


| Basic Information | |
|---|---|
| Family ID | F035898 |
| Family Type | Metagenome |
| Number of Sequences | 171 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MRWLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.22 % |
| % of genes near scaffold ends (potentially truncated) | 26.32 % |
| % of genes from short scaffolds (< 2000 bps) | 74.85 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.076 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.468 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.825 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 5.19% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00216 | Bac_DNA_binding | 32.75 |
| PF02585 | PIG-L | 12.28 |
| PF02518 | HATPase_c | 7.02 |
| PF02738 | MoCoBD_1 | 5.85 |
| PF00072 | Response_reg | 3.51 |
| PF13414 | TPR_11 | 2.92 |
| PF08281 | Sigma70_r4_2 | 2.34 |
| PF11799 | IMS_C | 2.34 |
| PF01323 | DSBA | 1.75 |
| PF01186 | Lysyl_oxidase | 1.75 |
| PF12681 | Glyoxalase_2 | 1.75 |
| PF01040 | UbiA | 1.17 |
| PF00106 | adh_short | 0.58 |
| PF04365 | BrnT_toxin | 0.58 |
| PF01925 | TauE | 0.58 |
| PF00343 | Phosphorylase | 0.58 |
| PF04392 | ABC_sub_bind | 0.58 |
| PF08028 | Acyl-CoA_dh_2 | 0.58 |
| PF05598 | DUF772 | 0.58 |
| PF12441 | CopG_antitoxin | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF13510 | Fer2_4 | 0.58 |
| PF12833 | HTH_18 | 0.58 |
| PF04134 | DCC1-like | 0.58 |
| PF02566 | OsmC | 0.58 |
| PF14559 | TPR_19 | 0.58 |
| PF01740 | STAS | 0.58 |
| PF13714 | PEP_mutase | 0.58 |
| PF00355 | Rieske | 0.58 |
| PF08349 | DUF1722 | 0.58 |
| PF00528 | BPD_transp_1 | 0.58 |
| PF00210 | Ferritin | 0.58 |
| PF01988 | VIT1 | 0.58 |
| PF04545 | Sigma70_r4 | 0.58 |
| PF12867 | DinB_2 | 0.58 |
| PF13185 | GAF_2 | 0.58 |
| PF02322 | Cyt_bd_oxida_II | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 32.75 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 12.28 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.58 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.58 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.58 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.58 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.58 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.58 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.58 |
| COG3272 | Uncharacterized conserved protein YbgA, DUF1722 family | Function unknown [S] | 0.58 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.08 % |
| Unclassified | root | N/A | 2.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17290777 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 2199352025|deepsgr__Contig_61019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2897 | Open in IMG/M |
| 2228664022|INPgaii200_c1011038 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300001661|JGI12053J15887_10481734 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300002120|C687J26616_10060937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
| 3300002908|JGI25382J43887_10430796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300003994|Ga0055435_10150738 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300003995|Ga0055438_10024425 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300003995|Ga0055438_10043850 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300004009|Ga0055437_10040064 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300004019|Ga0055439_10290690 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300004267|Ga0066396_10005062 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300004268|Ga0066398_10188925 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300004633|Ga0066395_10122427 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300004633|Ga0066395_10266986 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005166|Ga0066674_10542903 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005174|Ga0066680_10751734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300005176|Ga0066679_10035088 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300005181|Ga0066678_10274125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1097 | Open in IMG/M |
| 3300005181|Ga0066678_10634765 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005186|Ga0066676_10936975 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005332|Ga0066388_100653258 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300005332|Ga0066388_102091391 | Not Available | 1018 | Open in IMG/M |
