


| Basic Information | |
|---|---|
| Family ID | F035950 |
| Family Type | Metagenome |
| Number of Sequences | 171 |
| Average Sequence Length | 46 residues |
| Representative Sequence | IAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.42 % |
| % of genes from short scaffolds (< 2000 bps) | 94.15 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.450 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.825 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.123 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 41.52 |
| PF04338 | DUF481 | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF08308 | PEGA | 0.58 |
| PF01039 | Carboxyl_trans | 0.58 |
| PF00069 | Pkinase | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.34 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.58 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.58 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1132383 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300000890|JGI11643J12802_12071318 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300000891|JGI10214J12806_11084919 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300000955|JGI1027J12803_100974566 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300002907|JGI25613J43889_10063836 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300004268|Ga0066398_10028960 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300004479|Ga0062595_101749507 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005093|Ga0062594_100575528 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005177|Ga0066690_10046965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2613 | Open in IMG/M |
| 3300005186|Ga0066676_10099248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1764 | Open in IMG/M |
| 3300005332|Ga0066388_103681672 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005332|Ga0066388_104338739 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005434|Ga0070709_10759881 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005440|Ga0070705_100235687 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300005444|Ga0070694_100540360 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005444|Ga0070694_101103895 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005444|Ga0070694_101359259 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005445|Ga0070708_100179483 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300005445|Ga0070708_100217215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus roseus | 1792 | Open in IMG/M |
| 3300005445|Ga0070708_100398644 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300005445|Ga0070708_100619041 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300005445|Ga0070708_100953890 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005451|Ga0066681_10032935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2748 | Open in IMG/M |
| 3300005467|Ga0070706_102085073 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005540|Ga0066697_10283527 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005545|Ga0070695_100602284 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005546|Ga0070696_101269539 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005549|Ga0070704_100320001 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300005555|Ga0066692_10604713 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005577|Ga0068857_100749788 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005617|Ga0068859_100770591 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005713|Ga0066905_100383807 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300005713|Ga0066905_100765425 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005719|Ga0068861_101115869 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005764|Ga0066903_108257849 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005841|Ga0068863_102076563 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005843|Ga0068860_100420704 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300006031|Ga0066651_10580151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300006034|Ga0066656_10136578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1523 | Open in IMG/M |
| 3300006046|Ga0066652_101897691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300006049|Ga0075417_10749960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 504 | Open in IMG/M |
| 3300006169|Ga0082029_1721157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 541 | Open in IMG/M |
| 3300006791|Ga0066653_10575679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300006800|Ga0066660_10186147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1571 | Open in IMG/M |
| 3300006806|Ga0079220_10289613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1005 | Open in IMG/M |
| 3300006844|Ga0075428_100889229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 945 | Open in IMG/M |
| 3300006845|Ga0075421_101156565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300006852|Ga0075433_10008203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8323 | Open in IMG/M |
