 | Not Available | 694 | Open in IMG/M |
| 3300027123|Ga0255090_1058296 | Not Available | 567 | Open in IMG/M |
| 3300027135|Ga0255073_1022996 | Not Available | 1102 | Open in IMG/M |
| 3300027229|Ga0208442_1067981 | Not Available | 592 | Open in IMG/M |
| 3300027238|Ga0208808_1034207 | Not Available | 629 | Open in IMG/M |
| 3300027293|Ga0255132_1012000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 2336 | Open in IMG/M |
| 3300027396|Ga0255146_1013425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
| 3300027492|Ga0255093_1108129 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 508 | Open in IMG/M |
| 3300027563|Ga0209552_1011543 | Not Available | 2722 | Open in IMG/M |
| 3300027571|Ga0208897_1089719 | Not Available | 788 | Open in IMG/M |
| 3300027586|Ga0208966_1020196 | Not Available | 1960 | Open in IMG/M |
| 3300027586|Ga0208966_1197582 | Not Available | 515 | Open in IMG/M |
| 3300027598|Ga0255121_1027669 | Not Available | 1219 | Open in IMG/M |
| 3300027621|Ga0208951_1023532 | Not Available | 1932 | Open in IMG/M |
| 3300027627|Ga0208942_1131569 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027631|Ga0208133_1032436 | Not Available | 1303 | Open in IMG/M |
| 3300027644|Ga0209356_1066055 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300027659|Ga0208975_1054971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 1215 | Open in IMG/M |
| 3300027679|Ga0209769_1234232 | Not Available | 562 | Open in IMG/M |
| 3300027688|Ga0209553_1106728 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300027793|Ga0209972_10402367 | Not Available | 581 | Open in IMG/M |
| 3300027798|Ga0209353_10084661 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300027892|Ga0209550_10309369 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027973|Ga0209298_10172633 | Not Available | 897 | Open in IMG/M |
| 3300028101|Ga0256349_1073605 | Not Available | 585 | Open in IMG/M |
| 3300028112|Ga0256335_1154465 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028113|Ga0255234_1094366 | Not Available | 789 | Open in IMG/M |
| 3300028113|Ga0255234_1149406 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 614 | Open in IMG/M |
| 3300028286|Ga0256331_1014250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300028286|Ga0256331_1016523 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1355700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1099515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300029930|Ga0119944_1026495 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031786|Ga0315908_11447286 | Not Available | 537 | Open in IMG/M |
| 3300031787|Ga0315900_10612338 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031787|Ga0315900_10877162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 607 | Open in IMG/M |
| 3300031857|Ga0315909_10079474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2898 | Open in IMG/M |
| 3300031951|Ga0315904_10591560 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031951|Ga0315904_11113191 | Not Available | 615 | Open in IMG/M |
| 3300032093|Ga0315902_10177229 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
| 3300032093|Ga0315902_10464309 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300032116|Ga0315903_10119798 | Not Available | 2472 | Open in IMG/M |