| 3300005332|Ga0066388_105573295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300005332|Ga0066388_108147760 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005332|Ga0066388_108258984 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005354|Ga0070675_100999745 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005445|Ga0070708_100191109 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300005445|Ga0070708_100241708 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300005445|Ga0070708_100266326 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005446|Ga0066686_10165502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1468 | Open in IMG/M |
| 3300005446|Ga0066686_10587572 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005447|Ga0066689_10016203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3544 | Open in IMG/M |
| 3300005467|Ga0070706_100347368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1383 | Open in IMG/M |
| 3300005471|Ga0070698_100439985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
| 3300005536|Ga0070697_100211556 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300005552|Ga0066701_10065870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2038 | Open in IMG/M |
| 3300005558|Ga0066698_10001602 | All Organisms → cellular organisms → Bacteria | 10011 | Open in IMG/M |
| 3300005558|Ga0066698_10341681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300005713|Ga0066905_100000987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9200 | Open in IMG/M |
| 3300005713|Ga0066905_100341943 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300005764|Ga0066903_100045425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5260 | Open in IMG/M |
| 3300005764|Ga0066903_100602952 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300005764|Ga0066903_100606875 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300005764|Ga0066903_100719982 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300005764|Ga0066903_102744530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
| 3300005764|Ga0066903_106326922 | Not Available | 618 | Open in IMG/M |
| 3300006173|Ga0070716_101379037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300006755|Ga0079222_12070946 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006852|Ga0075433_10526278 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300006854|Ga0075425_100002761 | All Organisms → cellular organisms → Bacteria | 17618 | Open in IMG/M |
| 3300006854|Ga0075425_101067988 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006854|Ga0075425_102096095 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006871|Ga0075434_101760720 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006904|Ga0075424_100096309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3117 | Open in IMG/M |
| 3300006904|Ga0075424_100477265 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300009038|Ga0099829_10000942 | All Organisms → cellular organisms → Bacteria | 15569 | Open in IMG/M |
| 3300009038|Ga0099829_10047882 | All Organisms → cellular organisms → Bacteria | 3152 | Open in IMG/M |
| 3300009089|Ga0099828_10570808 | Not Available | 1019 | Open in IMG/M |
| 3300009090|Ga0099827_10086445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2462 | Open in IMG/M |
| 3300009792|Ga0126374_10005430 | All Organisms → cellular organisms → Bacteria | 4489 | Open in IMG/M |
| 3300009792|Ga0126374_10038662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2316 | Open in IMG/M |
| 3300009792|Ga0126374_10320990 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300009792|Ga0126374_10377305 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300009792|Ga0126374_10945927 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010043|Ga0126380_10113590 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300010043|Ga0126380_10388813 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1031 | Open in IMG/M |
| 3300010043|Ga0126380_10482820 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300010046|Ga0126384_10010641 | All Organisms → cellular organisms → Bacteria | 5713 | Open in IMG/M |
| 3300010046|Ga0126384_10372188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1197 | Open in IMG/M |
| 3300010047|Ga0126382_10056258 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300010047|Ga0126382_11276092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300010048|Ga0126373_10214416 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300010048|Ga0126373_11011607 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 897 | Open in IMG/M |
| 3300010358|Ga0126370_10685490 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 898 | Open in IMG/M |
| 3300010359|Ga0126376_10148253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1875 | Open in IMG/M |