| 3300006853|Ga0075420_100585042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 964 | Open in IMG/M |
| 3300006854|Ga0075425_100216765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2201 | Open in IMG/M |
| 3300006871|Ga0075434_100697160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1033 | Open in IMG/M |
| 3300006871|Ga0075434_101026355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 838 | Open in IMG/M |
| 3300006880|Ga0075429_100651087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 923 | Open in IMG/M |
| 3300006880|Ga0075429_102013506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 500 | Open in IMG/M |
| 3300006894|Ga0079215_10366988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 832 | Open in IMG/M |
| 3300006904|Ga0075424_100891931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 949 | Open in IMG/M |
| 3300006904|Ga0075424_101618612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 686 | Open in IMG/M |
| 3300006931|Ga0097620_101234148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 823 | Open in IMG/M |
| 3300006969|Ga0075419_10936494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300007076|Ga0075435_100329457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 1307 | Open in IMG/M |
| 3300007076|Ga0075435_100542493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1007 | Open in IMG/M |
| 3300009088|Ga0099830_10947276 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009089|Ga0099828_11059780 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300009090|Ga0099827_10314567 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009090|Ga0099827_10867494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
| 3300009092|Ga0105250_10542284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300009098|Ga0105245_10861608 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009100|Ga0075418_10316694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 1664 | Open in IMG/M |
| 3300009137|Ga0066709_103613619 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009147|Ga0114129_10489141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 1609 | Open in IMG/M |
| 3300009148|Ga0105243_12608217 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009162|Ga0075423_12210488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 598 | Open in IMG/M |
| 3300009177|Ga0105248_11404347 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009553|Ga0105249_10471873 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300009553|Ga0105249_12750072 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009792|Ga0126374_10162705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 1368 | Open in IMG/M |
| 3300009792|Ga0126374_10691308 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010043|Ga0126380_10488777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 941 | Open in IMG/M |
| 3300010043|Ga0126380_11575569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 585 | Open in IMG/M |
| 3300010046|Ga0126384_11965718 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010046|Ga0126384_12212088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 529 | Open in IMG/M |
| 3300010047|Ga0126382_11208065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 678 | Open in IMG/M |
| 3300010320|Ga0134109_10325357 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010321|Ga0134067_10270252 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010360|Ga0126372_11598887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 690 | Open in IMG/M |
| 3300010360|Ga0126372_11780996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 659 | Open in IMG/M |
| 3300010362|Ga0126377_10178523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 2018 | Open in IMG/M |
| 3300010362|Ga0126377_12092659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 642 | Open in IMG/M |
| 3300010362|Ga0126377_13125439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 535 | Open in IMG/M |
| 3300010391|Ga0136847_12092741 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010398|Ga0126383_10745594 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300011270|Ga0137391_11149063 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012179|Ga0137334_1127575 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012189|Ga0137388_10633895 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300012204|Ga0137374_10740162 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012204|Ga0137374_11124987 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012209|Ga0137379_10640760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 969 | Open in IMG/M |
| 3300012210|Ga0137378_11659907 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012353|Ga0137367_10028056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4356 | Open in IMG/M |
| 3300012361|Ga0137360_10044034 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
