


| Basic Information | |
|---|---|
| Family ID | F035919 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADAIR |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.36 % |
| % of genes near scaffold ends (potentially truncated) | 77.19 % |
| % of genes from short scaffolds (< 2000 bps) | 83.04 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.988 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.977 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.012 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00216 | Bac_DNA_binding | 1.75 |
| PF09903 | DUF2130 | 1.17 |
| PF03167 | UDG | 1.17 |
| PF07992 | Pyr_redox_2 | 1.17 |
| PF14559 | TPR_19 | 1.17 |
| PF12728 | HTH_17 | 1.17 |
| PF07505 | DUF5131 | 1.17 |
| PF13649 | Methyltransf_25 | 1.17 |
| PF04307 | YdjM | 0.58 |
| PF01555 | N6_N4_Mtase | 0.58 |
| PF03309 | Pan_kinase | 0.58 |
| PF04851 | ResIII | 0.58 |
| PF12680 | SnoaL_2 | 0.58 |
| PF01924 | HypD | 0.58 |
| PF02423 | OCD_Mu_crystall | 0.58 |
| PF05598 | DUF772 | 0.58 |
| PF02481 | DNA_processg_A | 0.58 |
| PF13589 | HATPase_c_3 | 0.58 |
| PF00665 | rve | 0.58 |
| PF02371 | Transposase_20 | 0.58 |
| PF00230 | MIP | 0.58 |
| PF04970 | LRAT | 0.58 |
| PF11838 | ERAP1_C | 0.58 |
| PF02661 | Fic | 0.58 |
| PF02673 | BacA | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF00128 | Alpha-amylase | 0.58 |
| PF06348 | DUF1059 | 0.58 |
| PF08867 | FRG | 0.58 |
| PF01381 | HTH_3 | 0.58 |
| PF11159 | DUF2939 | 0.58 |
| PF03721 | UDPG_MGDP_dh_N | 0.58 |
| PF04555 | XhoI | 0.58 |
| PF01053 | Cys_Met_Meta_PP | 0.58 |
| PF07676 | PD40 | 0.58 |
| PF07510 | DUF1524 | 0.58 |
| PF00990 | GGDEF | 0.58 |
| PF13683 | rve_3 | 0.58 |
| PF02518 | HATPase_c | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF02810 | SEC-C | 0.58 |
| PF01103 | Omp85 | 0.58 |
| PF00857 | Isochorismatase | 0.58 |
| PF00575 | S1 | 0.58 |
| PF01068 | DNA_ligase_A_M | 0.58 |
| PF04185 | Phosphoesterase | 0.58 |
| PF13365 | Trypsin_2 | 0.58 |
| PF06114 | Peptidase_M78 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.34 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.75 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.17 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.17 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.17 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.17 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 1.17 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.58 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.58 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.58 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0409 | Hydrogenase maturation factor HypD | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.58 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.58 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.58 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.58 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.58 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.58 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.58 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.58 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.58 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.58 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.58 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.58 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.58 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.58 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.58 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.58 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.58 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.58 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.58 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.58 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.99 % |
| Unclassified | root | N/A | 38.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02G2B05 | Not Available | 510 | Open in IMG/M |
| 3300001593|JGI12635J15846_10510134 | Not Available | 708 | Open in IMG/M |
| 3300001976|JGI24752J21851_1004541 | Not Available | 1820 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100012458 | All Organisms → cellular organisms → Bacteria | 7000 | Open in IMG/M |
| 3300004092|Ga0062389_102532624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300004092|Ga0062389_104023379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300004463|Ga0063356_101174594 | Not Available | 1112 | Open in IMG/M |