| 3300010359|Ga0126376_10409909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1224 | Open in IMG/M |
| 3300010360|Ga0126372_11450003 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010361|Ga0126378_10793821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300010366|Ga0126379_12397502 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010376|Ga0126381_105111846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300010391|Ga0136847_11608403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 651 | Open in IMG/M |
| 3300010391|Ga0136847_12757988 | Not Available | 578 | Open in IMG/M |
| 3300010398|Ga0126383_10517089 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300011269|Ga0137392_10538414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300011270|Ga0137391_10190501 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300011271|Ga0137393_10055018 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
| 3300012096|Ga0137389_10092607 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300012096|Ga0137389_11001478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
| 3300012202|Ga0137363_10000337 | All Organisms → cellular organisms → Bacteria | 26414 | Open in IMG/M |
| 3300012204|Ga0137374_10057824 | All Organisms → cellular organisms → Bacteria | 3924 | Open in IMG/M |
| 3300012206|Ga0137380_10183341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1903 | Open in IMG/M |
| 3300012207|Ga0137381_10030494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4348 | Open in IMG/M |
| 3300012209|Ga0137379_10064509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3525 | Open in IMG/M |
| 3300012209|Ga0137379_10843146 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012349|Ga0137387_10267200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1235 | Open in IMG/M |
| 3300012350|Ga0137372_10164238 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300012350|Ga0137372_10234808 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300012359|Ga0137385_10033889 | All Organisms → cellular organisms → Bacteria | 4581 | Open in IMG/M |
| 3300012359|Ga0137385_10217654 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300012362|Ga0137361_11049099 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012363|Ga0137390_10002414 | All Organisms → cellular organisms → Bacteria | 14785 | Open in IMG/M |
| 3300012532|Ga0137373_10576955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300012532|Ga0137373_11210011 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012582|Ga0137358_11040732 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012685|Ga0137397_10001654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15605 | Open in IMG/M |
| 3300012927|Ga0137416_10444113 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300012929|Ga0137404_10009649 | All Organisms → cellular organisms → Bacteria | 6645 | Open in IMG/M |
| 3300012929|Ga0137404_10360767 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300014269|Ga0075302_1012980 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300014269|Ga0075302_1138586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300015241|Ga0137418_10815610 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300015358|Ga0134089_10096278 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300018075|Ga0184632_10361538 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300018077|Ga0184633_10022170 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300018431|Ga0066655_10547305 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300018433|Ga0066667_11016647 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018482|Ga0066669_10247603 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300019458|Ga0187892_10000362 | All Organisms → cellular organisms → Bacteria | 120906 | Open in IMG/M |
| 3300019487|Ga0187893_10059929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3733 | Open in IMG/M |
| 3300019487|Ga0187893_10109836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2387 | Open in IMG/M |
| 3300020170|Ga0179594_10155949 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300021080|Ga0210382_10510017 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021560|Ga0126371_10218600 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300021560|Ga0126371_11244589 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025549|Ga0210094_1020166 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300025569|Ga0210073_1004255 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300025910|Ga0207684_10029758 | All Organisms → cellular organisms → Bacteria | 4649 | Open in IMG/M |
| 3300025910|Ga0207684_10522905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1016 | Open in IMG/M |