| 3300012362|Ga0137361_11630989 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012582|Ga0137358_10639279 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012917|Ga0137395_10489847 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012918|Ga0137396_10288001 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012929|Ga0137404_12190569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 517 | Open in IMG/M |
| 3300013306|Ga0163162_10545475 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300013307|Ga0157372_13373106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 508 | Open in IMG/M |
| 3300015264|Ga0137403_10231690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1765 | Open in IMG/M |
| 3300015373|Ga0132257_102516558 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300017997|Ga0184610_1158968 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300018058|Ga0187766_10344356 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300018060|Ga0187765_10674928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 676 | Open in IMG/M |
| 3300018068|Ga0184636_1164435 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018075|Ga0184632_10493378 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300018422|Ga0190265_11592794 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018482|Ga0066669_10048360 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300019377|Ga0190264_10742088 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300019882|Ga0193713_1174110 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300019883|Ga0193725_1043563 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300020170|Ga0179594_10163782 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300021051|Ga0206224_1037249 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021478|Ga0210402_11252149 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300022756|Ga0222622_10625514 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300023057|Ga0247797_1017531 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300023072|Ga0247799_1003917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 2063 | Open in IMG/M |
| 3300025885|Ga0207653_10111547 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300025922|Ga0207646_11125143 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025922|Ga0207646_11148729 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025922|Ga0207646_11479686 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025923|Ga0207681_10446411 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300025935|Ga0207709_10340327 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300025938|Ga0207704_11082506 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026075|Ga0207708_11243098 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300026116|Ga0207674_11330183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300026309|Ga0209055_1070902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1454 | Open in IMG/M |
| 3300026310|Ga0209239_1226037 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300026314|Ga0209268_1109182 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300026316|Ga0209155_1051130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1605 | Open in IMG/M |
| 3300026351|Ga0257170_1004630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1572 | Open in IMG/M |
| 3300026355|Ga0257149_1045033 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026446|Ga0257178_1008335 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300026508|Ga0257161_1073246 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026540|Ga0209376_1301997 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300027646|Ga0209466_1054040 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027695|Ga0209966_1175851 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027846|Ga0209180_10076919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1880 | Open in IMG/M |
| 3300027846|Ga0209180_10133521 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300027875|Ga0209283_10626190 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027875|Ga0209283_10921732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300027909|Ga0209382_10253527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1997 | Open in IMG/M |
| 3300027909|Ga0209382_11275764 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300028814|Ga0307302_10404919 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300028824|Ga0307310_10628241 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300030006|Ga0299907_10674963 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031152|Ga0307501_10136180 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031198|Ga0307500_10261691 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031713|Ga0318496_10415806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 743 | Open in IMG/M |
| 3300031720|Ga0307469_10289420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1343 | Open in IMG/M |
| 3300031720|Ga0307469_10590266 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031720|Ga0307469_11078977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 753 | Open in IMG/M |