| 3300005177|Ga0066690_10667730 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005179|Ga0066684_10764160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005290|Ga0065712_10197045 | Not Available | 1124 | Open in IMG/M |
| 3300005355|Ga0070671_100043994 | All Organisms → cellular organisms → Bacteria | 3710 | Open in IMG/M |
| 3300005445|Ga0070708_100010374 | All Organisms → cellular organisms → Bacteria | 7548 | Open in IMG/M |
| 3300005451|Ga0066681_10316038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 957 | Open in IMG/M |
| 3300005457|Ga0070662_101484070 | Not Available | 585 | Open in IMG/M |
| 3300005467|Ga0070706_100016684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6783 | Open in IMG/M |
| 3300005538|Ga0070731_11181385 | Not Available | 505 | Open in IMG/M |
| 3300005554|Ga0066661_10050760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2374 | Open in IMG/M |
| 3300005554|Ga0066661_10576242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 670 | Open in IMG/M |
| 3300005563|Ga0068855_101354614 | Not Available | 735 | Open in IMG/M |
| 3300005591|Ga0070761_10670053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300005844|Ga0068862_101202547 | Not Available | 756 | Open in IMG/M |
| 3300005938|Ga0066795_10151899 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006028|Ga0070717_10018786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5406 | Open in IMG/M |
| 3300006041|Ga0075023_100035277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1496 | Open in IMG/M |
| 3300006059|Ga0075017_101681614 | Not Available | 502 | Open in IMG/M |
| 3300006173|Ga0070716_100335149 | Not Available | 1065 | Open in IMG/M |
| 3300006174|Ga0075014_100762425 | Not Available | 568 | Open in IMG/M |
| 3300006176|Ga0070765_100238166 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300006354|Ga0075021_11096878 | Not Available | 521 | Open in IMG/M |
| 3300006796|Ga0066665_10448542 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006796|Ga0066665_10572247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 915 | Open in IMG/M |
| 3300006893|Ga0073928_10030701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5175 | Open in IMG/M |
| 3300006914|Ga0075436_100867073 | Not Available | 674 | Open in IMG/M |
| 3300009012|Ga0066710_103388005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300009038|Ga0099829_10065655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2737 | Open in IMG/M |
| 3300009038|Ga0099829_11055643 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009089|Ga0099828_10830815 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300009137|Ga0066709_103266786 | Not Available | 590 | Open in IMG/M |
| 3300009174|Ga0105241_11220860 | Not Available | 713 | Open in IMG/M |
| 3300009522|Ga0116218_1081998 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300009524|Ga0116225_1308927 | Not Available | 705 | Open in IMG/M |
| 3300009629|Ga0116119_1035367 | Not Available | 1328 | Open in IMG/M |
| 3300009643|Ga0116110_1182129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300009644|Ga0116121_1310953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009665|Ga0116135_1072231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1220 | Open in IMG/M |
| 3300009700|Ga0116217_10570495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300009759|Ga0116101_1166248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300009764|Ga0116134_1039558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
| 3300009824|Ga0116219_10397675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300010322|Ga0134084_10389596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010341|Ga0074045_10200253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| 3300010341|Ga0074045_10501533 | Not Available | 780 | Open in IMG/M |
| 3300010341|Ga0074045_11043274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010343|Ga0074044_10401161 | Not Available | 898 | Open in IMG/M |
| 3300010358|Ga0126370_10338910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300010358|Ga0126370_11244319 | Not Available | 694 | Open in IMG/M |
| 3300010361|Ga0126378_10511652 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300010366|Ga0126379_12627406 | Not Available | 601 | Open in IMG/M |
| 3300010379|Ga0136449_102711482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300012189|Ga0137388_11966686 | Not Available | 513 | Open in IMG/M |