| 3300025910|Ga0207684_10700089 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300025922|Ga0207646_10018219 | All Organisms → cellular organisms → Bacteria | 6554 | Open in IMG/M |
| 3300026089|Ga0207648_10730107 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300026326|Ga0209801_1272352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
| 3300026332|Ga0209803_1199511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300026334|Ga0209377_1213296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300026351|Ga0257170_1041442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300026377|Ga0257171_1103936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300026497|Ga0257164_1074659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300026497|Ga0257164_1090254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300027846|Ga0209180_10031483 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
| 3300027846|Ga0209180_10750043 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027846|Ga0209180_10786046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300027874|Ga0209465_10009911 | All Organisms → cellular organisms → Bacteria | 4224 | Open in IMG/M |
| 3300027875|Ga0209283_10098922 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300028047|Ga0209526_10197544 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300031231|Ga0170824_111074293 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300031469|Ga0170819_16095155 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031549|Ga0318571_10013179 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300031668|Ga0318542_10099129 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300031681|Ga0318572_10044902 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300031736|Ga0318501_10000775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8587 | Open in IMG/M |
| 3300031740|Ga0307468_100601849 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300031740|Ga0307468_101088695 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031740|Ga0307468_102022784 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031740|Ga0307468_102078630 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031770|Ga0318521_10192667 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031796|Ga0318576_10388114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300031897|Ga0318520_10583629 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031947|Ga0310909_10297086 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300031965|Ga0326597_10219637 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300032068|Ga0318553_10093166 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300032770|Ga0335085_10042768 | All Organisms → cellular organisms → Bacteria | 6196 | Open in IMG/M |
| 3300032782|Ga0335082_11663803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300032829|Ga0335070_10000355 | All Organisms → cellular organisms → Bacteria | 53141 | Open in IMG/M |
| 3300032829|Ga0335070_10009210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11585 | Open in IMG/M |
| 3300032954|Ga0335083_10209097 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300033004|Ga0335084_10436424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1347 | Open in IMG/M |
| 3300033233|Ga0334722_10973581 | Not Available | 598 | Open in IMG/M |
| 3300033432|Ga0326729_1008882 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300033805|Ga0314864_0168721 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033807|Ga0314866_063403 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.43% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.17% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.17% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.17% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01226330 | 2088090014 | Soil | MRLLAGLLLVAALLAGCAGWSQTPYNPQQACDSVGGVLTRDGRCLTGNM |
| deepsgr_00764230 | 2199352025 | Soil | MRLLAGLLLVAALLAGCAGWSQTPYNPQQACDIVGGVLTRDGRCLAGNL |
| INPgaii200_10110382 | 2228664022 | Soil | MRGLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL |
| JGI12053J15887_104817341 | 3300001661 | Forest Soil | VGVFLGAVLVAAALLGGCAGWLDTPYNPQQACDSVGGTLLSDGRCLGGG |
| C687J26616_100609373 | 3300002120 | Soil | MRLVVGVLLVAAVLLWVRRVSQTPYNPQQACDIVGDFLTADGRCLAGNS* |
| JGI25382J43887_104307961 | 3300002908 | Grasslands Soil | PSSLPRVPMVEVTDMRILLGAVLVVAMFMSGCAGWSQTPFSERQSCDAVGGRLTSDGRCLAGSQ* |
| Ga0055435_101507382 | 3300003994 | Natural And Restored Wetlands | MRFVAGVLLVAAALLGGCAGWSQTPYNPQQACDGVGGYLTTDGRCIAGN* |
| Ga0055438_100244254 | 3300003995 | Natural And Restored Wetlands | VVPVRLLLGGLLAAATLLGGCAGWSRTPYNPQQACDIVGGRLAADGRCLAGN* |
