


| Basic Information | |
|---|---|
| Family ID | F035513 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPPPKDDLKERLARYRQIKLSVIGRKSGKTISMPVWFVLE |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.47 % |
| % of genes near scaffold ends (potentially truncated) | 76.16 % |
| % of genes from short scaffolds (< 2000 bps) | 83.14 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.070 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.930 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.674 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.256 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 26.47% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF03576 | Peptidase_S58 | 5.81 |
| PF07681 | DoxX | 5.23 |
| PF00857 | Isochorismatase | 4.07 |
| PF01914 | MarC | 3.49 |
| PF04075 | F420H2_quin_red | 2.33 |
| PF14300 | DUF4375 | 1.74 |
| PF07311 | Dodecin | 1.74 |
| PF04365 | BrnT_toxin | 1.16 |
| PF13847 | Methyltransf_31 | 1.16 |
| PF00581 | Rhodanese | 1.16 |
| PF01546 | Peptidase_M20 | 1.16 |
| PF00578 | AhpC-TSA | 1.16 |
| PF01243 | Putative_PNPOx | 1.16 |
| PF07238 | PilZ | 1.16 |
| PF02586 | SRAP | 1.16 |
| PF04191 | PEMT | 1.16 |
| PF11154 | DUF2934 | 1.16 |
| PF00069 | Pkinase | 1.16 |
| PF01545 | Cation_efflux | 1.16 |
| PF06262 | Zincin_1 | 1.16 |
| PF00190 | Cupin_1 | 0.58 |
| PF01382 | Avidin | 0.58 |
| PF03795 | YCII | 0.58 |
| PF00488 | MutS_V | 0.58 |
| PF05514 | HR_lesion | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF01729 | QRPTase_C | 0.58 |
| PF05721 | PhyH | 0.58 |
| PF02900 | LigB | 0.58 |
| PF11127 | DUF2892 | 0.58 |
| PF06782 | UPF0236 | 0.58 |
| PF09722 | Xre_MbcA_ParS_C | 0.58 |
| PF00872 | Transposase_mut | 0.58 |
| PF00589 | Phage_integrase | 0.58 |
| PF05167 | DUF711 | 0.58 |
| PF07731 | Cu-oxidase_2 | 0.58 |
| PF00248 | Aldo_ket_red | 0.58 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.58 |
| PF13181 | TPR_8 | 0.58 |
| PF05192 | MutS_III | 0.58 |
| PF02517 | Rce1-like | 0.58 |
| PF14534 | DUF4440 | 0.58 |
| PF12681 | Glyoxalase_2 | 0.58 |
| PF12762 | DDE_Tnp_IS1595 | 0.58 |
| PF05128 | DUF697 | 0.58 |
| PF12840 | HTH_20 | 0.58 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF02401 | LYTB | 0.58 |
| PF03720 | UDPG_MGDP_dh_C | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF01380 | SIS | 0.58 |
| PF07732 | Cu-oxidase_3 | 0.58 |
| PF07366 | SnoaL | 0.58 |
| PF08543 | Phos_pyr_kin | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 11.63 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 5.23 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 5.23 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.65 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 4.07 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.07 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 3.49 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.74 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.16 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.16 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.16 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.16 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.16 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.16 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.16 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.16 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.58 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.58 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.58 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.58 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.58 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.58 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.58 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.65 % |
| Unclassified | root | N/A | 20.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10005773 | All Organisms → cellular organisms → Bacteria | 8656 | Open in IMG/M |
| 3300000567|JGI12270J11330_10285382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300001084|JGI12648J13191_1014164 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300001131|JGI12631J13338_1025360 | Not Available | 618 | Open in IMG/M |
| 3300001154|JGI12636J13339_1027031 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300001397|JGI20177J14857_1037382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300002562|JGI25382J37095_10204933 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300004092|Ga0062389_102002396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 756 | Open in IMG/M |
| 3300004152|Ga0062386_101627565 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005171|Ga0066677_10785553 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005178|Ga0066688_10544088 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005556|Ga0066707_10069740 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300005556|Ga0066707_10790258 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005586|Ga0066691_10016338 | All Organisms → cellular organisms → Bacteria | 3598 | Open in IMG/M |
| 3300005591|Ga0070761_10029474 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