| 3300032116|Ga0315903_10394179 | Not Available | 1130 | Open in IMG/M |
| 3300034062|Ga0334995_0360826 | Not Available | 925 | Open in IMG/M |
| 3300034073|Ga0310130_0025460 | Not Available | 1853 | Open in IMG/M |
| 3300034104|Ga0335031_0536398 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300034106|Ga0335036_0167112 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300034116|Ga0335068_0186989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 1095 | Open in IMG/M |
| 3300034121|Ga0335058_0595235 | Not Available | 619 | Open in IMG/M |
| 3300034121|Ga0335058_0792727 | Not Available | 517 | Open in IMG/M |
| 3300034166|Ga0335016_0214132 | Not Available | 1245 | Open in IMG/M |
| 3300034168|Ga0335061_0484201 | Not Available | 632 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 18.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.71% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.76% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.76% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.18% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.18% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.18% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.18% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.59% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.59% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.59% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001243 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020486 | Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024492 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024852 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027238 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028101 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13890_1037521 | 3300001243 | Freshwater | EINHNLGMKPNVTIKSSAGDVLETGIDYNSSNKITLTMAQPFSGTAYLS* |
| GOS2236_11025121 | 3300001968 | Marine | EDEDCYAIDLLHNLNFYPNVTVKDSSKDVVETGITYDGLNKIILTMTQPFSGIAYLS* |
| B570J29584_10033342 | 3300002294 | Freshwater | VNNVYSLPITHNLGFSPNVTVKTSAGDVLETGIDYNSSNQITLTMAQPFSGTAYLS* |
| JGI25910J50241_100804741 | 3300003388 | Freshwater Lake | YNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS* |
| JGI25911J50253_100197744 | 3300003411 | Freshwater Lake | YNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS* |
| JGI25921J50272_100793492 | 3300003430 | Freshwater Lake | LGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| JGI25925J51416_100215571 | 3300003497 | Freshwater Lake | YAIAITHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAXLS* |
| Ga0068884_14636162 | 3300005417 | Freshwater Lake | HNLGFYPNVTVKTSAGDVLETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0068872_100585364 | 3300005528 | Freshwater Lake | NSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0068885_18853272 | 3300005565 | Freshwater Lake | NLYGVTLIHDLGFKPNATVKNSAGDLVETGIDYDNINTITLTMAQPFSGTAYLS* |
| Ga0078894_100136661 | 3300005662 | Freshwater Lake | NPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0079957_11284182 | 3300005805 | Lake | YWYLEITHNMGYNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0079957_12931552 | 3300005805 | Lake | YLEIEHNMGINPNVTVKTSGGHILETGIDYNSLNKITLIMAQPFSGTAYLS* |