| Ga0055438_100438502 | 3300003995 | Natural And Restored Wetlands | MGWLAVLLLAAALLGGCAGWSQTPYNPQQACDSVGGFLTADGRCLAGN* |
| Ga0055437_100400642 | 3300004009 | Natural And Restored Wetlands | MRFVAGVLMVAAALLGGCAGWAQTPYSPQQACDAVGGRLAPDGRCRAGN* |
| Ga0055439_102906902 | 3300004019 | Natural And Restored Wetlands | MRLLAGVLLVVALPLAGCAGWSQTPYNPQLACDSVGGTLTSDGRCLAGN* |
| Ga0066396_100050623 | 3300004267 | Tropical Forest Soil | MRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGR |
| Ga0066398_101889252 | 3300004268 | Tropical Forest Soil | MRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0066395_101224273 | 3300004633 | Tropical Forest Soil | MRWLGGLLLVAALCGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0066395_102669863 | 3300004633 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0066674_105429032 | 3300005166 | Soil | VGVFLGAVLVAAALLGGCAGWLDTPYNPQQACDSVGGTLLSDGRCLGGGM* |
| Ga0066680_107517342 | 3300005174 | Soil | MVEVTDMRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGSQ |
| Ga0066679_100350884 | 3300005176 | Soil | MRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGRLTSDGRCLAGSQ* |
| Ga0066678_102741253 | 3300005181 | Soil | MRILLGAVLVVAMLMSGCAGWSQTPFSERQACDAVGGWLTSDRRCLAGSQ* |
| Ga0066678_106347652 | 3300005181 | Soil | VGVFLGAVLVAAALLGGCAGWLDTPYNPQQACASVGGTLLSDGRCLGGGM* |
| Ga0066676_109369751 | 3300005186 | Soil | MRVFLGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN* |
| Ga0066388_1006532583 | 3300005332 | Tropical Forest Soil | MQVLLVMMLLAAALTAGCGISSTPYNGQQACDIVGGRYTPDGRCLAGNS* |
| Ga0066388_1020913911 | 3300005332 | Tropical Forest Soil | MRVILGMLLVAGALLGGCASWPQTPNNGRQACDIVGGFYTADGRCIAGNT* |
| Ga0066388_1055732951 | 3300005332 | Tropical Forest Soil | RWLAGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNL* |
| Ga0066388_1081477602 | 3300005332 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLTGNT* |
| Ga0066388_1082589842 | 3300005332 | Tropical Forest Soil | MRWMAGVLLFAVALTGGCAGWSQTPYNPQQACDSAGGVLTADGRCLAGNL* |
| Ga0070675_1009997452 | 3300005354 | Miscanthus Rhizosphere | MRLLAGLLLVAALLTGCAGWSQTPYNPQQACDIVGGVLTRDGRCLAGNL* |
| Ga0070708_1001911092 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIVGAVIGLTMLLGGCAGWSQTPFNGRQACDAVGGEYTSDGRCLAGNL* |
| Ga0070708_1002417083 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLAGLLLVAALLGGCAGWSQTPFNPKQACDAVGGMLTADGRCLGGNL* |
| Ga0070708_1002663263 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVFLGAVLVVAVLLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN* |
| Ga0066686_101655022 | 3300005446 | Soil | MVEGTDMRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGSQ* |
| Ga0066686_105875722 | 3300005446 | Soil | MRWLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL* |
| Ga0066689_100162033 | 3300005447 | Soil | MRILLGAVLVVAMLMSGCAGWSQTAFSERQSCDAVGGWLTSDGRCLAGSQ* |
| Ga0070706_1003473683 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIVLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGNQ* |
| Ga0070698_1004399851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARLRAVLVAAILLGGCAGWSQTPFNGRQACDAVAGEYTSDGRCLAGNQ* |
| Ga0070697_1002115564 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLAGLLLVVAVLLGGCAGWSQTPYNPQQACDIVGGTLTSDGRCLAGN* |
| Ga0066701_100658703 | 3300005552 | Soil | MRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGSQ* |
| Ga0066698_100016025 | 3300005558 | Soil | MVEVTDMRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGRLTSDGRCLAGSQ* |
| Ga0066698_103416813 | 3300005558 | Soil | MRWLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLA |
| Ga0066905_1000009876 | 3300005713 | Tropical Forest Soil | MRWMAGVLLFAVALTGGCAGWSQTPYNPQQACDSAAGVLTADGRCLAGNL* |
| Ga0066905_1003419432 | 3300005713 | Tropical Forest Soil | MRWLGGLLLVATLCGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNL* |
| Ga0066903_1000454256 | 3300005764 | Tropical Forest Soil | VRIALWLVLAASVLLGGCAGWTGTPYNGQQACDIVGGIYTPDGRCQAGNN* |
| Ga0066903_1006029522 | 3300005764 | Tropical Forest Soil | MRLARLGLGALLAAAALLAGCGLPQTPYNGQQACDAVGGMYTADGRCLAGNS* |
| Ga0066903_1006068753 | 3300005764 | Tropical Forest Soil | MQVLLVVMLLAAALTAGCGISSTPYNGQQACDIVGGRYTPDGRCLAGNS* |
| Ga0066903_1007199821 | 3300005764 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCL |
| Ga0066903_1027445303 | 3300005764 | Tropical Forest Soil | MRLARLGLAAVLAAAALLAGCGLPQTPYNGQQACDAVGGIYTADGRCQAGNN* |
| Ga0066903_1063269222 | 3300005764 | Tropical Forest Soil | MRVILGMLLVAGALLGGCASWPQTPYNGRQACDIVGGSYTADGRCIAGNT* |
| Ga0070716_1013790371 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLAGLLLVAALLAGCAGWSQTPYNPQQACDIVGGVLTRDGRCLAGNL* |