| 3300005598|Ga0066706_10398676 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005764|Ga0066903_100135902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3477 | Open in IMG/M |
| 3300006028|Ga0070717_10631940 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300006102|Ga0075015_101049472 | Not Available | 501 | Open in IMG/M |
| 3300006163|Ga0070715_10267290 | Not Available | 901 | Open in IMG/M |
| 3300006176|Ga0070765_100020779 | All Organisms → cellular organisms → Bacteria | 4905 | Open in IMG/M |
| 3300006800|Ga0066660_10391025 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300006854|Ga0075425_101418588 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300006893|Ga0073928_10003294 | All Organisms → cellular organisms → Bacteria | 25783 | Open in IMG/M |
| 3300007255|Ga0099791_10097581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300007255|Ga0099791_10680528 | Not Available | 505 | Open in IMG/M |
| 3300009521|Ga0116222_1209320 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300009523|Ga0116221_1082923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1433 | Open in IMG/M |
| 3300009634|Ga0116124_1147163 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009637|Ga0116118_1008755 | All Organisms → cellular organisms → Bacteria | 4072 | Open in IMG/M |
| 3300009641|Ga0116120_1039091 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300009641|Ga0116120_1052326 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300009646|Ga0116132_1109525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 847 | Open in IMG/M |
| 3300009760|Ga0116131_1003430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7610 | Open in IMG/M |
| 3300010303|Ga0134082_10228014 | Not Available | 768 | Open in IMG/M |
| 3300010325|Ga0134064_10026402 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300010325|Ga0134064_10126841 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300010326|Ga0134065_10290749 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010339|Ga0074046_10293073 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300010341|Ga0074045_10458802 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010343|Ga0074044_10477210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 815 | Open in IMG/M |
| 3300010360|Ga0126372_11138842 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300010361|Ga0126378_13073789 | Not Available | 531 | Open in IMG/M |
| 3300010379|Ga0136449_100069973 | All Organisms → cellular organisms → Bacteria | 7541 | Open in IMG/M |
| 3300010379|Ga0136449_100222662 | Not Available | 3547 | Open in IMG/M |
| 3300011270|Ga0137391_10534552 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300011270|Ga0137391_11405474 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300011271|Ga0137393_10233434 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300012096|Ga0137389_10295074 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300012189|Ga0137388_10791390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300012198|Ga0137364_10494187 | Not Available | 920 | Open in IMG/M |
| 3300012201|Ga0137365_10150079 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300012203|Ga0137399_11319375 | Not Available | 606 | Open in IMG/M |
| 3300012205|Ga0137362_10513697 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012205|Ga0137362_11558675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012206|Ga0137380_10171727 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300012208|Ga0137376_11343742 | Not Available | 605 | Open in IMG/M |
| 3300012209|Ga0137379_10313059 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300012209|Ga0137379_11403963 | Not Available | 601 | Open in IMG/M |
| 3300012209|Ga0137379_11450955 | Not Available | 588 | Open in IMG/M |
| 3300012210|Ga0137378_10102210 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300012211|Ga0137377_10662423 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300012211|Ga0137377_10902311 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012285|Ga0137370_10349689 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012349|Ga0137387_11229221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012354|Ga0137366_10233940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
| 3300012354|Ga0137366_10281296 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300012359|Ga0137385_10887808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300012361|Ga0137360_10379923 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012363|Ga0137390_10435448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
| 3300012363|Ga0137390_11885132 | Not Available | 527 | Open in IMG/M |
| 3300012918|Ga0137396_11291584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012923|Ga0137359_10818023 | Not Available | 807 | Open in IMG/M |
| 3300012927|Ga0137416_10462977 | Not Available | 1086 | Open in IMG/M |
| 3300012929|Ga0137404_12156487 | Not Available | 521 | Open in IMG/M |
| 3300014489|Ga0182018_10194887 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300014494|Ga0182017_10110174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1799 | Open in IMG/M |
| 3300014657|Ga0181522_10657038 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 638 | Open in IMG/M |