| Ga0073913_100568282 | 3300005940 | Sand | LGYCPNVTVKSSSGDVLETGIDYNSLNTLTLTMAQPFSGTAHLS* |
| Ga0075471_100530042 | 3300006641 | Aqueous | NVTVKSSSGDMLETGINYNNTNTITLTMAQPFSGTAYLS* |
| Ga0075471_103968532 | 3300006641 | Aqueous | TVKSSAGDILETGIDYNNINTITLTMAQPFSGTAYLS* |
| Ga0102861_11835541 | 3300007544 | Estuarine | NSAGDILETGIDYNSINQITLTMAQPFGGTAYLS* |
| Ga0102881_10377061 | 3300007551 | Estuarine | NSAGDILETGIDYNNINQITLTMAQPFSGTAYLS* |
| Ga0102914_11467032 | 3300007561 | Estuarine | LGFHPNVTVKSSAGDILETGIDYNSINILTLTMAQPFSGTAYLS* |
| Ga0102915_13102981 | 3300007562 | Estuarine | RIEHNLQFHPNVTVKSSSGDVLETGIDYNSINVLTLTMAQAFSGTAYLS* |
| Ga0102870_11488461 | 3300007625 | Estuarine | NVTIKSSAGDVLETGIDYNSINTLTLTMAQPFSGTAHLS* |
| Ga0102903_12265481 | 3300007630 | Estuarine | VINHNLQFNPNVSVKSSSGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0102868_11249991 | 3300007653 | Estuarine | NVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0105737_11368091 | 3300007862 | Estuary Water | NPNVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0105747_13127932 | 3300007974 | Estuary Water | LSGGIYSLEITHNLGFSPNVTVKASSGDIVETEVDYNSLNKITLKMAQPFSGTAYLS* |
| Ga0114341_102723031 | 3300008108 | Freshwater, Plankton | SIVHNLGYNPNVTVKASSGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0114343_12180972 | 3300008110 | Freshwater, Plankton | NLGFSPNVTVKTSSGDVLETGIDYNSSNQITLTMAQPFAGTAYLS* |
| Ga0114346_11115111 | 3300008113 | Freshwater, Plankton | LGMKPNVTIKSSAGDVLETGIDYNSNNTITLTMAQPFSGTAYLS* |
| Ga0114350_11799671 | 3300008116 | Freshwater, Plankton | TVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0114354_10625625 | 3300008119 | Freshwater, Plankton | VYSVEIIHNLGYNPNVTVKSSAGDILETGIDYNSFNKITLTMAQPFSGTAHLS* |
| Ga0114355_100075124 | 3300008120 | Freshwater, Plankton | MHNLGFYPNLTVRTSSGDILETGIDYNNINKITLTMAQPFSGTAYLS* |
| Ga0114355_12242751 | 3300008120 | Freshwater, Plankton | YNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0114336_10022691 | 3300008261 | Freshwater, Plankton | NVTVKATGGDVLETGVQYNNLSSITLTMTQKFSGTAYLS* |
| Ga0114363_11769112 | 3300008266 | Freshwater, Plankton | GVYSLPITHNLGFKPNVTVKSSSGDVLETGIDYNSNDILTLTMAQPFSGTAYLS* |
| Ga0114880_11418312 | 3300008450 | Freshwater Lake | LGFKPNVTVKSSSGDVLETGIDYNSNDILTLTMAQPFSGTAYLS* |
| Ga0102829_12977111 | 3300009026 | Estuarine | NTYSVVVLHNLGFYPNVTVKTSAGDILETGIDYNNINQITLTMAQPFSGTAHLS* |
| Ga0102864_11455701 | 3300009051 | Estuarine | TYSVVVLHNLGFYPNVTVKTSAGDILETGIDYNNINQITLTMAQPFSGTAHLS* |
| Ga0102830_11879241 | 3300009059 | Estuarine | IHNLGYSPSVTIKSSSGDVVETGINYDSLNQLTLVMAQPFSGTVYLS* |
| Ga0102830_12348271 | 3300009059 | Estuarine | YNPNVTVKNSAGDILETGIDYNSINKITLIMAQPFGGIAYLS* |
| Ga0114968_107644071 | 3300009155 | Freshwater Lake | INHNLGYNPNVTIKSSAGDVLETGIDYNNINQITLTMAQPFSGTAHLS* |
| Ga0114977_105110732 | 3300009158 | Freshwater Lake | MGYNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGIAYLS* |
| Ga0114978_102453081 | 3300009159 | Freshwater Lake | KNSAGDILETGIDYNSINKITLTMAQPFGGIAYLS* |
| Ga0114979_104294712 | 3300009180 | Freshwater Lake | VRINHNLGFNPNVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0103856_101010982 | 3300009233 | River Water | LNHNLNFFPNVTVKASSGDILETGVDYNNTNTITLTMAQPFSGTAYLS* |