| Ga0079222_120709462 | 3300006755 | Agricultural Soil | MRWLAGGLLLTAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNI* |
| Ga0075433_105262782 | 3300006852 | Populus Rhizosphere | MRGLAGLLLVGALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL* |
| Ga0075425_10000276111 | 3300006854 | Populus Rhizosphere | MRWLAGGLLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNI* |
| Ga0075425_1010679882 | 3300006854 | Populus Rhizosphere | MRIIVGAVIGLAMLLGGCAGWSQTPFNGRQACDAVGGEYTSDGRCLAGNM* |
| Ga0075425_1020960951 | 3300006854 | Populus Rhizosphere | LVPMRVFLGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN* |
| Ga0075434_1017607202 | 3300006871 | Populus Rhizosphere | MRILLGAVLVAAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGSQ* |
| Ga0075424_1000963092 | 3300006904 | Populus Rhizosphere | MRILLGAAVLVAAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGSQ* |
| Ga0075424_1004772653 | 3300006904 | Populus Rhizosphere | MRGLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL* |
| Ga0099829_100009428 | 3300009038 | Vadose Zone Soil | MSLLAAMLAAAALCGGCAGWSQTPYNPQQACDIVGGTLTADGRCLAGN* |
| Ga0099829_100478824 | 3300009038 | Vadose Zone Soil | MRIIVGAVIGLAMALGGCAGWSQTPFNGRQACDAVGGEYTSDGRCLAGNM* |
| Ga0099828_105708081 | 3300009089 | Vadose Zone Soil | PTRLPLGVVLAAPALVGGCAGWSQTPYNPQQACDIVGGRLTADGR* |
| Ga0099827_100864453 | 3300009090 | Vadose Zone Soil | MRMSLLAAMLAAAALCGGCAGWSQTPYNPQQACDIVGGTLTADGRCLAGN* |
| Ga0126374_100054306 | 3300009792 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLTGNM* |
| Ga0126374_100386622 | 3300009792 | Tropical Forest Soil | MRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126374_103209902 | 3300009792 | Tropical Forest Soil | MRLLFAALLAAAALAGGCSGLPQTPYDGSLSCTSIGGTYTADGRCLAGNT* |
| Ga0126374_103773051 | 3300009792 | Tropical Forest Soil | MRWLGGLLLLAALCGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0126374_109459272 | 3300009792 | Tropical Forest Soil | MRWLVVMLLLAAASTAGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126380_101135903 | 3300010043 | Tropical Forest Soil | MRWLAGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLTGNM* |
| Ga0126380_103888133 | 3300010043 | Tropical Forest Soil | MRWLVVMLLLAAASTAGCAGWSQTPYNPQQACDSVGGVLTVDGRCLAGNM* |
| Ga0126380_104828202 | 3300010043 | Tropical Forest Soil | MRWLAGLVFLTAVLAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0126384_100106413 | 3300010046 | Tropical Forest Soil | MRWLAGVLLFAVALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126384_103721883 | 3300010046 | Tropical Forest Soil | MRMRWLTGLALLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126382_100562581 | 3300010047 | Tropical Forest Soil | MRWLAGLALLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126382_112760921 | 3300010047 | Tropical Forest Soil | ARRSSRMRWLAGLVFLTAVLAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0126373_102144162 | 3300010048 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNL* |
| Ga0126373_110116071 | 3300010048 | Tropical Forest Soil | GVLLFAAALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNL* |
| Ga0126370_106854901 | 3300010358 | Tropical Forest Soil | MRWLAGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM* |
| Ga0126376_101482531 | 3300010359 | Tropical Forest Soil | MRIVLGAVLMAAMLMAGCAGWSQTPFNGRQSCDAVGGTYTSDGRCLAGNQ* |
| Ga0126376_104099092 | 3300010359 | Tropical Forest Soil | MRMRWLARLVFLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126372_114500032 | 3300010360 | Tropical Forest Soil | MRWLGGVLLFAAALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNL* |
| Ga0126378_107938211 | 3300010361 | Tropical Forest Soil | MRMRWLAGLMLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCL |
| Ga0126379_123975022 | 3300010366 | Tropical Forest Soil | MRWRLGVLLFAVALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0126381_1051118461 | 3300010376 | Tropical Forest Soil | GLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM* |
| Ga0136847_116084032 | 3300010391 | Freshwater Sediment | MRFVAVVLLAAAALLGGCAGWSQTPYNPQQACDAVGGRLTADGRCLAGSM* |
| Ga0136847_127579882 | 3300010391 | Freshwater Sediment | VLAAAALLGGCAGWSQTPYNPQQACDIVGGFLTADGRCKAGD* |
| Ga0126383_105170893 | 3300010398 | Tropical Forest Soil | MRLARLGLAAILAAAALLAGCGLPQTPYNGQQACDAVGGIYTADGRC |
| Ga0137392_105384143 | 3300011269 | Vadose Zone Soil | MRVFLGAVLVAAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN* |
| Ga0137391_101905012 | 3300011270 | Vadose Zone Soil | MRILLGAVLMVVMLMAGCAGWSQTPFNARQSCDAVGGWYTSDGRCRAGN* |
| Ga0137393_100550185 | 3300011271 | Vadose Zone Soil | MRILLGAVLMVVMLMAGCAGWSQTPFNARQSCDAVGGWYTSDGRCRAG |
