


| Basic Information | |
|---|---|
| Family ID | F035775 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MARKVVRTYVKPKRKSHPHSKNASVGQTGYKKKYKGQGR |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.79 % |
| % of genes near scaffold ends (potentially truncated) | 13.45 % |
| % of genes from short scaffolds (< 2000 bps) | 63.74 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.556 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.901 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.006 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.041 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 29.82 |
| PF01510 | Amidase_2 | 10.53 |
| PF12518 | DUF3721 | 9.36 |
| PF00166 | Cpn10 | 2.92 |
| PF04466 | Terminase_3 | 1.75 |
| PF00118 | Cpn60_TCP1 | 1.17 |
| PF04860 | Phage_portal | 1.17 |
| PF11325 | DUF3127 | 0.58 |
| PF05766 | NinG | 0.58 |
| PF02018 | CBM_4_9 | 0.58 |
| PF03382 | DUF285 | 0.58 |
| PF00856 | SET | 0.58 |
| PF11351 | GTA_holin_3TM | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.92 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.75 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.56 % |
| All Organisms | root | All Organisms | 44.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10006480 | Not Available | 7018 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10015948 | All Organisms → Viruses → Predicted Viral | 4066 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10033607 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2461 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10065100 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300000947|BBAY92_10008714 | All Organisms → Viruses → Predicted Viral | 2690 | Open in IMG/M |
| 3300000947|BBAY92_10201730 | All Organisms → Viruses | 517 | Open in IMG/M |
| 3300000947|BBAY92_10210922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300001965|GOS2243_1081637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 5967 | Open in IMG/M |
| 3300002231|KVRMV2_100098519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4755 | Open in IMG/M |
| 3300002231|KVRMV2_100117064 | All Organisms → cellular organisms → Bacteria | 11244 | Open in IMG/M |
| 3300002231|KVRMV2_100170782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300002231|KVRMV2_101273456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1252 | Open in IMG/M |
| 3300002483|JGI25132J35274_1052309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 880 | Open in IMG/M |
| 3300003474|NAP4_1003529 | Not Available | 2523 | Open in IMG/M |
| 3300003477|nap3_10118924 | Not Available | 634 | Open in IMG/M |
| 3300003645|NAP1_1055446 | Not Available | 538 | Open in IMG/M |
| 3300005057|Ga0068511_1001054 | All Organisms → Viruses | 2674 | Open in IMG/M |
| 3300005057|Ga0068511_1001392 | Not Available | 2441 | Open in IMG/M |
| 3300005057|Ga0068511_1057471 | Not Available | 648 | Open in IMG/M |
| 3300005837|Ga0078893_11364141 | Not Available | 1228 | Open in IMG/M |
| 3300006027|Ga0075462_10073214 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300006413|Ga0099963_1001081 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300006735|Ga0098038_1002030 | All Organisms → Viruses | 8705 | Open in IMG/M |
| 3300006735|Ga0098038_1010407 | All Organisms → Viruses → Predicted Viral | 3651 | Open in IMG/M |
| 3300006735|Ga0098038_1019231 | All Organisms → Viruses → Predicted Viral | 2608 | Open in IMG/M |
| 3300006735|Ga0098038_1117907 | Not Available | 904 | Open in IMG/M |
| 3300006735|Ga0098038_1126513 | Not Available | 865 | Open in IMG/M |
| 3300006735|Ga0098038_1191633 | Not Available | 665 | Open in IMG/M |
| 3300006735|Ga0098038_1198805 | Not Available | 649 | Open in IMG/M |
| 3300006737|Ga0098037_1002617 | Not Available | 7846 | Open in IMG/M |
| 3300006737|Ga0098037_1012613 | Not Available | 3254 | Open in IMG/M |
| 3300006737|Ga0098037_1247944 | Not Available | 572 | Open in IMG/M |
| 3300006749|Ga0098042_1000108 | All Organisms → Viruses | 28787 | Open in IMG/M |
| 3300006749|Ga0098042_1013217 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
| 3300006789|Ga0098054_1168897 | Not Available | 804 | Open in IMG/M |