| Ga0103860_100888531 | 3300009243 | River Water | VKTSAGDVLETGIDYNNINTITLTMAQPFSGTAYLS* |
| Ga0102890_10135281 | 3300010309 | Estuarine | TSAGDILETGIDYNNINQITLTMAQPFSGTAHLS* |
| Ga0129333_114638731 | 3300010354 | Freshwater To Marine Saline Gradient | VKSSAGDVLETGIDYNNNNTLTLTMAQPFSGTAYLS* |
| Ga0129336_105858602 | 3300010370 | Freshwater To Marine Saline Gradient | YSVVINHNLGFHPNVTVKSSSGDILETGIDYNSLNIITLKMAQPFSGTAHLS* |
| Ga0133913_121265081 | 3300010885 | Freshwater Lake | NSAGDILETGIDYNSINKITLIMAQPFGGIAYLS* |
| Ga0133913_125701101 | 3300010885 | Freshwater Lake | DSAGNVLETGIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0151620_12007291 | 3300011268 | Freshwater | SSSGDVLETGIDYNSINVLTLTMAQAFSGTAYLS* |
| Ga0157609_11280122 | 3300012717 | Freshwater | YLEITHNMGYNPNVTVKASSGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0157613_12857362 | 3300012720 | Freshwater | RVVINHNLGFSPNVTVKSSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0157610_11611362 | 3300012725 | Freshwater | FSPNVTVKASSGDILETEVDYNSLNKITLRMAQPFSGTAYLS* |
| Ga0157616_13326631 | 3300012731 | Freshwater | VTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0157606_10684361 | 3300012733 | Freshwater | LGYHPNVTIKSSAGDILETGIDYNDINKITLTMAQPFSGTAYLS* |
| Ga0157615_12069121 | 3300012734 | Freshwater | GYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS* |
| Ga0157629_10058291 | 3300012752 | Freshwater | INHNLGFGPNVTVISSAGDVLETGIDYNSLNRLTLTMAQPFSGTAHLS* |
| Ga0138291_12967212 | 3300012770 | Freshwater Lake | SSAGDILETGIDYNSINILTLTMAQPFSGTAYLS* |
| Ga0129337_14234023 | 3300012968 | Aqueous | VKASSGDILETGIDYNNTNKITLTMAQPFSGTAYLS* |
| Ga0129338_10526352 | 3300012970 | Aqueous | GTYSVPITHNMGFYPNVTVKTSAGDILENRIDYNSINQITLTMAQPFSGTAYLS* |
| Ga0129338_11099691 | 3300012970 | Aqueous | PNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0164292_102920791 | 3300013005 | Freshwater | THNMGYNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS* |
| Ga0164292_104204202 | 3300013005 | Freshwater | GWAITILHNLGFKPNVTVKATGGDVLETGVQYNNLSSITLTMTQKFSGTAYLS* |
| (restricted) Ga0172367_102265461 | 3300013126 | Freshwater | GFFPNVTIKTSSGDILETGIDYNSINQITLTMAQPFSGTAFLS* |
| Ga0170791_119166471 | 3300013295 | Freshwater | INHGLGYNPNVTIKSSAGDVLETGIDYNTINQITLTMAQPFSGTAHLS* |
| Ga0181364_10402791 | 3300017701 | Freshwater Lake | GGVAVGNYFAIAIPHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS |
| Ga0181356_10639082 | 3300017761 | Freshwater Lake | TVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0181356_11560902 | 3300017761 | Freshwater Lake | GYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS |
| Ga0181343_12244422 | 3300017766 | Freshwater Lake | KSSAGDILETGIDYNSTNQITLTMAQPFSGTAYLS |
| Ga0181348_13225641 | 3300017784 | Freshwater Lake | KNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS |
| Ga0194113_104739342 | 3300020074 | Freshwater Lake | MGYNPNVTVKNSAGDILETGIDYNSTNKITLTMAQPFGGTAFLS |
| Ga0194111_104438682 | 3300020083 | Freshwater Lake | VTVKSSAGDVLETGIDYNSLNTLTLTMAQPFSGTAYLS |
| Ga0194110_101867233 | 3300020084 | Freshwater Lake | YYSLEIEHNMGYNPNVTVKSSAGDLLETGIDYNSINKITLIMAQPFGGTAFLS |
| Ga0211736_103454862 | 3300020151 | Freshwater | GPNVTVISSAGDVLETGIDYNSLNRLTLTMAQPFSGTAHLS |