| 3300031723|Ga0318493_10610913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 608 | Open in IMG/M |
| 3300031740|Ga0307468_100796628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 805 | Open in IMG/M |
| 3300031748|Ga0318492_10121313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 1301 | Open in IMG/M |
| 3300031858|Ga0310892_11018890 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031913|Ga0310891_10141360 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031945|Ga0310913_11006797 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300032012|Ga0310902_10960582 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032180|Ga0307471_102168104 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032180|Ga0307471_103589440 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300034147|Ga0364925_0039999 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300034151|Ga0364935_0234624 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.17% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.58% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_11323831 | 2228664022 | Soil | KLLRKQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE |
| JGI11643J12802_120713181 | 3300000890 | Soil | EPWYGEYDTKAVAIVHNIIRGATAVPKGLKELVALQRSLA* |
| JGI10214J12806_110849191 | 3300000891 | Soil | YKKGKVIAAYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV* |
| JGI1027J12803_1009745662 | 3300000955 | Soil | IAAYKEPWYAEYDTKALAIVHDIIRSSATVPTGLKRLAGLQKSLA* |
| JGI25613J43889_100638362 | 3300002907 | Grasslands Soil | PWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA* |
| Ga0066398_100289601 | 3300004268 | Tropical Forest Soil | EPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLASLQKSLA* |
| Ga0062595_1017495072 | 3300004479 | Soil | KGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA* |
| Ga0062594_1005755282 | 3300005093 | Soil | AYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0066690_100469655 | 3300005177 | Soil | IAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE* |
| Ga0066676_100992483 | 3300005186 | Soil | VIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE* |
| Ga0066388_1036816721 | 3300005332 | Tropical Forest Soil | DKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0066388_1043387391 | 3300005332 | Tropical Forest Soil | QYKKGKVIAAYKEPWYGEYDTKAVAIVQNIIRGATTVPKGLKDLAALQKSLA* |
| Ga0070709_107598811 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YKKGKVIGAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA* |
| Ga0070705_1002356873 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA* |
| Ga0070694_1005403602 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA* |
| Ga0070694_1011038952 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA* |
| Ga0070694_1013592591 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EQYKKGKVIAAYKEPWYGEYDTKAVATVQNLIRGTITVPKGLKDLAALQKSLA* |
| Ga0070708_1001794831 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLREQTRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGAAVPKGLKQLASLQKSLA* |
| Ga0070708_1002172151 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLREQTRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA* |
| Ga0070708_1003986441 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE* |
| Ga0070708_1006190412 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KVIAAYKEPWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA* |
| Ga0070708_1009538902 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV* |
| Ga0066681_100329355 | 3300005451 | Soil | KLLRKQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE* |
| Ga0070706_1020850732 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KGKVIAAYKEPWYSEYDTKAVPIVHNIIRGSVTVPQGLKEVVKLQRSLV* |
| Ga0066697_102835272 | 3300005540 | Soil | KQYEKGRVIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE* |
| Ga0070695_1006022841 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YKEPWYGEYDTKAVATVHNIIRGATSVPKGLKELVALQKSLA* |
| Ga0070696_1012695392 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FKESWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA* |
| Ga0070704_1003200012 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0066692_106047132 | 3300005555 | Soil | YKEPWYSEYDVKAVPIVHNMIRGGVSVPQGLKELVKLQKSLV* |
| Ga0068857_1007497881 | 3300005577 | Corn Rhizosphere | KGRIVSAFKEPWYGEYDSKAIAIVHNVIRGNSPVPKGLKDLVALQKSLA* |
| Ga0068859_1007705912 | 3300005617 | Switchgrass Rhizosphere | PWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0066905_1003838072 | 3300005713 | Tropical Forest Soil | VIAAYKEPWYGEYDTKAVAIVQNIIRGTTAVPKGLKELVALQKSLV* |
| Ga0066905_1007654252 | 3300005713 | Tropical Forest Soil | MLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLSVPKGLKDLVALQKSLA* |
| Ga0068861_1011158691 | 3300005719 | Switchgrass Rhizosphere | YKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE* |
| Ga0066903_1082578492 | 3300005764 | Tropical Forest Soil | FKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0068863_1020765632 | 3300005841 | Switchgrass Rhizosphere | PWYSEYDTKAVPIAHNIIRGAITVPQGLKEMTKLQRSLA* |