| 3300006802|Ga0070749_10015133 | All Organisms → Viruses → Predicted Viral | 4911 | Open in IMG/M |
| 3300006802|Ga0070749_10758513 | Not Available | 516 | Open in IMG/M |
| 3300006803|Ga0075467_10010603 | All Organisms → cellular organisms → Bacteria | 6125 | Open in IMG/M |
| 3300006810|Ga0070754_10511505 | Not Available | 516 | Open in IMG/M |
| 3300006810|Ga0070754_10530824 | Not Available | 504 | Open in IMG/M |
| 3300006810|Ga0070754_10532491 | Not Available | 503 | Open in IMG/M |
| 3300006916|Ga0070750_10491053 | Not Available | 504 | Open in IMG/M |
| 3300006919|Ga0070746_10267048 | Not Available | 794 | Open in IMG/M |
| 3300006919|Ga0070746_10452872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
| 3300006928|Ga0098041_1197287 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 644 | Open in IMG/M |
| 3300006929|Ga0098036_1056674 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300006929|Ga0098036_1244025 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 543 | Open in IMG/M |
| 3300006929|Ga0098036_1256683 | Not Available | 528 | Open in IMG/M |
| 3300007231|Ga0075469_10059806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300007345|Ga0070752_1173270 | Not Available | 874 | Open in IMG/M |
| 3300007540|Ga0099847_1111504 | Not Available | 828 | Open in IMG/M |
| 3300008218|Ga0114904_1123120 | All Organisms → Viruses | 619 | Open in IMG/M |
| 3300009034|Ga0115863_1049839 | Not Available | 5395 | Open in IMG/M |
| 3300009130|Ga0118729_1018963 | All Organisms → Viruses → Predicted Viral | 4798 | Open in IMG/M |
| 3300009413|Ga0114902_1005120 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4933 | Open in IMG/M |
| 3300009481|Ga0114932_10011173 | All Organisms → Viruses | 6841 | Open in IMG/M |
| 3300009488|Ga0114925_10003215 | Not Available | 8464 | Open in IMG/M |
| 3300009488|Ga0114925_10010519 | Not Available | 5088 | Open in IMG/M |
| 3300009550|Ga0115013_10146298 | All Organisms → Viruses | 1381 | Open in IMG/M |
| 3300009593|Ga0115011_10007363 | Not Available | 7391 | Open in IMG/M |
| 3300009593|Ga0115011_10016688 | Not Available | 4875 | Open in IMG/M |
| 3300009593|Ga0115011_10332208 | Not Available | 1164 | Open in IMG/M |
| 3300009677|Ga0115104_10665175 | Not Available | 659 | Open in IMG/M |
| 3300009790|Ga0115012_10984434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 696 | Open in IMG/M |
| 3300009794|Ga0105189_1013697 | Not Available | 752 | Open in IMG/M |
| 3300010148|Ga0098043_1011132 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2972 | Open in IMG/M |
| 3300010148|Ga0098043_1017795 | All Organisms → Viruses → Predicted Viral | 2301 | Open in IMG/M |
| 3300010148|Ga0098043_1057290 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300010149|Ga0098049_1104907 | All Organisms → Viruses | 883 | Open in IMG/M |
| 3300010330|Ga0136651_10107281 | Not Available | 1468 | Open in IMG/M |
| 3300010430|Ga0118733_100486540 | Not Available | 2450 | Open in IMG/M |
| 3300011127|Ga0151665_1003406 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1237 | Open in IMG/M |
| 3300011127|Ga0151665_1093404 | Not Available | 682 | Open in IMG/M |
| 3300012528|Ga0129352_10811589 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2500 | Open in IMG/M |
| 3300012919|Ga0160422_10859552 | Not Available | 583 | Open in IMG/M |
| 3300012920|Ga0160423_10001196 | All Organisms → Viruses | 21742 | Open in IMG/M |
| 3300012920|Ga0160423_10017745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 5379 | Open in IMG/M |
| 3300012920|Ga0160423_10198621 | Not Available | 1398 | Open in IMG/M |
| 3300012920|Ga0160423_10548144 | Not Available | 785 | Open in IMG/M |
| 3300012920|Ga0160423_10648222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 714 | Open in IMG/M |
| 3300012920|Ga0160423_10896127 | Not Available | 595 | Open in IMG/M |
| 3300012954|Ga0163111_10919645 | Not Available | 840 | Open in IMG/M |
| 3300014914|Ga0164311_10175819 | Not Available | 1273 | Open in IMG/M |
| 3300017708|Ga0181369_1036641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300017708|Ga0181369_1118430 | Not Available | 539 | Open in IMG/M |
| 3300017720|Ga0181383_1103336 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 765 | Open in IMG/M |