| Ga0211729_113259751 | 3300020172 | Freshwater | VKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0194134_102583412 | 3300020179 | Freshwater Lake | KASSGDLLETGIDYNSINKITLIMAQPFGGTAFLS |
| Ga0194128_101591191 | 3300020197 | Freshwater Lake | NVTVKASSGDLLETGIDYNSINKITLIMAQPFGGTAFLS |
| Ga0194125_102242741 | 3300020222 | Freshwater Lake | QVQNAGTYYSLEIEHNMGYNPNVTVKASSGDLLETGIDYNSINKITLIMAQPFGGTAFLS |
| Ga0208698_1035222 | 3300020486 | Freshwater | DEQTYWALEITHNMGYNPNVTVKNSAGDILETGIDYNSSNKITLTMAQPFSGTAYLS |
| Ga0208593_10405552 | 3300020511 | Freshwater | KDSAGDLVETGIDYSSTNKITLTMAQPFSGTAYLS |
| Ga0208223_10418242 | 3300020519 | Freshwater | QVVINHNLGFSPNVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAHLS |
| Ga0208358_10141603 | 3300020555 | Freshwater | PVDGVYSVEIIHNLGYNPNVTVKSSAGDILETGIDYNSFNKITLTMAQPFSGTAHLS |
| Ga0208719_10114911 | 3300020564 | Freshwater | VYSVEIIHNLGYNPNVTVKSSAGDILETGIDYNSFNKITLTMAQPFSGTAHLS |
| Ga0208465_10115192 | 3300020570 | Freshwater | YSVEIVHNLGFHPNVTVKSSSGDILETGIVYNSLNIITLTMAQPFSGTAHLS |
| Ga0214163_10544902 | 3300021141 | Freshwater | SIEHNLGYHPNVTIKSSAGDILETGIDYNDINKITLTMAQPFSGTAYLS |
| Ga0194041_101462461 | 3300021340 | Anoxic Zone Freshwater | KPNVTIKSSAGDVLETGIDYNSNNRITLTMAQPFSGTAYLS |
| Ga0194117_100533944 | 3300021424 | Freshwater Lake | PVKASSGDVLETGIDYNSNNQLTLTMAQPFSGAAYLS |
| Ga0194048_100448423 | 3300021519 | Anoxic Zone Freshwater | IQIIHNMEYYPNVTVKSSSGDILETGIDYNSNNKITLTMAQPFAGTAYLS |
| Ga0222714_100707931 | 3300021961 | Estuarine Water | TVKNSAGDLVETGIDYNSNNQITLKMAQPFSGTAYLS |
| Ga0222713_101745712 | 3300021962 | Estuarine Water | LGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0222713_102230841 | 3300021962 | Estuarine Water | TVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0222712_101839432 | 3300021963 | Estuarine Water | HDLGFYPNVTVKNSAGDVLETGIDYNSINQITLTMAQPFAGTAYLS |
| Ga0222712_101967991 | 3300021963 | Estuarine Water | KSSAGDILETGIDYNSINKITLTMAQPFSGTAHLS |
| Ga0212119_10682301 | 3300022543 | Freshwater | ATVKSSSGDMLETGIEYNSIEKITLTMAQPFSGTAYLS |
| Ga0214917_102766581 | 3300022752 | Freshwater | VTVKSSSGDVLETGIDYNSINVLTLTMAQPFSGTAYLS |
| Ga0214919_103064772 | 3300023184 | Freshwater | NVTVKNSAGDILETGIDYNSINKITLTMAQPFGGIAYLS |
| Ga0255148_10288852 | 3300024306 | Freshwater | NGVYSLVITHNLGFKPNVTVKTSAGDVLETGINYNSNNQLTLTMAQPFSGTAYLS |
| Ga0244775_111123341 | 3300024346 | Estuarine | PNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0244776_104174042 | 3300024348 | Estuarine | LGMKPNVTIKSSAGDVLETGIDYNSNNTITLTMAQPFSGTAYLS |
| Ga0255169_10207441 | 3300024356 | Freshwater | NVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0255222_10206591 | 3300024487 | Freshwater | MGYHPNVTIKASSGDILETGIDYNSINKITLTMAQPFSGTAYLS |
| Ga0255189_10069602 | 3300024492 | Freshwater | LDGDVYKIAISHNLGFHPNVTVKSSSGDILETGIDYNSLNTITLIMAQPFSGTAHLS |
| Ga0255152_10383212 | 3300024503 | Freshwater | PVNGVYSLVITHNLGFKPNVTVKTSAGDVLETGINYNSNNQLTLTMAQPFSGTAYLS |
| Ga0255168_10141672 | 3300024506 | Freshwater | HNLGFYPNVTVKTSGGDILETGIDYNSINQITLTMAQPFAGTAYLS |
| Ga0255187_10493501 | 3300024510 | Freshwater | KTSAGDVLETGIDYNSINQITLTMAQPFAGTAYLS |
| Ga0255144_10360572 | 3300024513 | Freshwater | NVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0255276_10555611 | 3300024570 | Freshwater | GIYSVPIIHNMGYNPNVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0255275_10476112 | 3300024574 | Freshwater | NMGYNPNVTVKDSGGNILETGIDYNSINKITLIMAQPFGGTAYLS |