| Ga0068860_1004207041 | 3300005843 | Switchgrass Rhizosphere | QYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA* |
| Ga0066651_105801511 | 3300006031 | Soil | STKGKVIGAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA* |
| Ga0066656_101365783 | 3300006034 | Soil | AYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE* |
| Ga0066652_1018976911 | 3300006046 | Soil | PNNAFKEPWFSEWDSKAIAIAHNIIRGTSTVPKGLKELTALHKSLV* |
| Ga0075417_107499602 | 3300006049 | Populus Rhizosphere | EYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA* |
| Ga0082029_17211572 | 3300006169 | Termite Nest | VIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAALQKSLA* |
| Ga0066653_105756792 | 3300006791 | Soil | AYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE* |
| Ga0066660_101861473 | 3300006800 | Soil | SEYDSKAIAVVHNIIRGTSTVPKGLKELAALQKSLA* |
| Ga0079220_102896132 | 3300006806 | Agricultural Soil | IAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE* |
| Ga0075428_1008892292 | 3300006844 | Populus Rhizosphere | KVIAAYKEPWYGEYDTKAVATVHNMIRGTTAVPKGLKELVALQKSLV* |
| Ga0075421_1011565652 | 3300006845 | Populus Rhizosphere | NAFKEPWFSEWDSKAIAIVHNVIRGTSTVPKGLKELTALHKSLV* |
| Ga0075433_100082031 | 3300006852 | Populus Rhizosphere | VIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE* |
| Ga0075420_1005850422 | 3300006853 | Populus Rhizosphere | FKEPWFSEWDSKAIAIVHNIIRGTSTVPKGLKELAALQKSLV* |
| Ga0075425_1002167654 | 3300006854 | Populus Rhizosphere | LRRQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE* |
| Ga0075434_1006971601 | 3300006871 | Populus Rhizosphere | KVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA* |
| Ga0075434_1010263551 | 3300006871 | Populus Rhizosphere | EKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE* |
| Ga0075429_1006510871 | 3300006880 | Populus Rhizosphere | YKEPWYGEYDTKAVAIVHNIIRGATPVPKGLKDLAALQKSLA* |
| Ga0075429_1020135061 | 3300006880 | Populus Rhizosphere | YKEPWYGEYDTKAIPIVQNIIRGTVTVPQGLKDLAKLQKSLA* |
| Ga0079215_103669881 | 3300006894 | Agricultural Soil | EQYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTVTVPKGLKDLVALQKSLA* |
| Ga0075424_1008919311 | 3300006904 | Populus Rhizosphere | MLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0075424_1016186122 | 3300006904 | Populus Rhizosphere | DKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA* |
| Ga0097620_1012341482 | 3300006931 | Switchgrass Rhizosphere | AYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA* |
| Ga0075419_109364942 | 3300006969 | Populus Rhizosphere | AAYKEPWYSEYDTKAVPIVHNMIRGTLPVGQGLKDIVKLQRSLA* |
| Ga0075435_1003294573 | 3300007076 | Populus Rhizosphere | EYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE* |
| Ga0075435_1005424932 | 3300007076 | Populus Rhizosphere | QYEKGRVIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE* |
| Ga0099830_109472761 | 3300009088 | Vadose Zone Soil | KGRVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV* |
| Ga0099828_110597801 | 3300009089 | Vadose Zone Soil | IAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV* |
| Ga0099827_103145672 | 3300009090 | Vadose Zone Soil | IAAYKEPWYGEYDTKAVATVQNIIRGVVTVPKGLKELVALQKSLA* |
| Ga0099827_108674941 | 3300009090 | Vadose Zone Soil | QYKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA* |
| Ga0105250_105422842 | 3300009092 | Switchgrass Rhizosphere | AAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0105245_108616081 | 3300009098 | Miscanthus Rhizosphere | KGKVIAAYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV* |
| Ga0075418_103166941 | 3300009100 | Populus Rhizosphere | REQYKKGRTITAFKEPWYAEYDSKAIAVVHNIIRGTSTVPKGLKDLAALQRSVA* |
| Ga0066709_1036136192 | 3300009137 | Grasslands Soil | PWFSEYDSKAIAVVHNIIRGTSTVPKGLKELATLQRSLA* |
| Ga0114129_104891413 | 3300009147 | Populus Rhizosphere | AFKEPWYGEYDSKAIAIVHNVIRGNSPVPKGLKDLVALQKSLA* |
| Ga0105243_126082171 | 3300009148 | Miscanthus Rhizosphere | KKGKVIAAYKEPWYGEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA* |
| Ga0075423_122104881 | 3300009162 | Populus Rhizosphere | IGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA* |
| Ga0105248_114043471 | 3300009177 | Switchgrass Rhizosphere | QYEKGKVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVLAGLKELVKLQKSLE* |
| Ga0105249_104718731 | 3300009553 | Switchgrass Rhizosphere | GKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0105249_127500722 | 3300009553 | Switchgrass Rhizosphere | LLRKQYEKGKVIAAYKEPWYSEYDVKAAPIVHNMIRGGTTVPQALKELVKLQKSLE* |
| Ga0126374_101627053 | 3300009792 | Tropical Forest Soil | SEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA* |
| Ga0126374_106913081 | 3300009792 | Tropical Forest Soil | QYEKGKVIAAYKEPWYGEYDVKAVPVVHNIIRGTATVPQGLKELVKLQKSLA* |
| Ga0126380_104887771 | 3300010043 | Tropical Forest Soil | AAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKALKDLASLQKSLA* |
| Ga0126380_115755691 | 3300010043 | Tropical Forest Soil | KAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0126384_119657181 | 3300010046 | Tropical Forest Soil | EYDTRAVPMVHDMIRGNTTVAKGLKDLVKLQKSLV* |