| 3300017721|Ga0181373_1075057 | Not Available | 602 | Open in IMG/M |
| 3300017727|Ga0181401_1040631 | All Organisms → Viruses | 1303 | Open in IMG/M |
| 3300017727|Ga0181401_1097352 | Not Available | 751 | Open in IMG/M |
| 3300017727|Ga0181401_1108290 | Not Available | 702 | Open in IMG/M |
| 3300017731|Ga0181416_1000431 | Not Available | 10805 | Open in IMG/M |
| 3300017738|Ga0181428_1063285 | Not Available | 863 | Open in IMG/M |
| 3300017743|Ga0181402_1035848 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300017743|Ga0181402_1189647 | Not Available | 512 | Open in IMG/M |
| 3300017752|Ga0181400_1041293 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300017768|Ga0187220_1061768 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300017768|Ga0187220_1201882 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 599 | Open in IMG/M |
| 3300017771|Ga0181425_1278777 | Not Available | 514 | Open in IMG/M |
| 3300017773|Ga0181386_1108439 | Not Available | 863 | Open in IMG/M |
| 3300017951|Ga0181577_10204436 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1318 | Open in IMG/M |
| 3300018416|Ga0181553_10075175 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300018416|Ga0181553_10108750 | Not Available | 1700 | Open in IMG/M |
| 3300018420|Ga0181563_10547655 | All Organisms → Viruses | 647 | Open in IMG/M |
| 3300019699|Ga0193985_1030383 | Not Available | 609 | Open in IMG/M |
| 3300019724|Ga0194003_1041953 | Not Available | 576 | Open in IMG/M |
| 3300019734|Ga0193970_1059050 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 540 | Open in IMG/M |
| 3300019737|Ga0193973_1003242 | Not Available | 1381 | Open in IMG/M |
| 3300019750|Ga0194000_1011143 | Not Available | 1048 | Open in IMG/M |
| 3300020349|Ga0211511_1025729 | Not Available | 1551 | Open in IMG/M |
| 3300020421|Ga0211653_10039391 | Not Available | 2166 | Open in IMG/M |
| 3300020429|Ga0211581_10256154 | Not Available | 711 | Open in IMG/M |
| 3300020436|Ga0211708_10000605 | All Organisms → Viruses | 13345 | Open in IMG/M |
| 3300020436|Ga0211708_10114716 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300020438|Ga0211576_10052857 | All Organisms → Viruses → Predicted Viral | 2318 | Open in IMG/M |
| 3300020438|Ga0211576_10119554 | All Organisms → Viruses | 1443 | Open in IMG/M |
| 3300020438|Ga0211576_10218391 | Not Available | 1010 | Open in IMG/M |
| 3300020446|Ga0211574_10002962 | All Organisms → Viruses | 8853 | Open in IMG/M |
| 3300020446|Ga0211574_10203139 | Not Available | 861 | Open in IMG/M |
| 3300020451|Ga0211473_10003033 | Not Available | 8360 | Open in IMG/M |
| 3300020451|Ga0211473_10007273 | Not Available | 5393 | Open in IMG/M |
| 3300020453|Ga0211550_10027517 | All Organisms → Viruses → Predicted Viral | 2762 | Open in IMG/M |
| 3300020464|Ga0211694_10253234 | Not Available | 732 | Open in IMG/M |
| 3300020466|Ga0211714_10136988 | Not Available | 1196 | Open in IMG/M |
| 3300020469|Ga0211577_10178871 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1410 | Open in IMG/M |
| 3300020469|Ga0211577_10559773 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 686 | Open in IMG/M |
| 3300021335|Ga0213867_1123989 | Not Available | 906 | Open in IMG/M |
| 3300021356|Ga0213858_10332174 | Not Available | 722 | Open in IMG/M |
| 3300021373|Ga0213865_10120099 | Not Available | 1379 | Open in IMG/M |
| 3300021379|Ga0213864_10002327 | Not Available | 8373 | Open in IMG/M |
| 3300021425|Ga0213866_10072389 | All Organisms → Viruses | 1915 | Open in IMG/M |
| 3300021471|Ga0190359_1237606 | Not Available | 582 | Open in IMG/M |
| 3300021484|Ga0190345_1008665 | All Organisms → Viruses | 1514 | Open in IMG/M |
| 3300022061|Ga0212023_1025182 | Not Available | 815 | Open in IMG/M |
| 3300022067|Ga0196895_1007181 | Not Available | 1182 | Open in IMG/M |
| 3300024344|Ga0209992_10001640 | Not Available | 22734 | Open in IMG/M |
| 3300024432|Ga0209977_10000273 | Not Available | 20347 | Open in IMG/M |
| 3300024432|Ga0209977_10010477 | Not Available | 4363 | Open in IMG/M |
| 3300024432|Ga0209977_10038458 | Not Available | 2315 | Open in IMG/M |
| 3300025086|Ga0208157_1028013 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