| 3300012202|Ga0137363_10069393 | Not Available | 2588 | Open in IMG/M |
| 3300012203|Ga0137399_10465638 | Not Available | 1058 | Open in IMG/M |
| 3300012206|Ga0137380_10131870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2281 | Open in IMG/M |
| 3300012208|Ga0137376_10149352 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300012349|Ga0137387_10117864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1868 | Open in IMG/M |
| 3300012356|Ga0137371_10688080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300012362|Ga0137361_11043998 | Not Available | 737 | Open in IMG/M |
| 3300012927|Ga0137416_12159226 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012929|Ga0137404_10147682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1952 | Open in IMG/M |
| 3300013297|Ga0157378_10273593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1625 | Open in IMG/M |
| 3300013297|Ga0157378_10571841 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300013297|Ga0157378_10588305 | Not Available | 1123 | Open in IMG/M |
| 3300013307|Ga0157372_10918588 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300014156|Ga0181518_10261208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300014495|Ga0182015_10163975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_63_13 | 1504 | Open in IMG/M |
| 3300014495|Ga0182015_10849185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300014501|Ga0182024_10062625 | All Organisms → cellular organisms → Bacteria | 5725 | Open in IMG/M |
| 3300014501|Ga0182024_10444094 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300014638|Ga0181536_10295416 | Not Available | 756 | Open in IMG/M |
| 3300014638|Ga0181536_10362379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300014657|Ga0181522_10837937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300014838|Ga0182030_11196278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Halanaerobacter → Halanaerobacter jeridensis | 650 | Open in IMG/M |
| 3300014968|Ga0157379_10201383 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300015264|Ga0137403_10412725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300015371|Ga0132258_11869659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300015374|Ga0132255_103629049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300016270|Ga0182036_10002021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9692 | Open in IMG/M |
| 3300016404|Ga0182037_10325501 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Parapedobacter → Parapedobacter koreensis | 1244 | Open in IMG/M |
| 3300017792|Ga0163161_11976989 | Not Available | 519 | Open in IMG/M |
| 3300017822|Ga0187802_10375259 | Not Available | 561 | Open in IMG/M |
| 3300017823|Ga0187818_10322029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Halanaerobacter → Halanaerobacter jeridensis | 681 | Open in IMG/M |
| 3300017925|Ga0187856_1149258 | Not Available | 882 | Open in IMG/M |
| 3300017929|Ga0187849_1380162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300017929|Ga0187849_1394516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300017935|Ga0187848_10067707 | Not Available | 1679 | Open in IMG/M |
| 3300017940|Ga0187853_10361267 | Not Available | 647 | Open in IMG/M |
| 3300017941|Ga0187850_10331210 | Not Available | 671 | Open in IMG/M |
| 3300017943|Ga0187819_10867346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300017948|Ga0187847_10438459 | Not Available | 720 | Open in IMG/M |
| 3300017948|Ga0187847_10597329 | Not Available | 617 | Open in IMG/M |
| 3300017955|Ga0187817_10033165 | Not Available | 3137 | Open in IMG/M |
| 3300017955|Ga0187817_11008237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300018005|Ga0187878_1350854 | Not Available | 521 | Open in IMG/M |
| 3300018007|Ga0187805_10020283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2892 | Open in IMG/M |
| 3300018019|Ga0187874_10015129 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-8 | 4221 | Open in IMG/M |
| 3300018022|Ga0187864_10260826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300018030|Ga0187869_10403305 | Not Available | 652 | Open in IMG/M |
| 3300018033|Ga0187867_10218116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
| 3300018037|Ga0187883_10467059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 649 | Open in IMG/M |
| 3300018040|Ga0187862_10115996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1839 | Open in IMG/M |