| Ga0126384_122120882 | 3300010046 | Tropical Forest Soil | AKVIAAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0126382_112080652 | 3300010047 | Tropical Forest Soil | AFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0134109_103253571 | 3300010320 | Grasslands Soil | KGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA* |
| Ga0134067_102702521 | 3300010321 | Grasslands Soil | YKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA* |
| Ga0126372_115988871 | 3300010360 | Tropical Forest Soil | LRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA* |
| Ga0126372_117809962 | 3300010360 | Tropical Forest Soil | LLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0126377_101785233 | 3300010362 | Tropical Forest Soil | YDTKAVPIVHNMIRGSLTVPKGLKDLASLQRSLA* |
| Ga0126377_120926592 | 3300010362 | Tropical Forest Soil | AKVIGAFKEPWYSEYDTKAVPIVHNMIRGSSTVPKGLKDLVALQKSLA* |
| Ga0126377_131254392 | 3300010362 | Tropical Forest Soil | NAFKEPWFSEWDSKAIAIVHNIIRGTSAVPKGLKELAALQKSLV* |
| Ga0136847_120927411 | 3300010391 | Freshwater Sediment | KEPWYGEYDTKAVATVQNIIRGVTTVPKGLKDLTALQKSLA* |
| Ga0126383_107455941 | 3300010398 | Tropical Forest Soil | KGRVSAAYKEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE* |
| Ga0137391_111490632 | 3300011270 | Vadose Zone Soil | IAAYKEPWYGEYDTKAVATVHNIIRGATSVPNGLKELVALQKSLA* |
| Ga0137334_11275752 | 3300012179 | Soil | EQYKKGKVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA* |
| Ga0137388_106338951 | 3300012189 | Vadose Zone Soil | KGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA* |
| Ga0137374_107401621 | 3300012204 | Vadose Zone Soil | LLREQYKKGKVIAAYKEPWYGEYDTKAVAIAHDIIRGATPVPKGLKDLVALQKSLA* |
| Ga0137374_111249871 | 3300012204 | Vadose Zone Soil | LLREQYKKGKVIAAYKEPWYGEYDTKAVAIAHDIIRGATPVAKGLKDLVALQKSLA* |
| Ga0137379_106407601 | 3300012209 | Vadose Zone Soil | KKGRPNNAFKEPWFSEWDSKAIAIAHNIIRGTSTVPKGLNELQALYKALV* |
| Ga0137378_116599071 | 3300012210 | Vadose Zone Soil | EYDSKAIAIVHNIIRGTSTVPKGLKELTALQKSLA* |
| Ga0137367_100280566 | 3300012353 | Vadose Zone Soil | AYKEPWYGEYDTKAVAIAHDIIRGATPVAKGLKDLVALQKSLA* |
| Ga0137360_100440345 | 3300012361 | Vadose Zone Soil | REQYKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA* |
| Ga0137361_116309891 | 3300012362 | Vadose Zone Soil | KEPWYAEYDTKALAIVHDIIRSGATVPKGLKQLASLQKSLA* |
| Ga0137358_106392791 | 3300012582 | Vadose Zone Soil | YDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE* |
| Ga0137395_104898472 | 3300012917 | Vadose Zone Soil | ESWFSEYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV* |
| Ga0137396_102880011 | 3300012918 | Vadose Zone Soil | KGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA* |
| Ga0137404_121905691 | 3300012929 | Vadose Zone Soil | QYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0163162_105454752 | 3300013306 | Switchgrass Rhizosphere | KEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0157372_133731061 | 3300013307 | Corn Rhizosphere | DKAKVIAAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA* |
| Ga0137403_102316903 | 3300015264 | Vadose Zone Soil | AAFKEPWYGEYDTRAVAIVHDIIRGAATVPKGLKDLAALQKSLV* |
| Ga0132257_1025165582 | 3300015373 | Arabidopsis Rhizosphere | VIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA* |
| Ga0184610_11589681 | 3300017997 | Groundwater Sediment | YGEYDTKAVATVHNIIRGTTTVPKGLKELTSLQKSLV |
| Ga0187766_103443561 | 3300018058 | Tropical Peatland | KEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE |
| Ga0187765_106749282 | 3300018060 | Tropical Peatland | LRKQYDKAKVIAAFKESWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVSLQKSVA |
| Ga0184636_11644351 | 3300018068 | Groundwater Sediment | GEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA |
| Ga0184632_104933781 | 3300018075 | Groundwater Sediment | AYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKDLVALQKSLA |
| Ga0190265_115927941 | 3300018422 | Soil | KKGKVIAAYKEPWYGEYDTKAVAIVHNIIRGATPVPKGLKDLAALQKSLA |
| Ga0066669_100483604 | 3300018482 | Grasslands Soil | IGAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA |
| Ga0190264_107420882 | 3300019377 | Soil | REQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGATPVPKGLKDLASLQKSLA |
| Ga0193713_11741102 | 3300019882 | Soil | SEYDTKAIAIVHNIIRGSSTVPKGLKELVALQKSLV |
| Ga0193725_10435632 | 3300019883 | Soil | SWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA |
| Ga0179594_101637821 | 3300020170 | Vadose Zone Soil | KEPWYSEYDVKAVPIVHNIIRGGVTVPQGLKELVKLQKSLE |
| Ga0206224_10372492 | 3300021051 | Deep Subsurface Sediment | EQYKKGKVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA |
| Ga0210402_112521491 | 3300021478 | Soil | LREQYKKGRVIAAYKEPWYGEYDAKAVATVHNIIRGTTTVPKGLKDLVALQKSLA |
| Ga0222622_106255142 | 3300022756 | Groundwater Sediment | QYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA |
| Ga0247797_10175311 | 3300023057 | Soil | KKGRVIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA |
| Ga0247799_10039173 | 3300023072 | Soil | RVIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA |
| Ga0207653_101115471 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | KKGKVIAAYKEPWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA |
| Ga0207646_111251432 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV |
| Ga0207646_111487291 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGAAVPKGLKQLASLQKSLA |
| Ga0207646_114796861 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAYKEPWYGEYDTKAVATVQNLIRGTITVPKGLKDLAALQKSLA |
| Ga0207681_104464112 | 3300025923 | Switchgrass Rhizosphere | ESWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA |
| Ga0207709_103403271 | 3300025935 | Miscanthus Rhizosphere | EYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA |
| Ga0207704_110825061 | 3300025938 | Miscanthus Rhizosphere | KGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA |
| Ga0207708_112430981 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE |
| Ga0207674_113301831 | 3300026116 | Corn Rhizosphere | EYDTKAVPIVHNIIRGSVTVPQGLKEVVKLQRSLA |
| Ga0209055_10709021 | 3300026309 | Soil | GAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA |
| Ga0209239_12260372 | 3300026310 | Grasslands Soil | AYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA |
| Ga0209268_11091821 | 3300026314 | Soil | PWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA |
| Ga0209155_10511301 | 3300026316 | Soil | SEWDSKAIAIVHNIIRGTSTVPKGLKELAALQKSLA |
| Ga0257170_10046301 | 3300026351 | Soil | EYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV |
| Ga0257149_10450332 | 3300026355 | Soil | IAAYKEPWYGEYDTKAVATVQNIIRGVTTVPRGLKELVALQKSLA |
| Ga0257178_10083352 | 3300026446 | Soil | TRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA |
| Ga0257161_10732461 | 3300026508 | Soil | YAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA |
| Ga0209376_13019972 | 3300026540 | Soil | WFSEWDSKAIAIVHNIIRGTTTVPKGLKELAALQKSLA |
| Ga0209466_10540402 | 3300027646 | Tropical Forest Soil | YDKAKVIDAFKEPWYAEYDTKAVPIVHNMIRGSLTVPRGLKELASLQKSLT |
| Ga0209966_11758512 | 3300027695 | Arabidopsis Thaliana Rhizosphere | EPWYGEYDTKAVAIVHNIIRGVTAVPKGLKELVALQRSLA |
| Ga0209180_100769193 | 3300027846 | Vadose Zone Soil | GKVIGAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA |
| Ga0209180_101335211 | 3300027846 | Vadose Zone Soil | YKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA |
| Ga0209283_106261901 | 3300027875 | Vadose Zone Soil | IAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV |
| Ga0209283_109217322 | 3300027875 | Vadose Zone Soil | KKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA |
| Ga0209382_102535271 | 3300027909 | Populus Rhizosphere | PWYAEYDTKALAVVHDIIRGGATVPRGLKQLTSLQKSLL |
| Ga0209382_112757642 | 3300027909 | Populus Rhizosphere | PWYGEYDSKAVAIVHNVIRGNSPVPKGLKDLVALQKSLA |
| Ga0307302_104049191 | 3300028814 | Soil | IAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA |
| Ga0307310_106282412 | 3300028824 | Soil | EQYKKGRVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA |
| Ga0299907_106749632 | 3300030006 | Soil | FSEWDSKAIAIVHNIIRGTSTVPRGLKELTALYKSLV |
| Ga0307501_101361802 | 3300031152 | Soil | KVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA |
| Ga0307500_102616911 | 3300031198 | Soil | AYKEPWYGEYDTKAIAIVQNIIRGSLTVPQGLKDLAKLQKSLA |
| Ga0318496_104158061 | 3300031713 | Soil | VIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA |
| Ga0307469_102894201 | 3300031720 | Hardwood Forest Soil | LLREQTRKGKVIAAYKESWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA |
| Ga0307469_105902661 | 3300031720 | Hardwood Forest Soil | KLLREQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGTTAVPKGLKELTALQKSLV |
| Ga0307469_110789771 | 3300031720 | Hardwood Forest Soil | KESWFSEYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV |
| Ga0318493_106109131 | 3300031723 | Soil | FKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA |
| Ga0307468_1007966282 | 3300031740 | Hardwood Forest Soil | FKEPWYSEYDTKAVPIVHNMIRGSLAVPKGLKDLVALQKSLA |
| Ga0318492_101213133 | 3300031748 | Soil | QYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA |
| Ga0310892_110188902 | 3300031858 | Soil | VIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA |
| Ga0310891_101413602 | 3300031913 | Soil | EKGKVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE |
| Ga0310913_110067971 | 3300031945 | Soil | QYEKGRVIAAYKEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE |
| Ga0310902_109605821 | 3300032012 | Soil | KEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE |
| Ga0307471_1021681041 | 3300032180 | Hardwood Forest Soil | REQIRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA |
| Ga0307471_1035894402 | 3300032180 | Hardwood Forest Soil | VIAAYKEPWYGEYDTKAVAVVHDIIRGTTTVPKGLKDLVALQKSLA |
| Ga0364925_0039999_1402_1566 | 3300034147 | Sediment | KTQYTKGKVIAAYKEGWYGEYDTKAIPIVQNIIRGTLTVPQGLKDLAKLQKSLA |
| Ga0364935_0234624_429_596 | 3300034151 | Sediment | LREQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGATPVPKGLKDLAALQKSLA |
| ⦗Top⦘ |