| 3300025086|Ga0208157_1034247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300025101|Ga0208159_1000146 | Not Available | 28763 | Open in IMG/M |
| 3300025101|Ga0208159_1000591 | Not Available | 14342 | Open in IMG/M |
| 3300025101|Ga0208159_1001516 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 8644 | Open in IMG/M |
| 3300025101|Ga0208159_1010677 | All Organisms → Viruses → Predicted Viral | 2487 | Open in IMG/M |
| 3300025102|Ga0208666_1002332 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 7969 | Open in IMG/M |
| 3300025110|Ga0208158_1000124 | Not Available | 33610 | Open in IMG/M |
| 3300025128|Ga0208919_1257205 | Not Available | 505 | Open in IMG/M |
| 3300025132|Ga0209232_1006594 | Not Available | 5054 | Open in IMG/M |
| 3300025132|Ga0209232_1138510 | Not Available | 788 | Open in IMG/M |
| 3300025151|Ga0209645_1042266 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1631 | Open in IMG/M |
| 3300025251|Ga0208182_1051964 | All Organisms → Viruses | 845 | Open in IMG/M |
| 3300025264|Ga0208029_1026518 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1384 | Open in IMG/M |
| 3300025630|Ga0208004_1080752 | Not Available | 805 | Open in IMG/M |
| 3300025632|Ga0209194_1049142 | Not Available | 1218 | Open in IMG/M |
| 3300025674|Ga0208162_1003086 | All Organisms → Viruses | 8056 | Open in IMG/M |
| 3300025674|Ga0208162_1159815 | Not Available | 609 | Open in IMG/M |
| 3300025759|Ga0208899_1154561 | Not Available | 780 | Open in IMG/M |
| 3300025816|Ga0209193_1061295 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1014 | Open in IMG/M |
| 3300026134|Ga0208815_1037507 | Not Available | 631 | Open in IMG/M |
| 3300027858|Ga0209013_10379570 | Not Available | 788 | Open in IMG/M |
| 3300027859|Ga0209503_10531451 | Not Available | 585 | Open in IMG/M |
| 3300027906|Ga0209404_10011347 | All Organisms → Viruses | 4875 | Open in IMG/M |
| 3300027906|Ga0209404_10045814 | Not Available | 2463 | Open in IMG/M |
| 3300027906|Ga0209404_10462757 | Not Available | 834 | Open in IMG/M |
| 3300028022|Ga0256382_1155595 | Not Available | 548 | Open in IMG/M |
| 3300029309|Ga0183683_1000576 | Not Available | 18880 | Open in IMG/M |
| 3300029309|Ga0183683_1000639 | Not Available | 17407 | Open in IMG/M |
| 3300029309|Ga0183683_1000945 | All Organisms → Viruses | 13127 | Open in IMG/M |
| 3300032011|Ga0315316_10020796 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5038 | Open in IMG/M |
| 3300032011|Ga0315316_11320986 | Not Available | 574 | Open in IMG/M |
| 3300032820|Ga0310342_100260940 | Not Available | 1804 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.90% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.28% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.70% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.60% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.09% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.34% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.34% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.34% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.34% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.92% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.75% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.75% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 1.75% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.75% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.17% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.17% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 1.17% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.17% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.58% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.58% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.58% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.58% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.58% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300003645 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011127 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02 | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019699 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019724 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MG | Environmental | Open in IMG/M |