| 3300018040|Ga0187862_10800457 | Not Available | 546 | Open in IMG/M |
| 3300018042|Ga0187871_10463634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300018057|Ga0187858_10834750 | Not Available | 544 | Open in IMG/M |
| 3300018062|Ga0187784_10588275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 894 | Open in IMG/M |
| 3300019082|Ga0187852_1079096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1476 | Open in IMG/M |
| 3300019786|Ga0182025_1314096 | Not Available | 1706 | Open in IMG/M |
| 3300020580|Ga0210403_10043618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3585 | Open in IMG/M |
| 3300020581|Ga0210399_10001277 | All Organisms → cellular organisms → Bacteria | 19756 | Open in IMG/M |
| 3300020582|Ga0210395_10939195 | Not Available | 642 | Open in IMG/M |
| 3300021171|Ga0210405_11350285 | Not Available | 521 | Open in IMG/M |
| 3300021407|Ga0210383_11542917 | Not Available | 548 | Open in IMG/M |
| 3300021432|Ga0210384_10390267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300021479|Ga0210410_11296927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 620 | Open in IMG/M |
| 3300021560|Ga0126371_10273289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1810 | Open in IMG/M |
| 3300021560|Ga0126371_12549180 | Not Available | 619 | Open in IMG/M |
| 3300022557|Ga0212123_10032832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5266 | Open in IMG/M |
| 3300023068|Ga0224554_1127569 | Not Available | 566 | Open in IMG/M |
| 3300025419|Ga0208036_1049265 | Not Available | 721 | Open in IMG/M |
| 3300025453|Ga0208455_1023532 | Not Available | 1460 | Open in IMG/M |
| 3300025612|Ga0208691_1044865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1006 | Open in IMG/M |
| 3300025910|Ga0207684_10115667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2298 | Open in IMG/M |
| 3300025910|Ga0207684_10445748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
| 3300025940|Ga0207691_11170200 | Not Available | 638 | Open in IMG/M |
| 3300026908|Ga0207787_1026510 | Not Available | 570 | Open in IMG/M |
| 3300027516|Ga0207761_1105668 | Not Available | 548 | Open in IMG/M |
| 3300027874|Ga0209465_10510979 | Not Available | 600 | Open in IMG/M |
| 3300027895|Ga0209624_10761769 | Not Available | 637 | Open in IMG/M |
| 3300027908|Ga0209006_10063506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 3299 | Open in IMG/M |
| 3300028047|Ga0209526_10322353 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300028379|Ga0268266_10760374 | Not Available | 935 | Open in IMG/M |
| 3300029636|Ga0222749_10000900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 16398 | Open in IMG/M |
| 3300029636|Ga0222749_10022444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2622 | Open in IMG/M |
| 3300030054|Ga0302182_10060345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300030693|Ga0302313_10241387 | Not Available | 724 | Open in IMG/M |
| 3300031028|Ga0302180_10198497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300031236|Ga0302324_103227422 | Not Available | 536 | Open in IMG/M |
| 3300031525|Ga0302326_13293917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031708|Ga0310686_117182843 | Not Available | 727 | Open in IMG/M |
| 3300031720|Ga0307469_10856352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300031820|Ga0307473_10700297 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031890|Ga0306925_10355866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1572 | Open in IMG/M |
| 3300032059|Ga0318533_10023502 | All Organisms → cellular organisms → Bacteria | 3926 | Open in IMG/M |
| 3300032160|Ga0311301_11168239 | Not Available | 991 | Open in IMG/M |
| 3300032180|Ga0307471_100065503 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
| 3300032180|Ga0307471_103939660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300032205|Ga0307472_100839707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300032770|Ga0335085_10310030 | Not Available | 1866 | Open in IMG/M |
| 3300032783|Ga0335079_11495949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300032783|Ga0335079_11691711 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 619 | Open in IMG/M |
| 3300032783|Ga0335079_11958940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300032805|Ga0335078_11880124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300032805|Ga0335078_12207445 | Not Available | 580 | Open in IMG/M |