| 3300015245|Ga0137409_10316621 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300015371|Ga0132258_12475001 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300016357|Ga0182032_11440817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300016730|Ga0181515_1461161 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300017822|Ga0187802_10431944 | Not Available | 523 | Open in IMG/M |
| 3300017924|Ga0187820_1017229 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300017932|Ga0187814_10248348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300017934|Ga0187803_10253307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300017934|Ga0187803_10410483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300017934|Ga0187803_10458009 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017939|Ga0187775_10316842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300017942|Ga0187808_10276255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 754 | Open in IMG/M |
| 3300017942|Ga0187808_10421436 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017943|Ga0187819_10187323 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300017943|Ga0187819_10599634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 624 | Open in IMG/M |
| 3300017946|Ga0187879_10056538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300017946|Ga0187879_10378602 | Not Available | 784 | Open in IMG/M |
| 3300017946|Ga0187879_10716259 | Not Available | 557 | Open in IMG/M |
| 3300017948|Ga0187847_10121284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300018003|Ga0187876_1002859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 12251 | Open in IMG/M |
| 3300018003|Ga0187876_1091959 | Not Available | 1142 | Open in IMG/M |
| 3300018005|Ga0187878_1318577 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018012|Ga0187810_10189586 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300018012|Ga0187810_10264299 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300018020|Ga0187861_10430117 | Not Available | 550 | Open in IMG/M |
| 3300018021|Ga0187882_1119161 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300018022|Ga0187864_10221517 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300018026|Ga0187857_10078984 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300018026|Ga0187857_10126399 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300018030|Ga0187869_10245708 | Not Available | 868 | Open in IMG/M |
| 3300018085|Ga0187772_10993519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Georgfuchsia → Georgfuchsia toluolica | 613 | Open in IMG/M |
| 3300018086|Ga0187769_10018001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4640 | Open in IMG/M |
| 3300018090|Ga0187770_10804014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 753 | Open in IMG/M |
| 3300018468|Ga0066662_11698324 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300019878|Ga0193715_1029589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
| 3300019881|Ga0193707_1001062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9964 | Open in IMG/M |
| 3300020580|Ga0210403_10015232 | All Organisms → cellular organisms → Bacteria | 6179 | Open in IMG/M |
| 3300020580|Ga0210403_10293690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300020581|Ga0210399_11116019 | Not Available | 630 | Open in IMG/M |
| 3300021046|Ga0215015_10137079 | All Organisms → cellular organisms → Bacteria | 6467 | Open in IMG/M |
| 3300021178|Ga0210408_10795650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300021403|Ga0210397_11093614 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300021432|Ga0210384_10736795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300021474|Ga0210390_11203628 | Not Available | 611 | Open in IMG/M |
| 3300021478|Ga0210402_10292816 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300021478|Ga0210402_11011192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300022881|Ga0224545_1002281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3539 | Open in IMG/M |
| 3300023259|Ga0224551_1089313 | All Organisms → cellular organisms → Archaea | 543 | Open in IMG/M |
| 3300025320|Ga0209171_10002801 | All Organisms → cellular organisms → Bacteria | 25460 | Open in IMG/M |
| 3300026273|Ga0209881_1188049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300026317|Ga0209154_1042282 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300026332|Ga0209803_1010736 | All Organisms → cellular organisms → Bacteria | 4851 | Open in IMG/M |
| 3300026333|Ga0209158_1343608 | Not Available | 518 | Open in IMG/M |
| 3300026529|Ga0209806_1108842 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300026529|Ga0209806_1142680 | Not Available | 927 | Open in IMG/M |
| 3300026557|Ga0179587_10179961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300027047|Ga0208730_1001779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1894 | Open in IMG/M |
| 3300027587|Ga0209220_1063620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 981 | Open in IMG/M |
| 3300027604|Ga0208324_1163589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 602 | Open in IMG/M |
| 3300027641|Ga0208827_1150114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 648 | Open in IMG/M |