| 3300019734 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MG | Environmental | Open in IMG/M |
| 3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
| 3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021471 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-2-3_MG | Environmental | Open in IMG/M |
| 3300021484 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-3-4_MG | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300026134 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100064809 | 3300000117 | Marine | MARNVIRAYVKPKRKSHPHSKNASVGQTGYKKQYKGQGR* |
| DelMOWin2010_100159485 | 3300000117 | Marine | MARKIVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| DelMOWin2010_100336073 | 3300000117 | Marine | MARNVVRTYVAPKRKSHPHSKNASVGQNKYKKPYRGQGR* |
| DelMOWin2010_100651002 | 3300000117 | Marine | MPRKVVSTYRKNKRKSHPHSKNASVGQKGYKKKYKGQGR* |
| BBAY92_100087141 | 3300000947 | Macroalgal Surface | MARKVVSVYVKPKKKSHPHSKNASVGQNKYKKKYRGQGR* |
| BBAY92_102017301 | 3300000947 | Macroalgal Surface | MARKIVRTYIKPKRKSHPHSKNASVGQKGYNKKYRGQGR* |
| BBAY92_102109221 | 3300000947 | Macroalgal Surface | LLEMARKIVSVYVKPKRKSHPHSKNASVGQKGYKKKYKGQGR* |
| GOS2243_10816375 | 3300001965 | Marine | MPRKVVSVYIKPKRKSHPHSKNASVGQNKYKKPYRGQGR* |
| KVRMV2_1000985198 | 3300002231 | Marine Sediment | MARKIVSVYVKPKRKSHPHSKNASVGQKGYKKQYRGQGR* |
| KVRMV2_1001170645 | 3300002231 | Marine Sediment | MARRANVVAYKKPKRKSHPHSKNASKGQTGYTKPYIGQGR* |
| KVRMV2_1001707823 | 3300002231 | Marine Sediment | MARKIVSVYIKPKXKSXPXSKNASVGQNKYKKPYKGQGR* |
| KVRMV2_1012734562 | 3300002231 | Marine Sediment | MARNVVKAYIKPKRKSHPHSKNASKGKTGYIKKYRGQGR* |
| JGI25132J35274_10523093 | 3300002483 | Marine | MARNVIKAYIKPKRKSHPHSKNASKGQTGYKKIYKGQGR* |
| NAP4_10035294 | 3300003474 | Estuarine | MPRKVVSTYRQNKRKSHPHSKNASVGKKGYKKKYKGQGR* |
| nap3_101189243 | 3300003477 | Estuarine | SLYLKSFLMPRKVVSTYRQNKRKSHPHSKNASVGKKGYKKKYKGQGR* |
| NAP1_10554462 | 3300003645 | Estuarine | MARKVISVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0068511_10010542 | 3300005057 | Marine Water | MPRKVVSVYIKPKRKSHPHSKNASVGQNGYKKQYRGQGR* |
| Ga0068511_10013924 | 3300005057 | Marine Water | MARRANIVIYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR* |
| Ga0068511_10574712 | 3300005057 | Marine Water | MARKVVTIYKKSKRKSHPHSKNASVGQTGYKKKYRGQGR* |
| Ga0078893_113641412 | 3300005837 | Marine Surface Water | MARKIVSTYIKPKRKSHPHSKNASIGQNGYKKKYRGQGR* |
| Ga0075462_100732142 | 3300006027 | Aqueous | MARNVIRTYVAPKRKSHPHSKNASVGQTGYKKQYRGQGR* |
| Ga0099963_10010813 | 3300006413 | Marine | MARRANVVIYRKPKRKSHPHSKNASRGQTGYVKPYRGQGR* |
| Ga0098038_10020303 | 3300006735 | Marine | MARNVVSVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0098038_10104072 | 3300006735 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQNGYKKKYRGQGR* |
| Ga0098038_10192312 | 3300006735 | Marine | MPKKIVSTYRKNKRKSHPHSKNASVGQKGYKKKYKGQGR* |
| Ga0098038_11179076 | 3300006735 | Marine | MSKLNTSNYQTPKKKSHAHNKNASKGQVGYNKPYRGQGR* |
| Ga0098038_11265132 | 3300006735 | Marine | MARRANVVTFSKRKRKSHPHSKNASVGQTGYKKPYKGQGRNG* |
| Ga0098038_11916333 | 3300006735 | Marine | MARRANVVVYKKKKRKSHPHSKNASVGQTGYKKPYKGQGRNG* |
| Ga0098038_11988052 | 3300006735 | Marine | MARNVVRTYIKPKRKSHPHSKTASVGQTGYKKKYKGQGR* |
| Ga0098037_10026172 | 3300006737 | Marine | MPKKIVSTYRKNKRKSHPHSKNASIGQKGYKKKYKGQGR* |
| Ga0098037_10126136 | 3300006737 | Marine | MARKANVATYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR* |
| Ga0098037_12479442 | 3300006737 | Marine | MARNVVRTYIKPKRKSHPHSKNASVGQTGYKKKYKGQGR* |
| Ga0098042_100010849 | 3300006749 | Marine | MARNVVRKYVKPKRKSHPHSKNASAGKTGYKKKYKGQGR* |
| Ga0098042_10132172 | 3300006749 | Marine | MPRKVVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0098054_11688971 | 3300006789 | Marine | MARKLVSTYTKRKKKSHPHSKNASQGQNGYRKKYRGQGRN |
| Ga0070749_100151333 | 3300006802 | Aqueous | MARKIISTYVKPKRKSHPHSKNASVGQNGYKKQYRGQGR* |
| Ga0070749_107585132 | 3300006802 | Aqueous | MARNVVRTYVAPKRKSHPHSKNASVGQNKYKKQYRGQGR* |
| Ga0075467_100106032 | 3300006803 | Aqueous | MARKANVSTYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR* |
| Ga0070754_105115052 | 3300006810 | Aqueous | MARNVVRVYVKPKRKSHPHSKNASVGQKGYKKQYRGQGR* |