| 3300032892|Ga0335081_11559029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300032897|Ga0335071_11193018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300033158|Ga0335077_11561463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300033561|Ga0371490_1149007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 580 | Open in IMG/M |
| 3300033983|Ga0371488_0280176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.09% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.34% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.17% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.17% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.17% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_04198240 | 2170459005 | Grass Soil | VDEGRKRVLLIAASILAAQKLSQFDGGKRVPAAISAIADAVRWPIA |
| JGI12635J15846_105101341 | 3300001593 | Forest Soil | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADGIRWAERIME |
| JGI24752J21851_10045411 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEGRKRVIAIMASILAARKLAQFDSSARVPATINAIADAVRWAERIME |
| JGIcombinedJ26739_10001245811 | 3300002245 | Forest Soil | VLLIAASILAARKLAQYDSGARVPATVSAIADAIR* |
| Ga0062389_1025326241 | 3300004092 | Bog Forest Soil | MDEGRKRVVGIMASILAARKLAQYDSGKRVPATVAAISDA |
| Ga0062389_1040233792 | 3300004092 | Bog Forest Soil | VDEGRKRVIGIMASILAARKLAQYDGGKRVPATVAAISDAVRWA |
| Ga0063356_1011745941 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VDEGRKRVIAIMASILAARKLAQFDSSARVPATINAIADAVRWAERIM |
| Ga0066690_106677301 | 3300005177 | Soil | VDEGRKRVLLIAASILAARKLAQPEPGRTPAFESVIANAITTA |
| Ga0066684_107641602 | 3300005179 | Soil | VDEGRKRVLLIAASILAARKLAQYDGVATARVPATVSAISDA |
| Ga0066678_105939111 | 3300005181 | Soil | MQGESAKLSSVDEGRKRVLLIAASILAARKLAQYGSEAQVPATI |
| Ga0065712_101970451 | 3300005290 | Miscanthus Rhizosphere | VDEGRKRVIAIMASILAARKLAQFDSSARVPATINAIADA |
| Ga0070671_1000439943 | 3300005355 | Switchgrass Rhizosphere | MDEGRKRVIAIMASILAARKLSQYDSGARIPATINAIADAVR |
| Ga0070708_1000103747 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDESRKRVILIAASILAARKLAQYDGAKRVPATTRPTKARS* |
| Ga0066681_103160383 | 3300005451 | Soil | VDEGRKRVLLIAASILAARKLAQYDGVATARVPATVSAISDAIRWAEQIM |
| Ga0070662_1014840701 | 3300005457 | Corn Rhizosphere | MDEGRRRVIATMASILAARKLAQFDSSARVPATINAIADA |
| Ga0070706_1000166847 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEGRKRVLLIAASILAARKLFHFDSGARVPATVSAIADAIPSGQRGF* |
| Ga0070731_111813852 | 3300005538 | Surface Soil | MDEGRKRVLLIAAAILAARKLAQYEGGKRVPATIIAIADGVR |
| Ga0066661_100507601 | 3300005554 | Soil | VDEGRKRVLLIAASILAARKLAQYGSEAQVPATISAIA |
| Ga0066661_105762421 | 3300005554 | Soil | VDEGRKRVLLIAASILAARKLAQHGSEAQVPATISA |
| Ga0068855_1013546141 | 3300005563 | Corn Rhizosphere | VDEGRKRVIAIMASILAARKLAQFDSSARVPATINAIADAV |
| Ga0070761_106700532 | 3300005591 | Soil | VDEGRKRVLLIAASILAARKLSQWDGGKRVPATISAIADAVRWA |
| Ga0068862_1012025472 | 3300005844 | Switchgrass Rhizosphere | LVVVEEGRKRVIGIMAAILAARTLAQFDSGARVPATINAIA |
| Ga0066795_101518992 | 3300005938 | Soil | VLLIAASILAARKLAQFEGWKRVPATLSAIAAAVQWAER |
| Ga0070717_100187864 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MACVVEGRKRALVMAASILAARKRAQFDGGKRVPAALSAISDAVGRAKEF* |
| Ga0075023_1000352773 | 3300006041 | Watersheds | VDEGRKRVLLIAAAILAARKLAQYDGGKRVPATIIAR* |
| Ga0075017_1016816142 | 3300006059 | Watersheds | MITPYVDEGRKRVLLIAASILAARKLAQFDGGKKVPATVSA |
| Ga0070716_1003351491 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEARKRLLGIMAAILAARKLANYDSVRRVPATESAIADAVRWAADGNWR |
| Ga0075014_1007624252 | 3300006174 | Watersheds | LILVDEGRKRVLLIAASILAARRLAQYEPGKRVPATICAITD |
| Ga0070765_1002381661 | 3300006176 | Soil | AQMDESRKRVIGVMAAILAARKLAQRDGGKRVPATVDAISDAVRWRTKS* |
| Ga0075021_110968782 | 3300006354 | Watersheds | VDEGRKRVLLIAASILAARKLAQYDSGARIPATVSAVADAVRWA |
| Ga0066665_104485422 | 3300006796 | Soil | VDEGRKRVLLSAASILAARKLAPYGSEAQVPATISAIADAIR |
| Ga0066665_105722472 | 3300006796 | Soil | VDEGRKRVLLIAASILAARKLAQHGSEAQVPATISAIADA |
| Ga0073928_100307013 | 3300006893 | Iron-Sulfur Acid Spring | MKEENRVLLIAASILAARKLAQCDGSKALPATVAAISDALRWG* |
| Ga0075436_1008670731 | 3300006914 | Populus Rhizosphere | VDEGRKRVLLIATAILAARRLPQYEPTKLVPATAS |
| Ga0066710_1033880051 | 3300009012 | Grasslands Soil | MDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIAVRGCD |
| Ga0099829_100656553 | 3300009038 | Vadose Zone Soil | VDESRKRVILIAASILAARKLAQYDGGKRVPATMSAIADAIRWAEEIMK* |
| Ga0099829_110556431 | 3300009038 | Vadose Zone Soil | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADAIR |
| Ga0099828_108308152 | 3300009089 | Vadose Zone Soil | VDEGRKRVLLIAASILAARKLAQYDGGRRVPATISA |
| Ga0066709_1032667862 | 3300009137 | Grasslands Soil | VDEGRKRVLLIAASILAARKLAQYGSEAQVPATICAVADAI* |
| Ga0105241_112208601 | 3300009174 | Corn Rhizosphere | VDESRKRVIAIMASILAAQKLAQHDGGKRVPATMSAIADAV |
| Ga0116218_10819981 | 3300009522 | Peatlands Soil | VDEGRKRVLLIAASILAARKLAQFDGGKRVPATISAIADAVRWAEEI |
| Ga0116225_13089272 | 3300009524 | Peatlands Soil | MDEPRKRVIGIMAAILAARKLAQYEGGTRVPATISAISDQMG* |
| Ga0116119_10353673 | 3300009629 | Peatland | VDEGCKRVLLIAASILAARKLAQFEGGKRVPATMSAIADAVRWA |
| Ga0116110_11821292 | 3300009643 | Peatland | MRESPVDEGRKRVLLIAASILAARKLAQYDSGARVPA |
| Ga0116121_13109531 | 3300009644 | Peatland | VDEGRKRVLLIAASILAARKLAPYDGGKRVPATVAAIADAVRWLRR* |
| Ga0116135_10722312 | 3300009665 | Peatland | VDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAIAHTVQVG* |
| Ga0116217_105704952 | 3300009700 | Peatlands Soil | MDEGRKRVLLIAASILAARKLAQYEGGKRVPATVAAIS |
| Ga0116101_11662481 | 3300009759 | Peatland | VDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAA |
| Ga0116134_10395583 | 3300009764 | Peatland | MDEGRRRVLLIAASILAARKLAQYDSGARVPATVAA |
| Ga0116219_103976752 | 3300009824 | Peatlands Soil | MDESRKRVIGIMAAILAARKLAQFDGGARVPATIMAIGDAVRWAEQI |
| Ga0134084_103895961 | 3300010322 | Grasslands Soil | VIKLSFVDEGRKRVLLIAASILAARKLAQYGSEAQVPATISAIAD |
| Ga0074045_102002533 | 3300010341 | Bog Forest Soil | MDEGRKRVLGIMAAILAARKLAQYDGGKRVPATVSAISDAISWAE |
| Ga0074045_105015332 | 3300010341 | Bog Forest Soil | MDEGRKRVLLIASSILAARKLAQFDGGKRVPATVSAIADAVRWAA* |
| Ga0074045_110432741 | 3300010341 | Bog Forest Soil | MDEGRKRVLLIAASILAARKLAQYDGGTRVPATVSAVADAIQWAE |
| Ga0074044_104011611 | 3300010343 | Bog Forest Soil | LIAASILAARKLAQYDSGARVPATVSAIADAVRWYATVP* |
| Ga0126370_103389102 | 3300010358 | Tropical Forest Soil | VDEGRKPVLLIAASILAARKLAQYDSGARVPATVAAVSDAIRG |
| Ga0126370_112443191 | 3300010358 | Tropical Forest Soil | MDEGRKRVLLIAASILAARKLAQLEGGPTGRTPATVSAV |
| Ga0126378_105116521 | 3300010361 | Tropical Forest Soil | VDEGRKRVLLIAAAILASRKLAQYSSTPRIPATVSAIA |
| Ga0126379_126274061 | 3300010366 | Tropical Forest Soil | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVGAISDAIR |
| Ga0136449_1027114821 | 3300010379 | Peatlands Soil | MDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADAIRWAERIMEE |
| Ga0137388_119666861 | 3300012189 | Vadose Zone Soil | VDEGRKRVLMIAASILAARKLANYDGGKRVPATMSAIADAVR |
| Ga0137363_100693931 | 3300012202 | Vadose Zone Soil | MDKGRKRVLLIAASILAARKLAQFEGGKRVPATLSAIAVRWARVWVDNKV |
| Ga0137399_104656382 | 3300012203 | Vadose Zone Soil | VDKGRKRVLLIAASILAARKLAQFEGGKRVPATLSAIADSVR* |
| Ga0137380_101318703 | 3300012206 | Vadose Zone Soil | MDEARKRVLGIMAAILAARKLAQYDSGTRVPATISAIGDAIRWAE |
| Ga0137376_101493523 | 3300012208 | Vadose Zone Soil | VDEGRKRVLLIAASILAARKMAQYEGGARVPATICAIADAVRWAE |
| Ga0137387_101178646 | 3300012349 | Vadose Zone Soil | VDEGRKRVILIAASILAARKLAQYDGGKRVPATMCAIADTRYAGQKK* |
| Ga0137371_106880802 | 3300012356 | Vadose Zone Soil | VDEGRKRVLLIAASILAARKLAQYGNEAQVPATICAIADSI |
| Ga0137361_110439981 | 3300012362 | Vadose Zone Soil | KLHSLDKSRKRVLLIAASILAARKLAQYDGGKRV* |
| Ga0137416_121592261 | 3300012927 | Vadose Zone Soil | MLNSLVDESRKRVIGIMASILAARKLANYDGGKRVPAT |
| Ga0137404_101476824 | 3300012929 | Vadose Zone Soil | VDESRKRVLAIMASILAARKLAQYDDGKRVSATICAIADAVRWAE |
| Ga0134076_106261711 | 3300012976 | Grasslands Soil | MEGEGGKLPSVDEGRKRVLLIAASILAARKLAQHGSEAQVPATICAIADAIRW |
| Ga0157378_102735931 | 3300013297 | Miscanthus Rhizosphere | VEEGRKRVIGIMAAILAARTLAQFDSGARVPATINAIADAV |
| Ga0157378_105718412 | 3300013297 | Miscanthus Rhizosphere | MEEGRKRVIGIMAAILAARTLAQFDSGARVPATINAIADAV |
| Ga0157378_105883052 | 3300013297 | Miscanthus Rhizosphere | VEEGRKRVIGIMAAILAARTLAQFDSGARVPATINA |
| Ga0157372_109185882 | 3300013307 | Corn Rhizosphere | VDEGRKRVLLIAASILAARKLSQYDGGRRIPATISAIADAIRWAEEILRE |
| Ga0181518_102612081 | 3300014156 | Bog | MDEGRKRVLLIAASILAARKLAQFDGGKRVPATMSAIA |
| Ga0182015_101639752 | 3300014495 | Palsa | MDEGRKRVIGIMAAILAARKLAQYDGGKRVPATVAAIADAVRLG* |
| Ga0182015_108491851 | 3300014495 | Palsa | MDEGRKRVLLIAASILAARKLAQYDSGARVPATVSA |
| Ga0182024_100626256 | 3300014501 | Permafrost | MDEGRKRVIGVMAAILAARKLAQWDGGKRVPATVAANCGRGTMG* |
| Ga0182024_104440942 | 3300014501 | Permafrost | MDEGRKRVLRIAASILAARKLAQFDGGKRVPATVAAISDAVRWAENHASD* |
| Ga0181536_102954161 | 3300014638 | Bog | MDEDRKRVLLIAACILAARKLAQYDGGKRVPATVAAI |