| Ga0137389_100926072 | 3300012096 | Vadose Zone Soil | MRILLGAVLMVVMLMAGCAGWSQTPFNARQSCDAVGGWYTPDGRCRAGN* |
| Ga0137389_110014782 | 3300012096 | Vadose Zone Soil | MRIIVGAVIGLAMALGGCTGWSQTPFNGRQACDAVGGEYTSDGRCLAGNM* |
| Ga0137363_1000033712 | 3300012202 | Vadose Zone Soil | MSLLVGVLLAAALLGGCAGWSQTPYNPEQACDGGVLTSDGRCLAGNI* |
| Ga0137374_100578242 | 3300012204 | Vadose Zone Soil | LLAGVLLVAALLGGCAGWSQTPYNPQQACDAVAGTLTRDGRCLAGNM* |
| Ga0137380_101833413 | 3300012206 | Vadose Zone Soil | MRMILLAAMLAAAALCGGCAGWSQTPYNPQQACDIVGGTLTADGRCLAGN* |
| Ga0137381_100304943 | 3300012207 | Vadose Zone Soil | MPLLAGVLLLVVAGLLGGCAGWSQTPYNPQQACDIVGGTLTRDGRCLAGNS* |
| Ga0137379_100645095 | 3300012209 | Vadose Zone Soil | MPLLAGVLLVVAGLLGGCAGWSQTPYNPQQACDIVGGTLTRDGRCLAGNS* |
| Ga0137379_108431461 | 3300012209 | Vadose Zone Soil | MRVFLGAVLVVAVLLGGCAGWSQTPYNPQQACDIVGGTLTADGRCLAGN* |
| Ga0137387_102672002 | 3300012349 | Vadose Zone Soil | MPLLAGVLLVVAWLLGGCAGWSQTPYNPQQACDIVGGTLTRDGRCLAGNS* |
| Ga0137372_101642382 | 3300012350 | Vadose Zone Soil | MPLLAGVLLVAALLGGCAGWSQTPYNPQQACDIVGGTLTRDGRCLAGNS* |
| Ga0137372_102348082 | 3300012350 | Vadose Zone Soil | MRVLLGAVLAAAALLAGCAGWSQTPYNGRQACESVGGIYTADERCLAGNI* |
| Ga0137385_100338894 | 3300012359 | Vadose Zone Soil | MVEVTDMRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGRFTSDGRCLAGSQ* |
| Ga0137385_102176541 | 3300012359 | Vadose Zone Soil | LLVVAGLLGGCAGWSQTPYNPQQACDIVGGTLTRDGRCLAGNS* |
| Ga0137361_110490992 | 3300012362 | Vadose Zone Soil | VGVFLGAVLVAAAWLGGRAGWLDTPYNPQQACDSVGGTLLSDGRCLGGGM* |
| Ga0137390_100024146 | 3300012363 | Vadose Zone Soil | MRVILGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN* |
| Ga0137373_105769552 | 3300012532 | Vadose Zone Soil | MPLLAGVLLVAGLLGGCAGWSQTPYNPQQACDIVGGTLTSDGRCLAGNS* |
| Ga0137373_112100112 | 3300012532 | Vadose Zone Soil | MRVLLGAVLAAAALLAGCAGWSQTPYNGRQACESVGGIYTADERCLAG |
| Ga0137358_110407322 | 3300012582 | Vadose Zone Soil | MRLVAGLSFVAALLGGCAGWSQTPYNPQQACDIVGGTLTGDGRCLAGNM* |
| Ga0137397_1000165419 | 3300012685 | Vadose Zone Soil | MRILLGAVLMVAMLMSGCAGWSQTPFNERQSCDAVGGWLTSDGRCLTGSQ* |
| Ga0137416_104441132 | 3300012927 | Vadose Zone Soil | MRILLGAVLVVAMLMSGCAGWSQTPFNERQSCDAVGGWLTSDGRCLTGSQ* |
| Ga0137404_100096496 | 3300012929 | Vadose Zone Soil | MPLLAGVLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTSDGRCLAGNL* |
| Ga0137404_103607671 | 3300012929 | Vadose Zone Soil | MRIIVGAVIGLAMLLGGCAGWSQTPFNGRQACDAVGGEYTSD |
| Ga0075302_10129801 | 3300014269 | Natural And Restored Wetlands | MGWLAVLLLAAALLGGCAGWSQTPYNPQQACDSVGGFLTADGRCLA |
| Ga0075302_11385861 | 3300014269 | Natural And Restored Wetlands | GVLLILALPLAGCAGWSQTPYNPQLACDSVGGTLTSDGRCLAGN* |
| Ga0137418_108156101 | 3300015241 | Vadose Zone Soil | ILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCRAGN* |
| Ga0134089_100962783 | 3300015358 | Grasslands Soil | MRGLAGLLLVATLLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL* |
| Ga0184632_103615383 | 3300018075 | Groundwater Sediment | MRVLLGAVLIAAVLLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRC |
| Ga0184633_100221703 | 3300018077 | Groundwater Sediment | MRLLLGVALTAATLLGGCAGWSQTPYNPQQACDIVGGFLTADGRCKAGN |
| Ga0066655_105473052 | 3300018431 | Grasslands Soil | MRWLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL |
| Ga0066667_110166471 | 3300018433 | Grasslands Soil | VGVFLGAVLVAAALLGGCAGWLDTPYNPQQACDSVGGTLLSDGRCLGGGM |
| Ga0066669_102476033 | 3300018482 | Grasslands Soil | RVFLGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN |
| Ga0187892_1000036218 | 3300019458 | Bio-Ooze | MRALLGVVLLVAAFAGGCADLSQTPYNGRLACESVGGRYTADGRCLAGNS |
| Ga0187893_100599292 | 3300019487 | Microbial Mat On Rocks | MSATRVLLGVVLLVAAFAGGCAELSQTPYNGRLACESVGGRYTADGRCLAGNS |
| Ga0187893_101098363 | 3300019487 | Microbial Mat On Rocks | MRVLLGVGLLVAAIAGGCADLSQTPYNGRLACESVGGRYTADGRCLAGNS |
| Ga0179594_101559492 | 3300020170 | Vadose Zone Soil | MPLLAGVLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTSDGRCLAGNL |
| Ga0210382_105100171 | 3300021080 | Groundwater Sediment | MRFVAGVLLVAAALLGGCAGWSQTPYNPQQACDAVGGRLTSDLRCLAGNS |
| Ga0126371_102186003 | 3300021560 | Tropical Forest Soil | MRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0126371_112445892 | 3300021560 | Tropical Forest Soil | MRWLAGVLLFAVALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0210094_10201662 | 3300025549 | Natural And Restored Wetlands | MGWLAVLLLAAALLGGCAGWSQTPYNPQQACDSVGGFLTADGRCLAGN |
| Ga0210073_10042553 | 3300025569 | Natural And Restored Wetlands | MGWLAVLLLAAALLGGCAGWSQTPYNPQQACDSVGGFLTADGRCLAATRCRGGA |
| Ga0207684_100297585 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIVGAVIGLTMLLGGCAGWSQTPFNGRQACDAVGGEYTSDGRCLAGNL |