| Ga0070754_105308242 | 3300006810 | Aqueous | MPRKVISVYIKPKRKSHPHSKNASVGQNKYKKQYRGQGR* |
| Ga0070754_105324912 | 3300006810 | Aqueous | MARNVVRTYVKPKRKSHPHSKNASVGQNKYKKPYRGQGR* |
| Ga0070750_104910532 | 3300006916 | Aqueous | MARKIVSVYIKPKRKSHPHSKNASVGQTGYKKQYRGQGR* |
| Ga0070746_102670483 | 3300006919 | Aqueous | MPRKVISVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0070746_104528721 | 3300006919 | Aqueous | KVISVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0098041_11972873 | 3300006928 | Marine | MARRANVVTFSKRKRKSHPHSKNASVGQTGYKKPYKGQGR |
| Ga0098036_10566742 | 3300006929 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQTRYKKKYRGQGR* |
| Ga0098036_12440253 | 3300006929 | Marine | MARNVVKSYVKPKRKSHPHSKNASKGQTGYKKIYRGQGR* |
| Ga0098036_12566832 | 3300006929 | Marine | MARKIVRTYIKPKRKSHPHSKNASKGQTGYNKKYRGQGR* |
| Ga0075469_100598064 | 3300007231 | Aqueous | RKANVSTYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR* |
| Ga0070752_11732702 | 3300007345 | Aqueous | MARNVVRTYVKPKRKSHPHSKNASVGQNKYKKPYTGQGR* |
| Ga0099847_11115042 | 3300007540 | Aqueous | MPRKVISVYIKPKRKSHPHSKNASVGQKGYKKQYRGQGR* |
| Ga0114904_11231201 | 3300008218 | Deep Ocean | VARNVVKAYIKPKRKSHPHSKNASKGQTGYKKIYKGQGR* |
| Ga0115863_10498393 | 3300009034 | Sediment, Intertidal | MARNVVKAYIKPKRKSHPHSKNASKGQTGYKKIYRGQGR* |
| Ga0118729_10189638 | 3300009130 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQNKYKKQYRGQGR* |
| Ga0114902_10051205 | 3300009413 | Deep Ocean | MARNVIKAYIKPKRKSHPHSKNASKGKTGYIKKYRGQGR* |
| Ga0114932_100111735 | 3300009481 | Deep Subsurface | MARKIISTYIKPKRKSHSHSKNASVGQTGYKKKYRGQGR* |
| Ga0114925_1000321518 | 3300009488 | Deep Subsurface | MARRANVVTYVKPKRKSHPHSKNASRGQTGYKKPYKGQGR* |
| Ga0114925_100105195 | 3300009488 | Deep Subsurface | MARRANVVTYRKPKRKSHPHSKNASRGQTGYVKPYRGQGR* |
| Ga0115013_101462982 | 3300009550 | Marine | MARNVVSVYVKPKRKSHPHSKNASVGQNGYKKKYRGQGR* |
| Ga0115011_100073633 | 3300009593 | Marine | MARRANVVVYKKKKRKSHPHSKNASKGQSKYTKPYRGQGR* |
| Ga0115011_100166889 | 3300009593 | Marine | MARRANIVVYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR* |
| Ga0115011_103322082 | 3300009593 | Marine | MARKANVTTYVKPKRKSHPHSKNASRGQTGYTKPYKGQGR* |
| Ga0115104_106651753 | 3300009677 | Marine | MARKANVSTYTKTKRKSHSHNKNASKGQVKYKKKYRGQGR* |
| Ga0115012_109844341 | 3300009790 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQNKYKKQYKGQGR* |
| Ga0105189_10136971 | 3300009794 | Marine Oceanic | MARKVVRTYVKPKRKSHPHSKNASVGQTGYKKKYKGQGR* |
| Ga0098043_10111323 | 3300010148 | Marine | MARNVIRAYVKPKRKSHPHSKNASVGQNKYKKKYRGQGR* |
| Ga0098043_10177953 | 3300010148 | Marine | MARKVVNIYRKNKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0098043_10572903 | 3300010148 | Marine | MPRKVVSIYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0098049_11049072 | 3300010149 | Marine | VARNVVKAYIKPKRKSHPHSKNASKGQTGYKKIYRGQGR* |
| Ga0136651_101072812 | 3300010330 | Marine Hydrothermal Vent | MARKANIVVYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR* |
| Ga0118733_1004865402 | 3300010430 | Marine Sediment | MAARGVASVYTKPKGKSHPHSKNASKGQTGYKKKYRGQGR* |
| Ga0151665_10034062 | 3300011127 | Marine | MARKVVSVYIKPKRKSHPHSKNASVGQKGYKKQYRGQGR* |
| Ga0151665_10934042 | 3300011127 | Marine | MPRKVVSTYRQKKRKSHPHSKNASAGRKGYKKKYKGQGR* |
| Ga0129352_108115896 | 3300012528 | Aqueous | MAKKIVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0160422_108595521 | 3300012919 | Seawater | MARNIVRGYIKPKRKSHPHSKNASVGQNGYKKQYRGQGR* |
| Ga0160423_1000119629 | 3300012920 | Surface Seawater | MARKVVRTYVKPKRKSHPHSKNASAGKTGYKKKYRGQGK* |
| Ga0160423_100177452 | 3300012920 | Surface Seawater | MAKKIVSKYIKSKRKSHPHSKNASIGQTGYKKKYRGQGR* |
| Ga0160423_101986212 | 3300012920 | Surface Seawater | MARKVVNIYIKNKRKSHPHSKNASVGQTGYKKKYKGQGR* |
| Ga0160423_105481443 | 3300012920 | Surface Seawater | MARKVVNIYIKNKRKSHPHSKNASVGQNKYKKPYKGQGR* |
| Ga0160423_106482223 | 3300012920 | Surface Seawater | MARKLVTIYKKSKRKSHPHSKNASVGQTGYKKKYKGQGR* |
| Ga0160423_108961272 | 3300012920 | Surface Seawater | MARKVIRTYVKPKRKSHPHSKNASVGQTGYKKKYRGQGR* |
| Ga0163111_109196452 | 3300012954 | Surface Seawater | MARNIVRTYVAPKRKSHPHSKNASVGQNGYKKQYRGQGR* |