| Ga0181536_103623791 | 3300014638 | Bog | VICVDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAISDSVRW |
| Ga0181522_108379372 | 3300014657 | Bog | MDEGRKRVLGIMAAILAARKLAQYDGGKRIPATVA |
| Ga0182030_111962782 | 3300014838 | Bog | VDEGRKRVLLIAASILAARKLAQHDGGKRVPATVAAISDAV |
| Ga0157379_102013832 | 3300014968 | Switchgrass Rhizosphere | MDEGRKRVIAIMASILAARKLSQYDSGARVPATINAIADAVRWAERI |
| Ga0137403_104127251 | 3300015264 | Vadose Zone Soil | ARVDESRKRVIGIMASILAARKLAQYDGGKRVPATMSAIADAGQWETNYVA* |
| Ga0132258_118696591 | 3300015371 | Arabidopsis Rhizosphere | KRVLLIAASILAARKLAQYDSGARVPATVSAIADAIRC* |
| Ga0132255_1036290492 | 3300015374 | Arabidopsis Rhizosphere | VDEGRKRVIGIMAAILAAGKLAQYDSGSRVPVTINAIADAVRWAERIMEE |
| Ga0182036_100020218 | 3300016270 | Soil | VDESRKRVLLIAASILAARKLAQFDGGKRVPATVSAIA |
| Ga0182037_103255012 | 3300016404 | Soil | VDAGRKRVVLIAASILAARKLAQFDGGKKVPATISAIADAVRWAEAKS |
| Ga0163161_119769891 | 3300017792 | Switchgrass Rhizosphere | MDEGRKRVIAIMASILAARKLSQFDSSARVPATINAIADAVRWAER |
| Ga0187802_103752591 | 3300017822 | Freshwater Sediment | VLLIAASILAARKLAPYDGGKRAPATVSAIADTIRWAEEIMR |
| Ga0187818_103220291 | 3300017823 | Freshwater Sediment | VDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAISDSIRW |
| Ga0187856_11492582 | 3300017925 | Peatland | MDEGRKRVLLIAASILAARRLAQFEGGARVPATICAISDSIRWAEEIMG |
| Ga0187849_13801621 | 3300017929 | Peatland | VDEGRKRVLLIAASILAARKLAQFEGGKRVPATMSAFANA |
| Ga0187849_13945161 | 3300017929 | Peatland | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVAAIADAVR |
| Ga0187848_100677071 | 3300017935 | Peatland | MPNSMDEGRKRVLLIAASILAARRLAQFEGGARVPATICAISDSIRWAEEIMG |
| Ga0187853_103612671 | 3300017940 | Peatland | VICVDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADAVRWAER |
| Ga0187850_103312102 | 3300017941 | Peatland | MDDGREGRKRVIGIMAAILAARKLAQFDGGARVPA |
| Ga0187819_101351621 | 3300017943 | Freshwater Sediment | MGEGRKRVLLIAASILAARKLAQFDGGREVPASDRNRG |
| Ga0187819_108673462 | 3300017943 | Freshwater Sediment | MLNVDEGRKRVLLIAASILAARKLSQFDGGKRVPATISAMSDAVRWQKKS |
| Ga0187847_104384591 | 3300017948 | Peatland | MDEGRKRVLLIAASILGARKLAQYDSGARVPATVSAIADSIRWAERI |
| Ga0187847_105973292 | 3300017948 | Peatland | VLLIAASILAARKLAPYDGGKRVPATVAAIADAVRWLRR |
| Ga0187817_100331652 | 3300017955 | Freshwater Sediment | MDEGRKRVLLIAASILAARKLAQYDGGVRVPATISAIADSVRWPEGNSEGD |
| Ga0187817_110082371 | 3300017955 | Freshwater Sediment | EGRKRVIGVMAAILAARKLSQYDSGARVPATVSAIADAIR |
| Ga0187878_13508542 | 3300018005 | Peatland | MPGSMDEGRKRVLLIAASILAARKLAQFDGGARVPATICAVSD |
| Ga0187805_100202831 | 3300018007 | Freshwater Sediment | VDEGRKRVLLIAASILAARKLAQYEGGKRVPATVSAIAD |
| Ga0187874_100151292 | 3300018019 | Peatland | MPNSMDEGRKRVLLIAAAILASRKLAQFEGRARVPATICAITDSFRS |
| Ga0187864_102608261 | 3300018022 | Peatland | MDESRKRVIGIMAAILAARKLAQYDGGARVPATITAIADAIR |
| Ga0187869_104033051 | 3300018030 | Peatland | MDEGRKRVLLIAASILAARRLAQFEGGARVPATICAISDS |
| Ga0187867_102181161 | 3300018033 | Peatland | MDEGRKRVLLIAASILGARKLAQYDSGARVPATVSAIADGVRWAERIME |
| Ga0187883_104670591 | 3300018037 | Peatland | VDEGRKRVLLIAASILAARKLSQYDSGARVPATVSAIADGVRWAERIME |
| Ga0187862_101159963 | 3300018040 | Peatland | VDEGRKRVLLIAASILAARKLAQYEGGKRVPATVAAIS |
| Ga0187862_108004571 | 3300018040 | Peatland | MDESRKRVLLIAAAILAARKLASFDGGKRVPATVAAISDA |
| Ga0187871_104636341 | 3300018042 | Peatland | MDEGRKRVLLIAASILAARKLAPYDGGKRVPATVAAIADAVRWLRR |
| Ga0187858_108347501 | 3300018057 | Peatland | MDEGRKRVLVIAASILAARTLAQYDSGARIPATVSAIADAVRW |
| Ga0187784_105882753 | 3300018062 | Tropical Peatland | MNEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAISD |
| Ga0187852_10790963 | 3300019082 | Peatland | MDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAI |
| Ga0182025_13140963 | 3300019786 | Permafrost | MDEGRKRVIGVMAAILAARKLAQWDGGKRVPATVAANCGRGTMG |
| Ga0210403_100436181 | 3300020580 | Soil | VDEGRKRVLLIAASILAARKLAQFEGGKRVSATLSAI |
| Ga0210399_1000127716 | 3300020581 | Soil | MDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADAVPVGRTNNGRN |
| Ga0210395_109391952 | 3300020582 | Soil | VDEGRKPVLLIAASILVSRKLAQYGPGKRIPATMCAVADAIRWAEEIYGRD |
| Ga0210405_113502851 | 3300021171 | Soil | VDEGRKRVLVIAACILAARKLAQFNGGKRVPATMSAIADAVRWAE |
| Ga0210383_115429171 | 3300021407 | Soil | MDEGRKRLLIAASILASRKLAQYEGARKVPATVSAIAD |
| Ga0210384_103902671 | 3300021432 | Soil | VDEGRKRVILIAASILAARKLAQFDGGKRVPATISAMADAVRW |
| Ga0210410_112969271 | 3300021479 | Soil | MDEGRKRVLLIAASILAARKLSAYESGTRVPATVAAISDAVRWAEEI |
| Ga0126371_102732892 | 3300021560 | Tropical Forest Soil | MDEGRKRVLLIAASILAARKLAQYDGGKRVPATIGAISDAVRWAEEI |
| Ga0126371_125491801 | 3300021560 | Tropical Forest Soil | MLSSRVDEGRTRVLLIAASILAARKLAQFDGGRRVPAT |
| Ga0212123_100328323 | 3300022557 | Iron-Sulfur Acid Spring | MKEENRVLLIAASILAARKLAQCDGSKALPATVAAISDALRWG |
| Ga0224554_11275691 | 3300023068 | Soil | MDEGRKRVLLVAASILAARRLAQYEGGARVPATICAITDSIRW |
| Ga0208036_10492652 | 3300025419 | Peatland | VDEGCKRVLLIAASILAARKLAQFEGGKRVPATMSAIAD |
| Ga0208455_10235324 | 3300025453 | Peatland | MTSQAGLQMPGTMDEGRKRVLLIAASILAARKLAQFDGGARVPATICAISDAIRWAE |
| Ga0208691_10448652 | 3300025612 | Peatland | EGRKRVLLIAASILAARKLAQYDGGKRVPATVAAIAHTVQVG |
| Ga0207684_101156672 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEGRKRVLLIAASILAARKLFHFDSGARVPATVSAIADAIPSGQRGF |
| Ga0207684_104457481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEGRKRVLLIAASIPAARKLAQHDAGARVPATICAIADS |
| Ga0207691_111702001 | 3300025940 | Miscanthus Rhizosphere | MEEGRKRVIGIMAAILAARTLAQFDSGSRVPATINAIADAVRWAEGIFE |
| Ga0207787_10265102 | 3300026908 | Tropical Forest Soil | VDEGRKRVLLIAAGILAARKLAQLDGGKRVPATVSAIAD |
| Ga0207761_11056681 | 3300027516 | Tropical Forest Soil | MDESRKRVLLIAASILAARKLAQFESGRRVPATISAIADAVRWAEEIRRD |
| Ga0208324_10089231 | 3300027604 | Peatlands Soil | MIRLAGVDEGRKRVLLIAASILAARKLAQFDGGKRLPATMSAIADAVR |
| Ga0209465_105109791 | 3300027874 | Tropical Forest Soil | MDESRKRVLGIMAAILAARKLAQYDGPARVPATIYAIED |
| Ga0209624_107617692 | 3300027895 | Forest Soil | VYDASVDEGRKRVIGVIAAILAARKLAQWDGGKRVPATVTAISDAVRW |
| Ga0209006_100635066 | 3300027908 | Forest Soil | VLLIAASILAARKLAQYDSGARVPATVSAIADAIR |
| Ga0209526_103223532 | 3300028047 | Forest Soil | MDEGRKRVLLIAASILAARKLAQYDSGTRVPATISAIGDAIRWAEQI |
| Ga0268266_107603742 | 3300028379 | Switchgrass Rhizosphere | MDEGRKRVIAIMASILAARKLAQFDSSARVPATISAIVDAVRWAERIFEE |
| Ga0222749_100009001 | 3300029636 | Soil | VDEGRKRVLLIAASILAARKLAQFDGGKRVPATMSAIADAVR |
| Ga0222749_100224441 | 3300029636 | Soil | VVEGRKRVLLIAASILAARKLAQFDGGKRVPATMSAIADAVR |
| Ga0302182_100603451 | 3300030054 | Palsa | MDEGRKRVIGVMAAILAARKLAQWDGGKRVPATVAAIADAVRWAEEIM |
| Ga0302313_102413871 | 3300030693 | Palsa | MDEGRKRVILIAATILAARKLSPFDGGKRVPATVAAISDAVRWAEAIM |
| Ga0302180_101984973 | 3300031028 | Palsa | VDEGRKRVMLIAASILAARKLAQYDSGARVPATVAAI |
| Ga0302324_1032274221 | 3300031236 | Palsa | MNEGRKRTLLIAAAILAARKLAQYEGGARVPATIMAVENA |
| Ga0302326_132939171 | 3300031525 | Palsa | MDEGRKRVLLIAASILAARKLAQYDSGARVPATVSAIADS |
| Ga0310686_1171828432 | 3300031708 | Soil | MDEGRKRVLLIAASILAARKLAPYEGGTRVPATVSAIA |
| Ga0307469_108563523 | 3300031720 | Hardwood Forest Soil | ATLHSVDESRKRVLGIMASILAARKLANYDGGKRVPATMSAIADAIRWADEGN |
| Ga0307473_107002972 | 3300031820 | Hardwood Forest Soil | VDEGRKRVLLIAASILAARKLAQYDSGARVPATVAAVADAVPW |
| Ga0306925_103558661 | 3300031890 | Soil | MDEGRKRVLLIAASILAARKLAQIPAEPRSPAYQATIY |
| Ga0318533_100235021 | 3300032059 | Soil | HVDEGRKRVLLIAASILAARKLAQFDGGKRVPATVSAIADAVRWGRGNPEGD |
| Ga0311301_111682392 | 3300032160 | Peatlands Soil | MDEPRKRVIGIMAAILAARKLAQYEGGTRVPATISAISDQMG |
| Ga0307471_1000655032 | 3300032180 | Hardwood Forest Soil | VDEGRKRVMLIAASILAARKLAQYDSGARVPATVRAIADASGGQSG |
| Ga0307471_1039396601 | 3300032180 | Hardwood Forest Soil | VDESRKRVLLIAASILAARKLAQYDGGKRVPATMSAIAGAVHWAEEI |
| Ga0307472_1008397071 | 3300032205 | Hardwood Forest Soil | VDESRKRVIGIMASILAARKLAQYDGGKRVPATISAIADAVR |
| Ga0335085_103100302 | 3300032770 | Soil | MDEGRKRVLLIAACILAARKLSQYEGGKRVPATVAAILMLYAGQKK |
| Ga0335079_114959492 | 3300032783 | Soil | VDEGRKRVIGVMAAILAARKLAQWDGGKRVPATVAAIADAVR |
| Ga0335079_116917111 | 3300032783 | Soil | MDEGRKRPIGVMAAILAARKLAPHDGGKRVPATVVAISGAVRWAEAI |
| Ga0335079_119589401 | 3300032783 | Soil | MDEGRKRVIGIMAAILAARKLCQYDGGRMVPATVSAISD |
| Ga0335078_118801242 | 3300032805 | Soil | VDEGRKRVIGVMAAILAARKLAQWDGGKRVPATVA |
| Ga0335078_122074453 | 3300032805 | Soil | VDEARKRVLLIAASILAARKLSQYEGGTHMPATVGAIADSIRW |
| Ga0335081_115590291 | 3300032892 | Soil | MDEGRKRVLLIAASILAARKLAQYDGGKRVPATVAAISDAIRWAEEIMLE |
| Ga0335071_111930181 | 3300032897 | Soil | MDEGRKRVLLIAASILAARKFSQFDGGKKVPATVS |
| Ga0335077_115614631 | 3300033158 | Soil | MDEGRKRVLLIAASILAARKLAQYDSGARTPATVSAIADG |
| Ga0371490_11490071 | 3300033561 | Peat Soil | MDEDRKRVLLIAASILAARKLAQFDGGKRVPATMSA |
| Ga0371488_0280176_1_105 | 3300033983 | Peat Soil | MDESRKRVLGIMAAILAARKLAQYDGGRRVPATVA |
| ⦗Top⦘ |