| Ga0207684_105229052 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVFLGAVLVVAVLLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN |
| Ga0207684_107000893 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLAGLLLVAALLGGCAGWSQTPFNPKQACDAVGGMLTADGRCLGGNL |
| Ga0207646_100182191 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRLGVVLVAAILLGGCAGWSQTPFNGRQACDAVAGEYTSDGRCLAGNQ |
| Ga0207648_107301073 | 3300026089 | Miscanthus Rhizosphere | MRLLAGLLLVAALLTGCAGWSQTPYNPQQACDIVGGVLTRDGRCL |
| Ga0209801_12723521 | 3300026326 | Soil | MRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGR |
| Ga0209803_11995112 | 3300026332 | Soil | MPRVPMVEGTDMRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAVGGWLTSDGRCLAGS |
| Ga0209377_12132961 | 3300026334 | Soil | MRILLGAVLVVAMLMSGCAGWSQTPFSERQSCDAV |
| Ga0257170_10414421 | 3300026351 | Soil | WVFLGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN |
| Ga0257171_11039362 | 3300026377 | Soil | MPLLAGVLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTSDGRCLAGNM |
| Ga0257164_10746592 | 3300026497 | Soil | SASRALFPMRVFLGAVLVVAILLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAGNN |
| Ga0257164_10902541 | 3300026497 | Soil | MVEVTNMRILLGGVLVVAMLMSGCAGWSQTPFNERQSCDAVGGWLTSDGRCLAGSQ |
| Ga0209180_100314834 | 3300027846 | Vadose Zone Soil | MRIIVGAVIGLAMALGGCAGWSQTPFNGRQACDAVGGEYTSDGRCLAGNM |
| Ga0209180_107500431 | 3300027846 | Vadose Zone Soil | MRMSLLAAMLAAAALCGGCAGWSQTPYNPQQACDIVGGTLTADGRCLAGN |
| Ga0209180_107860462 | 3300027846 | Vadose Zone Soil | MRILLGAVLMVVMLMAGCAGWSQTPFNARQSCDAVGGWYTSDGRCRAGN |
| Ga0209465_100099113 | 3300027874 | Tropical Forest Soil | MRWLVGVLLFAVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM |
| Ga0209283_100989221 | 3300027875 | Vadose Zone Soil | MRIIVGAVIGLAMALGGCAGWSQTPFNGRQACDAVGGEYTSD |
| Ga0209526_101975441 | 3300028047 | Forest Soil | MRIMVGAVIGLAMLLGGCAGWSQTPFNGQQACDAVGGEYTSDGRCLAGNV |
| Ga0170824_1110742931 | 3300031231 | Forest Soil | LLAGLLLVAALLGGCAGWSQTPYNPQQACDIVGGVLTRDGR |
| Ga0170819_160951551 | 3300031469 | Forest Soil | MRLLAGLFLVAALLGGCAGWSQTPYNPQQACDIVGGVLTRDGRCLAGNL |
| Ga0318571_100131791 | 3300031549 | Soil | PVVAPRRRMRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0318542_100991293 | 3300031668 | Soil | WLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0318572_100449023 | 3300031681 | Soil | MRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0318501_100007751 | 3300031736 | Soil | AGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0307468_1006018491 | 3300031740 | Hardwood Forest Soil | MKTLLAALLIAALLLGGCAGWSQTPYNPQQACDIVGGTLTYDGRC |
| Ga0307468_1010886951 | 3300031740 | Hardwood Forest Soil | MRVLLGAVLIAAVLLGGCAGWSQTPYNPQQFCDSVGGTLTSDGRCLAG |
| Ga0307468_1020227841 | 3300031740 | Hardwood Forest Soil | MKTLLAALLVAVVLLGGCAGWSQTPYNPQQACDIVGGTLTYDGRCLAGN |
| Ga0307468_1020786302 | 3300031740 | Hardwood Forest Soil | LLVAALLGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL |
| Ga0318521_101926673 | 3300031770 | Soil | RPVVAPRRRMRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGN |
| Ga0318576_103881141 | 3300031796 | Soil | RRRMRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0318520_105836291 | 3300031897 | Soil | MRWLAGVLLVGVALAGGCAGWSQTPYNPRQACDIVGGVLTADGRCLAGNM |
| Ga0310909_102970861 | 3300031947 | Soil | RWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0326597_102196371 | 3300031965 | Soil | MGFVAGVLLAAAALLGGCAGWSQTPYNPQQACDIVGGSLTADGRCLAGNS |
| Ga0318553_100931663 | 3300032068 | Soil | RMRMRWLAGLVLLAAALAGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0335085_100427683 | 3300032770 | Soil | MRWLGALLVAATLCGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0335082_116638032 | 3300032782 | Soil | MRVLLGMVLLAAALTAGCAGIPSTPYNGQQACDIVGGRYTADGRCLAGNS |
| Ga0335070_1000035525 | 3300032829 | Soil | MRWLAGLLAASALLGGCAGWSQTPYNPQQACDIVGGSLTADGRCLAGN |
| Ga0335070_100092103 | 3300032829 | Soil | MRWLGALLMAATLCGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNL |
| Ga0335083_102090973 | 3300032954 | Soil | MRWLGALLMAATLCGGCAGWSQTPYNPQQACDIVGGVLTADGRCLAGNM |
| Ga0335084_104364242 | 3300033004 | Soil | RHRPMRLVAGALLAAAVLLAGCAGWSQTPYNPQQACDIVGGRLAADGRCLAGN |
| Ga0334722_109735812 | 3300033233 | Sediment | MRLVAGLLLTAAAVLGGCAGWSQTPYNPQQACDIVGGRLTSDGRCLAGNL |
| Ga0326729_10088823 | 3300033432 | Peat Soil | MRWLAGLLAASALLGGCAGWSQTPYNPQQACDIVGGFLTADGRCLAGN |
| Ga0314864_0168721_414_563 | 3300033805 | Peatland | RLFLAALLAAAALAGGCAGMPQTPYDGSLSCTSIGGIYTADGRCLAGNV |
| Ga0314866_063403_493_621 | 3300033807 | Peatland | MRWLAVILVAAALCCGGCAGWSQTPYNPQQACDIVGGVLTADG |
| ⦗Top⦘ |