| Ga0164311_101758192 | 3300014914 | Marine Sediment | MARKANIVVYRKPKRKSHPHSKNVSKGQTGYKKKYIGQGR* |
| Ga0181369_10366413 | 3300017708 | Marine | MARKANVATYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR |
| Ga0181369_11184302 | 3300017708 | Marine | MARNVVSVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGRXVKE |
| Ga0181383_11033362 | 3300017720 | Seawater | MARNIVSVYVKPKRKSHPHSKNASVGQTGYKKKYKGQGRXVKE |
| Ga0181373_10750573 | 3300017721 | Marine | MARRANVVVYKKKKRKSHPHSKNASVGQTGYKKPYKG |
| Ga0181401_10406314 | 3300017727 | Seawater | MARKIVSVYVKPKRKSHPHSKNASVGQTGYKKKYKGQGR |
| Ga0181401_10973522 | 3300017727 | Seawater | MARNVVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGRXVKE |
| Ga0181401_11082901 | 3300017727 | Seawater | NVSTYTKTKRKSHSHNKNASKGQVKYKKKYRGQGR |
| Ga0181416_100043110 | 3300017731 | Seawater | MARKANVSTYTKTKRKSHSHNKNASKGQDKYKKKYRGQGR |
| Ga0181428_10632852 | 3300017738 | Seawater | MPRKVVSVYIKPKRKSHPHSKNASVGQTGYKKPYK |
| Ga0181402_10358482 | 3300017743 | Seawater | MARNVVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0181402_11896472 | 3300017743 | Seawater | MARNVISVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGRXVKE |
| Ga0181400_10412932 | 3300017752 | Seawater | MARNIVSVYVKPKRKSHPHSKNASVGQTGYKKKYKGQGR |
| Ga0187220_10617681 | 3300017768 | Seawater | MPRKVVSVYIKPKRKSHPHSKNASVGQTGYKKKYKGQGR |
| Ga0187220_12018822 | 3300017768 | Seawater | VPRKVVSVYIKPKRKSHPHSKNASVGQNGYKKKYKGQGRXKNL |
| Ga0181425_12787772 | 3300017771 | Seawater | MARNIVSVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGRXKNLK |
| Ga0181386_11084391 | 3300017773 | Seawater | MARKANVSTYTKTKRKSHSHNKNASKGQVKYKKKYRGQGRXVN |
| Ga0181577_102044364 | 3300017951 | Salt Marsh | KVVSVYRKAKRKSHPHSKNASKGQNGYTKQYRGQGK |
| Ga0181553_100751753 | 3300018416 | Salt Marsh | MPRKVISTYVKPKRKSHPHSKNASVGQNGYKKQYRGQGR |
| Ga0181553_101087504 | 3300018416 | Salt Marsh | MPRKVVSTYRQKKRKSHPHSKNASVGRKGYKKKYKGQGR |
| Ga0181563_105476553 | 3300018420 | Salt Marsh | RKVISTYVKPKRKSHPHSKNASVGQNGYKKQYRGQGR |
| Ga0193985_10303833 | 3300019699 | Sediment | MPRKVVSTYKKNKRKSHPHSKNASVGQKGYKKKYKGQGR |
| Ga0194003_10419532 | 3300019724 | Sediment | MARKIVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQG |
| Ga0193970_10590502 | 3300019734 | Sediment | MARNVIRVYVKPKRKSHPHSKNASVGQTGYKKQYKGQGR |
| Ga0193973_10032421 | 3300019737 | Sediment | MARNVIRAYVKPKRKSHPHSKNASVGQTGYKKQYRGQGR |
| Ga0194000_10111432 | 3300019750 | Sediment | MARNVIRTYVKPKRKSHPHSKNASVGQTGYKKQYRGQGR |
| Ga0211511_10257293 | 3300020349 | Marine | MARKANVSTYTKTKRKSHSHNKNASKGQVKYKKKYRGQGR |
| Ga0211653_100393914 | 3300020421 | Marine | MARRANVVTFSKRKRKSHPHSKNASVGQTGYKKPYKGQGRNG |
| Ga0211581_102561542 | 3300020429 | Marine | MARRANVVQFRKRKRKSHPHSKNASKGQTGYVKKYIGQGR |
| Ga0211708_1000060514 | 3300020436 | Marine | MARKVIRTYVKPKRKSHPHSKNASVGQKGYKKKYRGQGR |
| Ga0211708_101147161 | 3300020436 | Marine | MARKAVIIYRKNKRKSHPHSKNASVGQKGYKKNIK |
| Ga0211576_100528572 | 3300020438 | Marine | MPKKIVSTYRKNKRKSHPHSKNASIGQKGYKKKYKGQGR |
| Ga0211576_101195544 | 3300020438 | Marine | VPRKVVSVYIKPKRKSHPHSKNASVGQNGYKKKYKGQGR |
| Ga0211576_102183912 | 3300020438 | Marine | MARNVISVYVKPKRKSHPHSKNASVGQTGYKKPYKGQGRXVKE |
| Ga0211574_100029629 | 3300020446 | Marine | MARKVVNIYRKNKRKSHPHSKNASVGQTGYKKKYRGQGR |
| Ga0211574_102031393 | 3300020446 | Marine | MARKVVNIYIKNKRKSHPHSKNASVGQTGYKKKYKGQGRXVKE |
| Ga0211473_1000303313 | 3300020451 | Marine | MARRANVVTYRKPKRKSHPHSKNASRGQSKYKKPYRGQGRNG |
| Ga0211473_100072737 | 3300020451 | Marine | MARKTNVVTYVKPKRKSHPHSKNASKGQTGYTKPYRGQGR |
| Ga0211550_100275173 | 3300020453 | Marine | MARKVISVYVKPKRKSHPHSKNASVGQKGYKKKYKGQGR |
| Ga0211694_102532342 | 3300020464 | Marine | MARKIVRTYIKPKRKSHPHSKNASVGQKGYNKKYRGQGRXKKYVY |
| Ga0211714_101369882 | 3300020466 | Marine | MARKVISVYVKPKKKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0211577_101788711 | 3300020469 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQTGYKKPYKGQGR |
| Ga0211577_105597731 | 3300020469 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0213867_11239892 | 3300021335 | Seawater | MPRKVVSTYRKNKRKSHPHSKNASVGQKGYKKKYKGQGR |
| Ga0213858_103321742 | 3300021356 | Seawater | MPRKVVRVYVKPKRKSHPHSKNASVGQKGYKKQYRGQGRXKNLKHQ |