| 3300027652|Ga0209007_1162261 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027678|Ga0209011_1028487 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300027698|Ga0209446_1205438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027745|Ga0209908_10035610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
| 3300027748|Ga0209689_1212769 | Not Available | 835 | Open in IMG/M |
| 3300027748|Ga0209689_1277971 | Not Available | 661 | Open in IMG/M |
| 3300027768|Ga0209772_10259248 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027783|Ga0209448_10110977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 918 | Open in IMG/M |
| 3300027853|Ga0209274_10022351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2891 | Open in IMG/M |
| 3300027854|Ga0209517_10015464 | All Organisms → cellular organisms → Bacteria | 7672 | Open in IMG/M |
| 3300027875|Ga0209283_10411414 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300027895|Ga0209624_10946441 | Not Available | 560 | Open in IMG/M |
| 3300028536|Ga0137415_10181426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1930 | Open in IMG/M |
| 3300028747|Ga0302219_10068199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300028906|Ga0308309_10156622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1839 | Open in IMG/M |
| 3300028906|Ga0308309_11881710 | Not Available | 505 | Open in IMG/M |
| 3300030114|Ga0311333_11536530 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300030706|Ga0310039_10040261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2110 | Open in IMG/M |
| 3300030707|Ga0310038_10445904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300030740|Ga0265460_12430601 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031122|Ga0170822_16655572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300031708|Ga0310686_117213315 | Not Available | 1127 | Open in IMG/M |
| 3300031715|Ga0307476_10023997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3992 | Open in IMG/M |
| 3300031715|Ga0307476_10480877 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031720|Ga0307469_11842590 | Not Available | 585 | Open in IMG/M |
| 3300031754|Ga0307475_10880924 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031820|Ga0307473_11243076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300031947|Ga0310909_11678604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300031954|Ga0306926_12367990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300032160|Ga0311301_10378747 | Not Available | 2186 | Open in IMG/M |
| 3300032160|Ga0311301_11400065 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300032180|Ga0307471_103414506 | Not Available | 562 | Open in IMG/M |
| 3300032783|Ga0335079_11634554 | Not Available | 632 | Open in IMG/M |
| 3300032895|Ga0335074_10027073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8062 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.16% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.16% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.58% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100057738 | 3300000567 | Peatlands Soil | MPTSKATLKDRLARYRQIKLSVIGRKTGQTISIPV* |
| JGI12270J11330_102853822 | 3300000567 | Peatlands Soil | MGSMMNQNPSPRDTNDRLARYRRIKISVIGRKSGKMISIPVWFVLEGEKP* |
| JGI12648J13191_10141641 | 3300001084 | Forest Soil | MTTVRNELKERLSRYRQIKISVIGRKSGKTISIPVWFVSER |
| JGI12631J13338_10253602 | 3300001131 | Forest Soil | MPSSGETLKERLARYRQIKMSMIGRKFGKTISIPVS* |
| JGI12636J13339_10270312 | 3300001154 | Forest Soil | MPTQKDTLKDRLARYRQIKISIIGRKSGQIISVPVWFVLEGEKLYLLP |
| JGI20177J14857_10373821 | 3300001397 | Arctic Peat Soil | MTGSKDVLENRLLRYRQIKISVIGRKSGRTISIPVWF |
| JGI25382J37095_102049332 | 3300002562 | Grasslands Soil | MAGSKHGLRERLARYRQIKISVIGRSSGRTISIPVWFALEGEKLYLLP |
| Ga0062389_1020023962 | 3300004092 | Bog Forest Soil | LPTSKNALKDPLARYRQINISLIGRKSGKTISIPVWFVLER |
| Ga0062386_1016275652 | 3300004152 | Bog Forest Soil | LSLPTSKNALKDPLARYRQINISLIGRKSGKTISIPVWFV |
| Ga0066677_107855532 | 3300005171 | Soil | VKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLEAQKP* |
| Ga0066688_105440882 | 3300005178 | Soil | MQVPSSKETLKDRLPRYRQIKLSVTGRKSGKMISMPVWFV |
| Ga0066707_100697401 | 3300005556 | Soil | VKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWF |
| Ga0066707_107902582 | 3300005556 | Soil | MSSVVEMQVRSSKETLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLE |
| Ga0066691_100163387 | 3300005586 | Soil | VPSSKGTLKDRLARFRQIKLSVTGRKSGKMISMPVWFVLEGEKLYL |
| Ga0070761_100294745 | 3300005591 | Soil | MKPSTDNLKDRLARYREIKISVIGRKSGKTISIPISICFV* |
| Ga0066706_103986761 | 3300005598 | Soil | VTAPKGSIKERLFRYREIKLSVRGRKSGKTISIPVWFVLEGDKLYL |
| Ga0066903_1001359023 | 3300005764 | Tropical Forest Soil | VKRNELKDRLPPYRQIKLSVVGRKSGKTISMPVWFVLE |
| Ga0070717_106319403 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAMVPSSKETLKDGLLRYRQIKISAIGRKSGRTISIPVWFVLEGGKLYLL |
| Ga0075015_1010494722 | 3300006102 | Watersheds | MAGSKDSLRDRLARYYRQIKISVIGRKSGRTISIPVWKW* |
| Ga0070715_102672901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSAKGSLKERLARYRQIKLGVIGRKSGQTISNPVWALPNV |
| Ga0070765_1000207793 | 3300006176 | Soil | MAQSSKENLKDRLARYRQITLSVVGRKSGRTISIPVWFVLEGEKP* |
| Ga0066660_103910251 | 3300006800 | Soil | YQVKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLEAQKP* |
| