


| Basic Information | |
|---|---|
| Family ID | F035718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEG |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.23 % |
| % of genes near scaffold ends (potentially truncated) | 40.35 % |
| % of genes from short scaffolds (< 2000 bps) | 76.02 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.982 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.713 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.596 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.11% β-sheet: 23.68% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 26.32 |
| PF08334 | T2SSG | 4.68 |
| PF00487 | FA_desaturase | 4.09 |
| PF13633 | Obsolete Pfam Family | 2.92 |
| PF03631 | Virul_fac_BrkB | 2.34 |
| PF06348 | DUF1059 | 1.17 |
| PF00076 | RRM_1 | 1.17 |
| PF01027 | Bax1-I | 1.17 |
| PF00166 | Cpn10 | 1.17 |
| PF13544 | Obsolete Pfam Family | 1.17 |
| PF13419 | HAD_2 | 1.17 |
| PF00072 | Response_reg | 0.58 |
| PF16338 | AGL_N | 0.58 |
| PF05598 | DUF772 | 0.58 |
| PF07859 | Abhydrolase_3 | 0.58 |
| PF00213 | OSCP | 0.58 |
| PF07992 | Pyr_redox_2 | 0.58 |
| PF00378 | ECH_1 | 0.58 |
| PF00589 | Phage_integrase | 0.58 |
| PF08031 | BBE | 0.58 |
| PF00528 | BPD_transp_1 | 0.58 |
| PF03994 | DUF350 | 0.58 |
| PF10091 | Glycoamylase | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF03699 | UPF0182 | 0.58 |
| PF07963 | N_methyl | 0.58 |
| PF10604 | Polyketide_cyc2 | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF08245 | Mur_ligase_M | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 26.32 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 4.09 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 4.09 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.34 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.58 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.58 |
| COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 0.58 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.98 % |
| Unclassified | root | N/A | 7.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_45_length_1320_cov_14.577272 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300000571|JGI1358J11329_10022475 | All Organisms → cellular organisms → Bacteria | 3173 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100965220 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300002681|Ga0005471J37259_108341 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300002886|JGI25612J43240_1051737 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300002908|JGI25382J43887_10117585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1387 | Open in IMG/M |
| 3300004114|Ga0062593_100074650 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300005093|Ga0062594_101137676 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005166|Ga0066674_10192863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 969 | Open in IMG/M |
| 3300005174|Ga0066680_10160053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1412 | Open in IMG/M |
| 3300005329|Ga0070683_100688793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus ruber → Rhodococcus ruber BKS 20-38 | 979 | Open in IMG/M |
| 3300005341|Ga0070691_10329842 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005434|Ga0070709_10289991 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300005439|Ga0070711_100538091 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300005440|Ga0070705_101598019 | Not Available | 548 | Open in IMG/M |
| 3300005445|Ga0070708_100003367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12524 | Open in IMG/M |
| 3300005445|Ga0070708_100103477 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300005445|Ga0070708_100194765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1896 | Open in IMG/M |
| 3300005450|Ga0066682_10010649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4830 | Open in IMG/M |
| 3300005467|Ga0070706_101016027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
| 3300005468|Ga0070707_100062130 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300005549|Ga0070704_100988210 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005552|Ga0066701_10049699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2296 | Open in IMG/M |
| 3300005556|Ga0066707_10003324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6815 | Open in IMG/M |
| 3300005574|Ga0066694_10175677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1016 | Open in IMG/M |
| 3300005586|Ga0066691_10047661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2285 | Open in IMG/M |
| 3300005617|Ga0068859_100006224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12114 | Open in IMG/M |
| 3300005890|Ga0075285_1008391 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300006031|Ga0066651_10089292 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300006041|Ga0075023_100032885 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300006041|Ga0075023_100379206 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006047|Ga0075024_100102008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
| 3300006755|Ga0079222_10010167 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300006755|Ga0079222_10842699 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006794|Ga0066658_10009030 | All Organisms → cellular organisms → Bacteria | 3638 | Open in IMG/M |
| 3300006804|Ga0079221_10532656 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006806|Ga0079220_11971997 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006846|Ga0075430_101297581 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006852|Ga0075433_10504366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1065 | Open in IMG/M |
| 3300006854|Ga0075425_100040804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5181 | Open in IMG/M |
| 3300006854|Ga0075425_101706587 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006871|Ga0075434_100698908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1031 | Open in IMG/M |
| 3300006871|Ga0075434_101634368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300006954|Ga0079219_10957250 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300007255|Ga0099791_10040987 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300007255|Ga0099791_10160079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1054 | Open in IMG/M |
| 3300007255|Ga0099791_10574057 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009038|Ga0099829_10009079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6350 | Open in IMG/M |
| 3300009038|Ga0099829_10140566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1919 | Open in IMG/M |
| 3300009089|Ga0099828_10102205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2481 | Open in IMG/M |
| 3300009089|Ga0099828_11359367 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300009090|Ga0099827_10908108 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009156|Ga0111538_13944476 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009162|Ga0075423_12582190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 555 | Open in IMG/M |
| 3300009444|Ga0114945_10026376 | Not Available | 3107 | Open in IMG/M |
| 3300009553|Ga0105249_12040761 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009777|Ga0105164_10050168 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300009777|Ga0105164_10441465 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009808|Ga0105071_1003474 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1853 | Open in IMG/M |
| 3300009813|Ga0105057_1075386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300009820|Ga0105085_1107525 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009822|Ga0105066_1013057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1567 | Open in IMG/M |
| 3300009822|Ga0105066_1065974 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010333|Ga0134080_10188921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 888 | Open in IMG/M |
| 3300011120|Ga0150983_12998407 | Not Available | 539 | Open in IMG/M |
| 3300011270|Ga0137391_10388192 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300012096|Ga0137389_11171321 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012189|Ga0137388_10599718 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300012201|Ga0137365_10202784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1482 | Open in IMG/M |
| 3300012203|Ga0137399_11769518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300012204|Ga0137374_10009680 | All Organisms → cellular organisms → Bacteria | 11364 | Open in IMG/M |
| 3300012205|Ga0137362_11064256 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012205|Ga0137362_11314835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300012211|Ga0137377_10030379 | All Organisms → cellular organisms → Bacteria | 4891 | Open in IMG/M |
| 3300012351|Ga0137386_10083368 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300012359|Ga0137385_10024693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5384 | Open in IMG/M |
| 3300012360|Ga0137375_11467299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300012493|Ga0157355_1030235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300012917|Ga0137395_10307600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1124 | Open in IMG/M |
| 3300012918|Ga0137396_10210015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1432 | Open in IMG/M |
| 3300012918|Ga0137396_10291429 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012927|Ga0137416_10127377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1959 | Open in IMG/M |
| 3300012986|Ga0164304_10013006 | All Organisms → cellular organisms → Bacteria | 3773 | Open in IMG/M |
| 3300015373|Ga0132257_102995365 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300015374|Ga0132255_101623550 | Not Available | 980 | Open in IMG/M |
| 3300017927|Ga0187824_10053134 | Not Available | 1252 | Open in IMG/M |
| 3300017936|Ga0187821_10050967 | Not Available | 1485 | Open in IMG/M |
| 3300018053|Ga0184626_10112370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1156 | Open in IMG/M |
| 3300018074|Ga0184640_10115824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1177 | Open in IMG/M |
| 3300018077|Ga0184633_10386908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300018422|Ga0190265_10273223 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300018431|Ga0066655_10165508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1330 | Open in IMG/M |
| 3300018468|Ga0066662_10609198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1024 | Open in IMG/M |
| 3300019877|Ga0193722_1063453 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300020022|Ga0193733_1117035 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300021086|Ga0179596_10015040 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
| 3300021403|Ga0210397_11429388 | Not Available | 537 | Open in IMG/M |
| 3300022563|Ga0212128_10065604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2342 | Open in IMG/M |
| 3300024330|Ga0137417_1052143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1099 | Open in IMG/M |
| 3300024330|Ga0137417_1319135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1688 | Open in IMG/M |
| 3300025173|Ga0209824_10005410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5966 | Open in IMG/M |
| 3300025312|Ga0209321_10206493 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300025314|Ga0209323_10372280 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300025322|Ga0209641_10955007 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300025910|Ga0207684_10205602 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300025910|Ga0207684_10986337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300025914|Ga0207671_10224693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium ADurb.Bin417 | 1471 | Open in IMG/M |
| 3300025922|Ga0207646_10175833 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300025939|Ga0207665_10628992 | Not Available | 840 | Open in IMG/M |
| 3300025944|Ga0207661_10247247 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300026005|Ga0208285_1000113 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300026325|Ga0209152_10112020 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1035 | Open in IMG/M |
| 3300026329|Ga0209375_1027165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3153 | Open in IMG/M |
| 3300026332|Ga0209803_1199702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300026332|Ga0209803_1234704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300026342|Ga0209057_1041816 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300026361|Ga0257176_1008024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1323 | Open in IMG/M |
| 3300026361|Ga0257176_1063226 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 592 | Open in IMG/M |
| 3300026514|Ga0257168_1021091 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300026514|Ga0257168_1075555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 745 | Open in IMG/M |
| 3300026524|Ga0209690_1124296 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300026538|Ga0209056_10578200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300027655|Ga0209388_1103711 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027775|Ga0209177_10130168 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300027775|Ga0209177_10253951 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027835|Ga0209515_10089856 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300027846|Ga0209180_10041954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2501 | Open in IMG/M |
| 3300027880|Ga0209481_10679324 | Not Available | 534 | Open in IMG/M |
| 3300027882|Ga0209590_10530253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 760 | Open in IMG/M |
| 3300027894|Ga0209068_10007659 | All Organisms → cellular organisms → Bacteria | 5091 | Open in IMG/M |
| 3300027915|Ga0209069_10287824 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300028047|Ga0209526_10168784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1527 | Open in IMG/M |
| 3300028381|Ga0268264_12348995 | Not Available | 540 | Open in IMG/M |
| 3300028536|Ga0137415_10042835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4419 | Open in IMG/M |
| 3300028673|Ga0257175_1034620 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300028792|Ga0307504_10121442 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300028792|Ga0307504_10389117 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300028828|Ga0307312_10431088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
| 3300028828|Ga0307312_11183684 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030006|Ga0299907_10733781 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1058570 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10022343 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300031720|Ga0307469_10396978 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300031720|Ga0307469_10563934 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031720|Ga0307469_12403837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300031740|Ga0307468_101163343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300031740|Ga0307468_102265257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300031740|Ga0307468_102322920 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300031858|Ga0310892_10916111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300031908|Ga0310900_10072008 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300031940|Ga0310901_10155787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
| 3300031949|Ga0214473_10025225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6961 | Open in IMG/M |
| 3300032075|Ga0310890_11070475 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300032180|Ga0307471_100087400 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300032180|Ga0307471_100215524 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300032180|Ga0307471_101108904 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300032180|Ga0307471_101225998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 914 | Open in IMG/M |
| 3300032205|Ga0307472_100653017 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300032211|Ga0310896_10071302 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1473 | Open in IMG/M |
| 3300033233|Ga0334722_10468315 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300033432|Ga0326729_1004293 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300033433|Ga0326726_11888537 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033480|Ga0316620_10163562 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300033486|Ga0316624_10891734 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300033500|Ga0326730_1004860 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300034090|Ga0326723_0195946 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300034165|Ga0364942_0021311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2056 | Open in IMG/M |
| 3300034643|Ga0370545_071137 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300034817|Ga0373948_0048287 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.34% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.92% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.17% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.17% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.17% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.17% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.17% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000571 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_03263080 | 2140918013 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS |
| JGI1358J11329_100224755 | 3300000571 | Groundwater | MGKFTQICASHNDLFALDEQGDVHQYNFDTKMWAKLVANHQSDKEKWGEG* |
| JGIcombinedJ26739_1009652202 | 3300002245 | Forest Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQEDGAATS* |
| Ga0005471J37259_1083413 | 3300002681 | Forest Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAATRDLQENG |
| JGI25612J43240_10517372 | 3300002886 | Grasslands Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQQEDGAAS* |
| JGI25382J43887_101175853 | 3300002908 | Grasslands Soil | KFIQICASQDDLFALDEVGNIHQYNFNAKTXVKLIASRSHEGRA* |
| Ga0062593_1000746505 | 3300004114 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS* |
| Ga0062594_1011376761 | 3300005093 | Soil | RFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS* |
| Ga0066674_101928632 | 3300005166 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEGS* |
| Ga0066680_101600534 | 3300005174 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQES* |
| Ga0070683_1006887931 | 3300005329 | Corn Rhizosphere | HRMTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS* |
| Ga0070691_103298422 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLAVTRDLSEADAS* |
| Ga0070709_102899913 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPA* |
| Ga0070711_1005380912 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAATRDLQENGAATS* |
| Ga0070705_1015980192 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQQEDGAAS* |
| Ga0070708_10000336713 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGEGS* |
| Ga0070708_1001034772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQEDGAAS* |
| Ga0070708_1001947653 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKFIQVCASQNDLFALDEEGDVYQYHFNAKTWVKLVANRESDEGRGSTSSP* |
| Ga0066682_100106493 | 3300005450 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEGP* |
| Ga0070706_1010160271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SPAPTKFIQICASQNDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA* |
| Ga0070707_1000621302 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKFIQICASQNDLFALDQEGVIYQYHFNAKTWVKLTSNRESDEKGQES* |
| Ga0070704_1009882103 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SEAPTQFIQICASQNDLFALDKEGKIYQYNFNAKAWVKLGTSRSYEEHA* |
| Ga0066701_100496995 | 3300005552 | Soil | CASQDDLFALDEVGNIHQYNFNAKTWVKLIASRSHEGRA* |
| Ga0066707_100033241 | 3300005556 | Soil | ICASQDDLFALDEVGNIHQYNFNAKTWVKLIASRSHEGRA* |
| Ga0066694_101756771 | 3300005574 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEG |
| Ga0066691_100476615 | 3300005586 | Soil | SQAPAKFIQICASQDDLFALDEVGNIHQYNFNAKTWVKLIASRSHEGRA* |
| Ga0068859_1000062249 | 3300005617 | Switchgrass Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTR |
| Ga0075285_10083913 | 3300005890 | Rice Paddy Soil | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLAVTRDLSE |
| Ga0066651_100892923 | 3300006031 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQGS* |
| Ga0075023_1000328852 | 3300006041 | Watersheds | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQEDGAPS* |
| Ga0075023_1003792062 | 3300006041 | Watersheds | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLATNREQQEERP* |
| Ga0075024_1001020082 | 3300006047 | Watersheds | MTKFIQMCASQNNLFALDEEGNVYQYHFNVKTWVKLAANREQQEERP* |
| Ga0079222_100101674 | 3300006755 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPG* |
| Ga0079222_108426992 | 3300006755 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQQEDGAAS* |
| Ga0066658_100090305 | 3300006794 | Soil | MAKFIQICASQNDLCALDEEGVIYQYHFNAKTWVKLIGNRESDETGEGS* |
| Ga0079221_105326562 | 3300006804 | Agricultural Soil | PAPTKFIQICASQDDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA* |
| Ga0079220_119719972 | 3300006806 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQHEDGAAS* |
| Ga0075430_1012975812 | 3300006846 | Populus Rhizosphere | MPKFIQICASNDDLFALDGEGNVYQFDFSAKAWVKLAAGRARDTRA* |
| Ga0075433_105043663 | 3300006852 | Populus Rhizosphere | FIQICASQNDLFALDKEGHIYQYNFNAKTWVKLGASRSYEEHA* |
| Ga0075425_1000408041 | 3300006854 | Populus Rhizosphere | FIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPA* |
| Ga0075425_1017065871 | 3300006854 | Populus Rhizosphere | RMTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPA* |
| Ga0075434_1006989082 | 3300006871 | Populus Rhizosphere | IQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAATRDLQENGAATS* |
| Ga0075434_1016343682 | 3300006871 | Populus Rhizosphere | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEGGQGS* |
| Ga0079219_109572501 | 3300006954 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPTEGAA* |
| Ga0099791_100409872 | 3300007255 | Vadose Zone Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAITRDVQEDGAAS* |
| Ga0099791_101600792 | 3300007255 | Vadose Zone Soil | MGKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGQGS* |
| Ga0099791_105740571 | 3300007255 | Vadose Zone Soil | MRKFIQVCASQNDLFALDEEGDVYQYHFNAKTWVKLVANRESDEGRG |
| Ga0099829_100090794 | 3300009038 | Vadose Zone Soil | MAKFIQICASQNDLFALDEDGVIYQYHFNAKTWVKLIGNRESDEKGEGA* |
| Ga0099829_101405663 | 3300009038 | Vadose Zone Soil | VAKFIQICASQDDLFALDEEGNIYQYNFNAQTWVKLAVGRSDEEPV* |
| Ga0099828_101022054 | 3300009089 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGEGA* |
| Ga0099828_113593671 | 3300009089 | Vadose Zone Soil | MAKFIQICASQNDVFALDEEGDIHQYHFNVKTWVKLRATRELEDGRGLAK |
| Ga0099827_109081081 | 3300009090 | Vadose Zone Soil | MRKFIQVCASQNDLFALDEEGDVYQYHFNAKTWVKLVANRESDEGRGSALSP* |
| Ga0105240_112582761 | 3300009093 | Corn Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVT |
| Ga0111538_139444762 | 3300009156 | Populus Rhizosphere | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQQEGGAAS* |
| Ga0075423_125821901 | 3300009162 | Populus Rhizosphere | PAKFIQICASQNDLFALDKGGNIYQYDFNAKTWGKLVASRSMDSR* |
| Ga0114945_100263763 | 3300009444 | Thermal Springs | MGKFIQICASHNDLFALDEQGDVHQYNFDTKKWVKLVANRQSDEEKWGAG* |
| Ga0105249_120407611 | 3300009553 | Switchgrass Rhizosphere | MTRFVQICASQNDLFALDAEGDIHQYHFNAKTWVKLTANRESEEG |
| Ga0105164_100501682 | 3300009777 | Wastewater | MAKFIQICASQDDLFALDEEGNIYQYNFNAKTWVKLAAGRSDEEPV* |
| Ga0105164_104414652 | 3300009777 | Wastewater | MGKFIQICASHNDLFALDEQGDVHQYNFDTKMWTKLVANHQSDKEKWSAD* |
| Ga0105071_10034744 | 3300009808 | Groundwater Sand | GTVSQAPRKFIQICASQNDLFALDAEGNIYQYNFNAKAWAKLVASRS* |
| Ga0105057_10753862 | 3300009813 | Groundwater Sand | FGTVSQAPRKFIQICASQNDLFALDAEGNIYQYNFNAKAWAKLVASRS* |
| Ga0105085_11075251 | 3300009820 | Groundwater Sand | QAPAKFIQICASQDDLFALDAEGNISQYNFNEKTWVKLVASRSYEGRTSNP* |
| Ga0105066_10130571 | 3300009822 | Groundwater Sand | QICASQNDLFALDAEGNIYQYNFNAKAWAKLVASRS* |
| Ga0105066_10659742 | 3300009822 | Groundwater Sand | MAKFIQICASQDDLFALDEEGKIYQYNFNAKTWVQLVAGRSYDV* |
| Ga0134080_101889212 | 3300010333 | Grasslands Soil | MEKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLICNRESDETGEGS* |
| Ga0150983_129984071 | 3300011120 | Forest Soil | AGGSPMTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDEAPA* |
| Ga0137391_103881921 | 3300011270 | Vadose Zone Soil | MRKFIQLCASQNDLFALDEEGDVYQYHFNAKTWVKLVANRESDEGRGSAPSP* |
| Ga0137389_111713212 | 3300012096 | Vadose Zone Soil | MAKFIQICASQDDLFALDDAGNIYQYNFNAQTWVKLAVGRSDEEPV* |
| Ga0137388_105997181 | 3300012189 | Vadose Zone Soil | MRKFIQVCASQNDLFALDEEGDVYQYHFNAKTWVKLVADRESDEGRGSAPSP* |
| Ga0137365_102027844 | 3300012201 | Vadose Zone Soil | MGKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRES |
| Ga0137399_117695182 | 3300012203 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESGEKGQES* |
| Ga0137374_100096802 | 3300012204 | Vadose Zone Soil | VTKFIQICASQDDLFALDEEGNVHQYNFNAKTWIKLVASRAHEESA* |
| Ga0137362_110642561 | 3300012205 | Vadose Zone Soil | MAKLIQVCASLNALFALDEEGNIYQYHFKSKTWVKLVATRESEEKSK* |
| Ga0137362_113148351 | 3300012205 | Vadose Zone Soil | MDKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGQGS* |
| Ga0137377_100303791 | 3300012211 | Vadose Zone Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQEDG |
| Ga0137386_100833684 | 3300012351 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGSRESDEKGQGS* |
| Ga0137385_100246938 | 3300012359 | Vadose Zone Soil | KFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQES* |
| Ga0137375_114672991 | 3300012360 | Vadose Zone Soil | PAKFIQICASQDDLFALDGEGNIYQYNFNEKTWGKLVASRSHEGRT* |
| Ga0157355_10302352 | 3300012493 | Unplanted Soil | MTKFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPTEGAA* |
| Ga0137395_103076003 | 3300012917 | Vadose Zone Soil | MGRFIQICASQNDLFSLDEEGVIYQYHFNAKTWVKLIGNRESDETGQGS* |
| Ga0137396_102100151 | 3300012918 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDERGQES* |
| Ga0137396_102914292 | 3300012918 | Vadose Zone Soil | MTRFIQLCASQNNLFALDEEGHVYEYHFNVRTWVKLAVTRDVQEDGAAS* |
| Ga0137416_101273773 | 3300012927 | Vadose Zone Soil | MGKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQES* |
| Ga0164304_100130062 | 3300012986 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQQEDGAATS* |
| Ga0132257_1029953652 | 3300015373 | Arabidopsis Rhizosphere | MTRFIQLCASQNNLFALDEEGHMYQYHFNVRTWVKLAVTRDLQHEDGAAS* |
| Ga0132255_1016235503 | 3300015374 | Arabidopsis Rhizosphere | MTKFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTSTRELPT |
| Ga0187824_100531343 | 3300017927 | Freshwater Sediment | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPTEGAA |
| Ga0187821_100509672 | 3300017936 | Freshwater Sediment | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPAEGAA |
| Ga0184626_101123702 | 3300018053 | Groundwater Sediment | APAKFIQICASQDDLFALDAEGSIHQYNFNAKTWVKLVASRSHEGRT |
| Ga0184640_101158243 | 3300018074 | Groundwater Sediment | MTKFIQLCASQNNLFALDEEGDVYQYHFNVKTWVKLAANRELHEESP |
| Ga0184633_103869082 | 3300018077 | Groundwater Sediment | MAKFIQICASQDDLFALDEEGNIYQFNFNAKTWVKLVASRSDEEPV |
| Ga0190265_102732234 | 3300018422 | Soil | MTKFVQICASQNNLFALDENGEVYQYHFNVKTWVKLAAERELQEERQE |
| Ga0066655_101655082 | 3300018431 | Grasslands Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEGS |
| Ga0066662_106091983 | 3300018468 | Grasslands Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESD |
| Ga0193722_10634532 | 3300019877 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQQEDGAATS |
| Ga0193733_11170352 | 3300020022 | Soil | MDKFIQICASQNDLFALDEEGTVYQYHFNAKTWVKLTSNRESDEKGQES |
| Ga0179596_100150402 | 3300021086 | Vadose Zone Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQEDGAAS |
| Ga0210397_114293881 | 3300021403 | Soil | RFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAATRDLQENGAATS |
| Ga0212128_100656043 | 3300022563 | Thermal Springs | MGKFIQICASHNDLFALDEQGDVHQYNFDTKKWVKLVANRQSDEEKWGAG |
| Ga0137417_10521432 | 3300024330 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDERGQES |
| Ga0137417_13191354 | 3300024330 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESGEKGQES |
| Ga0209824_1000541010 | 3300025173 | Wastewater | MAKFIQICASQDDLFALDEEGNIYQYNFNAKTWVKLAAGRSDEEPV |
| Ga0209321_102064931 | 3300025312 | Soil | AKFIQICASQDDLFALDEGGNIYQYDFNAKTWVKLVTSRGSMDSRGK |
| Ga0209323_103722802 | 3300025314 | Soil | MGKLIQICASQNDLFALDEEGEVFQYNFNTKTWVKLVTSRGSMDSRGK |
| Ga0209641_109550072 | 3300025322 | Soil | IQICASQNDLFALDEGGNIYQYNFNAKTWVKLVASRSYEGRAGAETVSRSEDYR |
| Ga0207684_102056023 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKFIQVCASQNDLFALDEEGDVYQYHFNAKTWVKLVANRESDEGRGSTSSP |
| Ga0207684_109863371 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGEGS |
| Ga0207671_102246932 | 3300025914 | Corn Rhizosphere | VSRQEDHRMTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS |
| Ga0207646_101758334 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKFIQICASQNDLFALDQEGVIYQYHFNAKTWVKLTSNRESDEKGQES |
| Ga0207665_106289922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLIQICASQNDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA |
| Ga0207661_102472472 | 3300025944 | Corn Rhizosphere | ARVSRQEDHRMTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQHEDGAAS |
| Ga0208285_10001133 | 3300026005 | Rice Paddy Soil | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLAVTRDLSEADAS |
| Ga0209152_101120201 | 3300026325 | Soil | IQICASQNDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA |
| Ga0209375_10271655 | 3300026329 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDETGEGP |
| Ga0209803_11997023 | 3300026332 | Soil | QICASQNDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA |
| Ga0209803_12347043 | 3300026332 | Soil | QICASQNDLFALDKKGNVYQYNFNAKAWTQLVASRSYEEHASA |
| Ga0209057_10418161 | 3300026342 | Soil | KFIQICASQNDLFALDKEGNIYQYNFNAKAWIKLVASRSYEEPA |
| Ga0257176_10080242 | 3300026361 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGEGA |
| Ga0257176_10632262 | 3300026361 | Soil | MAKFIQVCASHNALFALDEEGDVYQYHFNSKTWVKLVATRASEE |
| Ga0257168_10210911 | 3300026514 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQQEDAAAS |
| Ga0257168_10755552 | 3300026514 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLTSNRESDEKGQE |
| Ga0209690_11242961 | 3300026524 | Soil | QICASQDDLFALDEVGNIHQYNFNAKTWVKLIASRSHEGRA |
| Ga0209056_105782001 | 3300026538 | Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQGS |
| Ga0209388_11037111 | 3300027655 | Vadose Zone Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAITRDVQEDGAAS |
| Ga0209177_101301682 | 3300027775 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDLQQEDGAAS |
| Ga0209177_102539512 | 3300027775 | Agricultural Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPG |
| Ga0209515_100898562 | 3300027835 | Groundwater | MGKFTQICASHNDLFALDEQGDVHQYNFDTKMWAKLVANHQSDKEKWGEG |
| Ga0209180_100419543 | 3300027846 | Vadose Zone Soil | MAKFIQICASQNDLFALDEDGVIYQYHFNAKTWVKLIGNRESDEKGEGA |
| Ga0209283_101587263 | 3300027875 | Vadose Zone Soil | VAKFIQICASQDDLFALDEVGNIYQYKFNAQTWVKLAVGRSDEEPV |
| Ga0209481_106793241 | 3300027880 | Populus Rhizosphere | MTRFVQICASQNDLFALDAEGDIHQYHFNAKTWVKLTANRESEEGVPTGVT |
| Ga0209590_105302531 | 3300027882 | Vadose Zone Soil | MAKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQES |
| Ga0209068_100076595 | 3300027894 | Watersheds | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVQEDGAPS |
| Ga0209069_102878242 | 3300027915 | Watersheds | MTKFIQMCASQNNLFALDEEGNVYQYHFNVKTWVKLAANREQQEERP |
| Ga0209526_101687842 | 3300028047 | Forest Soil | MGKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESDEKGQAS |
| Ga0268264_123489952 | 3300028381 | Switchgrass Rhizosphere | MTRFVQICASQNDLFALDAEGDIHQYHFNAKTWVKLTANRESEEGVPTGVTRRQ |
| Ga0137415_100428355 | 3300028536 | Vadose Zone Soil | MGKFIQICASQNDLFALDEEGVIYQYHFNAKTWVKLIGNRESGEKGQES |
| Ga0257175_10346203 | 3300028673 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRD |
| Ga0307504_101214422 | 3300028792 | Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAVTRDVLEDGAAS |
| Ga0307504_103891171 | 3300028792 | Soil | MGDQRMTKFIQMCASQNNLFALDEEGNVYQYHFNVKTWVKLAANREQQEERP |
| Ga0307312_104310881 | 3300028828 | Soil | MDKFIQICASQNDLFALDEEGTVYQYHFNAKTWVKLTSNRESDEKGQE |
| Ga0307312_111836841 | 3300028828 | Soil | HYGGSGMAKFIQVCASHSALFALDEEGDVYQYHFNSKTWVKLVAARASEEKSK |
| Ga0299907_107337811 | 3300030006 | Soil | MAKFIQVCASQNDLFALDDEGNVFQYNFSTKTWIKLRMSRAPDE |
| (restricted) Ga0255311_10585702 | 3300031150 | Sandy Soil | MTKFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPAEGAA |
| (restricted) Ga0255310_100223433 | 3300031197 | Sandy Soil | MGGQRMTKFIQMCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPAEGAA |
| Ga0307469_103969783 | 3300031720 | Hardwood Forest Soil | IQICASQDDLFALDDEGNIHQYNFNAKTWVKLVASRSHEGRT |
| Ga0307469_105639341 | 3300031720 | Hardwood Forest Soil | MMKFVQLCASQNDLFALDENGSVYQYHFNVKTWVKLSANRESEEKTS |
| Ga0307469_124038372 | 3300031720 | Hardwood Forest Soil | KFIQICASQNDLFALDEEGNIYQYNFNAKAWAKLVASRSYE |
| Ga0307468_1011633433 | 3300031740 | Hardwood Forest Soil | QNDLFALDKEGNIYQYNFNAKAGVKLGTSHAYEEHA |
| Ga0307468_1022652571 | 3300031740 | Hardwood Forest Soil | NDLFALDKEGNVYRYNFNAKAWTQFVASRSYDEHA |
| Ga0307468_1023229201 | 3300031740 | Hardwood Forest Soil | CASQNDLFALDKVGSIYQYNFNAKAWVKLGASRSYEEHA |
| Ga0310892_109161113 | 3300031858 | Soil | LRTVSQAPTQFIQICASQNDLFALDKEGNIYQYNFNAKAWVKLGTSRSYEEHA |
| Ga0310900_100720086 | 3300031908 | Soil | APTQFIQICASQNDLFALDKDGSIYQYNFNAKAWVKLGTSRSYEEHA |
| Ga0310901_101557873 | 3300031940 | Soil | RTVSQTPTQFIQICASQNDLFALDKEGNIYQYNFNAKAWVKLGTSRSYEEHA |
| Ga0214473_100252252 | 3300031949 | Soil | MAKFIQICASQNDVFALDEEGDIYQYHFNVKTWVKLIATRELEERSP |
| Ga0310890_110704752 | 3300032075 | Soil | SARVSRQEDHRMTRFIQLCASQNNLFALDEEGHVYQYHFNVRTWVKLAATRDLQENGAAT |
| Ga0307471_1000874002 | 3300032180 | Hardwood Forest Soil | MDKFIQICASQNDLFALDEKGVIYQYHFNAKTWVKLTGNRESDETGQGS |
| Ga0307471_1002155241 | 3300032180 | Hardwood Forest Soil | EDHRMTRFIQLCASQNNLFALDEEGHVYQYHFNVKAWVKLAVTRDLQEDGAPA |
| Ga0307471_1011089041 | 3300032180 | Hardwood Forest Soil | MRKFIQVCASQNDLFALDEEGNVYQYHFNAKTWVKLVANRESDEGR |
| Ga0307471_1012259981 | 3300032180 | Hardwood Forest Soil | GTVSQAPTQFIQICASQNDLFALDKDGNVYQYNFNAKAWIKLGASRSYEEHA |
| Ga0307472_1006530172 | 3300032205 | Hardwood Forest Soil | MMKFVQLCASQNDLFALDEEGSVYQYHFNVKTWVKLIATRESAEAGRGATE |
| Ga0310896_100713021 | 3300032211 | Soil | QICASQNDLFALDKDGSIYQYNFNAKAWVKLGTSRSYEEHA |
| Ga0334722_104683151 | 3300033233 | Sediment | MAKFIQICASQNDLFALDEEGNIYQYNFNAKTWVKLVAGRSDEEPV |
| Ga0326729_10042936 | 3300033432 | Peat Soil | MTKFIQLCASQNNLFALDEEGDVYQYHFNVRTWVKLTATRELTATRELPAEGAA |
| Ga0326726_118885372 | 3300033433 | Peat Soil | MTKFIQLCASQNNLFALDEEGDVYQYHFNVRTWVKLTATRELPAEGAA |
| Ga0316620_101635622 | 3300033480 | Soil | MTKFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLAVTRDLAEAGAS |
| Ga0316624_108917341 | 3300033486 | Soil | FIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPAEGAA |
| Ga0326730_10048606 | 3300033500 | Peat Soil | QLCASQNNLFALDEEGDVYQYHFNVRTWVKLTATRELTATRELPAEGAA |
| Ga0326723_0195946_755_892 | 3300034090 | Peat Soil | MTRFIQLCASQNNLFALDEEGNVYQYHFNVKTWVKLTATRELPAEG |
| Ga0364942_0021311_1584_1742 | 3300034165 | Sediment | MGDQRMTKFIQLCASQNNLFALDEEGDVYQYHFNVKTWVKLAANRELHEESP |
| Ga0370545_071137_1_138 | 3300034643 | Soil | VKEKAMAKFIQICASQNDLFALDEEGDIHRYDFKVRTWGKLTAGRR |
| Ga0373948_0048287_633_782 | 3300034817 | Rhizosphere Soil | MTRFIQLCASQNNLFALDEEGHVYQYHFNVRAWVKLAVTRDVKEDGAAS |
| ⦗Top⦘ |