| Ga0213865_101200993 | 3300021373 | Seawater | MARNVIRTYVAPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0213864_100023275 | 3300021379 | Seawater | MARNIVRAYVKPKRKSHPHSKNASVGQTGYKKTYRGQGR |
| Ga0213866_100723894 | 3300021425 | Seawater | MARNVVRTYVAPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0190359_12376061 | 3300021471 | Hydrothermal Vent Microbial Mat | ANIVVYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR |
| Ga0190345_10086652 | 3300021484 | Hydrothermal Vent Microbial Mat | MARKANIVVYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR |
| Ga0212023_10251822 | 3300022061 | Aqueous | MARKANVSTYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR |
| Ga0196895_10071812 | 3300022067 | Aqueous | MARKIVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0209992_1000164016 | 3300024344 | Deep Subsurface | MARKIISTYIKPKRKSHSHSKNASVGQTGYKKKYRGQGR |
| Ga0209977_1000027320 | 3300024432 | Deep Subsurface | MARRANVVTYVKPKRKSHPHSKNASRGQTGYKKPYKGQGR |
| Ga0209977_100104774 | 3300024432 | Deep Subsurface | MAKKINLQVYRERKRKSHPHNKNASRGQTGYKKKYRGQGR |
| Ga0209977_100384584 | 3300024432 | Deep Subsurface | MARRANVVTYRKPKRKSHPHSKNASRGQTGYVKPYRGQGR |
| Ga0208157_10280132 | 3300025086 | Marine | MARNVIRTYVKPKRKSHPHSKNASVGQNGYKKKYRGQGR |
| Ga0208157_10342475 | 3300025086 | Marine | RKANVATYVKTKRKSHSHNKNASKGQVKYKKKYRGQGR |
| Ga0208159_100014637 | 3300025101 | Marine | MARNVVRKYVKPKRKSHPHSKNASAGKTGYKKKYKGQGR |
| Ga0208159_100059110 | 3300025101 | Marine | MPKKIVSTYRKNKRKSHPHSKNASVGQKGYKKKYKGQGR |
| Ga0208159_10015166 | 3300025101 | Marine | MPRKVVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0208159_10106772 | 3300025101 | Marine | MPRKVVSIYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0208666_10023328 | 3300025102 | Marine | MARNVVSVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0208158_100012429 | 3300025110 | Marine | MARRANVVVYKKKKRKSHPHSKNASVGQTGYKKPYKGQGRNG |
| Ga0208919_12572052 | 3300025128 | Marine | MARKIVRTYIKPKRKSHPHSKNASKGQTGYNKKYRGQGR |
| Ga0209232_10065943 | 3300025132 | Marine | MPRKVVSTYTKNKRKSHPHSKNASVGQKGYKKKYKGQGR |
| Ga0209232_11385102 | 3300025132 | Marine | MARNVVRTYVKPKRKSHPHSKNASVGQTGYKKKYRGQGR |
| Ga0209645_10422662 | 3300025151 | Marine | MPRKVISVYIKPKRKSHPHSKNASVGQTGYKKQYRGQGR |
| Ga0208182_10519642 | 3300025251 | Deep Ocean | MARNVIKAYIKPKRKSHPHSKNASKGKTGYIKKYRGQGR |
| Ga0208029_10265181 | 3300025264 | Deep Ocean | VARNVVKAYIKPKRKSHPHSKNASKGQTGYKKIYKGQGR |
| Ga0208004_10807521 | 3300025630 | Aqueous | MARNVIRTYVAPKRKSHPHSKNASVGQTGYKKQYRGQGR |
| Ga0209194_10491421 | 3300025632 | Pelagic Marine | RRANVVTFSKRKRKSHPHSKNASRGQTGYKKPYKGQGRNG |
| Ga0208162_10030869 | 3300025674 | Aqueous | MARNVVRVYVKPKRKSHPHSKNASVGQKGYKKQYRGQGR |
| Ga0208162_11598152 | 3300025674 | Aqueous | MARKVISVYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0208899_11545612 | 3300025759 | Aqueous | MPRKVVSTYRQNKRKSHPHSKNASVGKKGYKKKYKGQGR |
| Ga0209193_10612953 | 3300025816 | Pelagic Marine | MARRANVVTFSKRKRKSHPHSKNASRGQTGYKKPYKGQGRNG |
| Ga0208815_10375072 | 3300026134 | Marine Oceanic | MARKVVRTYVKPKRKSHPHSKNASVGQTGYKKKYKGQGRXVKE |
| Ga0209013_103795702 | 3300027858 | Marine | MARRANVVAYKKPKRKSHPHSKNASKGQTGYNKKYIGQGR |
| Ga0209503_105314511 | 3300027859 | Marine | MARNVVSVYVKPKRKSHPHSKNASVGQNGYKKKYRGQGR |
| Ga0209404_100113473 | 3300027906 | Marine | MARRANIVVYRKPKRKSHPHSKNASKGQTGYKKKYIGQGR |
| Ga0209404_100458145 | 3300027906 | Marine | MARRANVVVYKKKKRKSHPHSKNASKGQSKYTKPYRGQGR |
| Ga0209404_104627573 | 3300027906 | Marine | MARKANVTTYVKPKRKSHPHSKNASRGQTGYTKPYKGQGR |
| Ga0256382_11555951 | 3300028022 | Seawater | MARRANVVAYKKPKRKSHPHSKNASKGQTGYTKPYIGQGR |
| Ga0183683_100057616 | 3300029309 | Marine | MARKVVRTYVKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0183683_100063910 | 3300029309 | Marine | MPRKVVNVYRKNKRKSHPHSKNASVGQTGYKKKYKGQGRXVKKE |
| Ga0183683_10009451 | 3300029309 | Marine | MPRKVVNVYRKNKRKSHPHSKNASVGQTGYKKKYRGQGR |
| Ga0315316_100207966 | 3300032011 | Seawater | MAKKIVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGR |
| Ga0315316_113209861 | 3300032011 | Seawater | MPRKVVSVYIKPKRKSHPHSKNASVGQNKYKKPYKGQGRXVKE |
| Ga0310342_1002609405 | 3300032820 | Seawater | MARRANVVIYRKPKRKSHPHSKNASRGQTGYVKPYRGQGR |
| ⦗Top⦘ |