| Ga0255295_10121782 | 3300024852 | Freshwater | FHPNVTVKSSSGDILETGIDYNSLNTITLIMAQPFSGTAHLS |
| Ga0256339_10149791 | 3300024857 | Freshwater | VKSSSGDVLETGIDYNSINVLTLTMAQPFSGTAYLS |
| Ga0255271_10704122 | 3300024864 | Freshwater | EITHNLGFHPNVTIKTSGGDILETGIDYNSLNKITLIMAQPFSGTAYLS |
| Ga0255272_11393052 | 3300024866 | Freshwater | GFHPNVTIKTSGGDILETGIDYNSLNKITLIMAQPFSGTAYLS |
| Ga0255267_10908981 | 3300024867 | Freshwater | KSSSGDILETGIVYNSLYKITLTMAQPFSGTAHLS |
| Ga0255166_10265351 | 3300026473 | Freshwater | TVKTSGGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0256334_10118621 | 3300026566 | Freshwater | NHNLGFRPNVTVKTSAGDVLETGIDYNSSNQLTLTMAQPFSGTAYLS |
| Ga0255289_10245632 | 3300026571 | Freshwater | VKTSAGDILETGIDYNSLNTLTLTMAQPFSGTAYLS |
| Ga0255269_10623411 | 3300026573 | Freshwater | PNVTVKTSAGDILETGIDYNSLNTLTLTMAQPFSGTAYLS |
| Ga0255074_10285881 | 3300027121 | Freshwater | PNVTVISSAGDVLETGIDYNSLNRLTLTMAQPFSGTAHLS |
| Ga0255090_10582962 | 3300027123 | Freshwater | YWALEITHNMGYNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0255073_10229962 | 3300027135 | Freshwater | NVTIKASSGDILETGIDYNSINKITLTMAQPFSGTAYLS |
| Ga0208442_10679812 | 3300027229 | Estuarine | LGMKPNITIKSSAGDVLETGIDYNSNNTITLTMAQPFSGTAYLS |
| Ga0208808_10342071 | 3300027238 | Estuarine | VIVHNLGYNPNVTIKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0255132_10120001 | 3300027293 | Freshwater | SVEINHNLGMKPNVTIKSSAGDVLETGIDYNSSNKITLTMAQPFSGTAYLS |
| Ga0255146_10134251 | 3300027396 | Freshwater | VINHNLGFYPNVTVKTSGGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0255093_11081291 | 3300027492 | Freshwater | ILHNLGFYPNVTVKTSAGDILETGIDYNNINQITLTMAQPFSGTAHLS |
| Ga0209552_10115431 | 3300027563 | Freshwater Lake | SGLYSLPITHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0208897_10897192 | 3300027571 | Estuarine | THNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0208966_10201961 | 3300027586 | Freshwater Lentic | GNYYAIAIPHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0208966_11975821 | 3300027586 | Freshwater Lentic | NGTYSVAVNHNLGYSPNVTVKSSAGDVLETGIDYNSTNTLTLTMAQPFSGTAHLS |
| Ga0255121_10276692 | 3300027598 | Freshwater | MGYNPNVTVKNSAGDILETGIDYNSNMKITLTMAQPFGGTAYLS |
| Ga0208951_10235323 | 3300027621 | Freshwater Lentic | HNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0208942_11315691 | 3300027627 | Freshwater Lentic | FYPNVTVKTSAGDILETGIDYNNINQITLTMAQPFSGTAHLS |
| Ga0208133_10324361 | 3300027631 | Estuarine | NGTYHSLVITHNLGYNPNVTIKNSAGDILETGINYDSINQITLTMAQPFAGTAYLS |
| Ga0209356_10660551 | 3300027644 | Freshwater Lake | NYFAIAIPHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0208975_10549712 | 3300027659 | Freshwater Lentic | NGVYSIVINHNLGFSPNVTVKSSAGDILETGIDYNSINQITLTMAQPFSGTAHLS |
| Ga0209769_12342322 | 3300027679 | Freshwater Lake | YNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0209553_11067282 | 3300027688 | Freshwater Lake | VKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0209972_104023671 | 3300027793 | Freshwater Lake | ITHNLGFYPNVTVKTSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0209353_100846612 | 3300027798 | Freshwater Lake | QVVAVGNYFAIAIPHNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAFLS |
| Ga0209550_103093692 | 3300027892 | Freshwater Lake | WSLEITHNMGYNPNVTVKDSSGNILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0209298_101726332 | 3300027973 | Freshwater Lake | QNLVLSAGVYSIEITHNLGFSPNVTVKASSGDILETEVDYNSLNKITLRMAQPFSGTAYL |
| Ga0256349_10736051 | 3300028101 | Freshwater | GFYPNVTVKTSAGDVLETGIDYNSINQITLTMAQPFAGTAYLS |
| Ga0256335_11544651 | 3300028112 | Freshwater | GVYSLRIEHNLQFHPNVTVKSSSGDVLETGIDYNSINVLTLTMAQAFSGTAYLS |
| Ga0255234_10943661 | 3300028113 | Freshwater | VTVKTSGGDILETGIEYNNVNTLTLTMAQPFSGTAYLS |
| Ga0255234_11494061 | 3300028113 | Freshwater | HNMGYHPNVTIKASSGDILETGIDYNSINKITLTMAQPFSGTAYLS |
| Ga0256331_10142502 | 3300028286 | Freshwater | ITHNLGFHPNVTVKSSSGDILETGIVYNSLNIITLTMAQPFSGTAHLS |
| Ga0256331_10165232 | 3300028286 | Freshwater | MGYNPNVTVKDSGGNILETGIDYNSINKITLIMAQPFGGTAYLS |
| (restricted) Ga0247839_13557001 | 3300028553 | Freshwater | YSIAITHNLGFSPNVTVKASSGDVLETGIDYNSINQITLTMAQPFSGTAFLS |
| (restricted) Ga0247832_10995151 | 3300028557 | Freshwater | LYSIAITHNLGFSPNVTVKASSGDVLETGIDYNSINQITLTMAQPFSGTAFLS |
| Ga0119944_10264951 | 3300029930 | Aquatic | THNLGFNPNVTVKASSGDVLETGIDYNSSNQLTLTMAQPFSGTAYLS |
| Ga0315908_114472861 | 3300031786 | Freshwater | YVTINHNLGFYPNVTVKTSAGDVLETGIDYNSINQITLTMAQPFAGTAYLS |
| Ga0315900_106123382 | 3300031787 | Freshwater | GYNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0315900_108771621 | 3300031787 | Freshwater | VDGIYSVEISHNLGYNPNVTVKASSGDILETGIDYNSINKITLTMAQPFSGTAYLS |
| Ga0315909_100794745 | 3300031857 | Freshwater | HDLGYNPNVTVKNSAGDVLETGIDYNSMNKITLIMAQPFGGTAYLS |
| Ga0315904_105915601 | 3300031951 | Freshwater | SGTYSVAITHNLGFKPNVTVKTSAGDVLETGIDYNSNNQITLTMAQPFSGTAYLS |
| Ga0315904_111131912 | 3300031951 | Freshwater | VYSVEINHNLGMKPNVTIKSSAGDVLETGIDYNSSNKITLTMAQPFSGTAYLS |
| Ga0315902_101772294 | 3300032093 | Freshwater | YNPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0315902_104643091 | 3300032093 | Freshwater | MGYNPNVTVKASSGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0315903_101197985 | 3300032116 | Freshwater | LGYNPNVTVKNSAGDVLETGIDYNSMNKITLIMAQPFGGTAYLS |
| Ga0315903_103941791 | 3300032116 | Freshwater | NLGFSPAVTVKSSNGDVLETGIDYNSLNTLTLTMAQPFSGTAYLS |
| Ga0334995_0360826_747_875 | 3300034062 | Freshwater | MKPNVTVKSSAGDVLETGIDYNSSNKITLTMAQPFSGTAYLS |
| Ga0310130_0025460_1_126 | 3300034073 | Fracking Water | YPNVTVKTSAGDILETGIDYNSINQITLTMAQPFSGTAYLS |
| Ga0335031_0536398_1_135 | 3300034104 | Freshwater | LGYNPNVTVKNSAGDVLETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0335036_0167112_3_143 | 3300034106 | Freshwater | HNLGYNPNVTVKNSAGDILETGIDYNSINQITLTMAQPFGGTAYLS |
| Ga0335068_0186989_968_1093 | 3300034116 | Freshwater | NPNVTVKNSAGDILETGIDYNSINKITLTMAQPFGGTAYLS |
| Ga0335058_0595235_480_617 | 3300034121 | Freshwater | GLGYQPNVTVKSSAGDILETGIDYNSNNQITLTMAQPFSGTAYLS |
| Ga0335058_0792727_373_516 | 3300034121 | Freshwater | EHNLGYHPNVTIKSSAGDILETGIDYNDINKITLTMAQPFSGTAYLS |
| Ga0335016_0214132_3_158 | 3300034166 | Freshwater | SLVITHGLGYQPNVTVKSSAGDILETGIDYNSTNQITLTMAQPFSGTAYLS |
| Ga0335061_0484201_464_625 | 3300034168 | Freshwater | VYSVEITHNLGFSPNVTVKASSGDILETEVDYNSLNKITLRMAQPFSGTAYLS |
| ⦗Top⦘ |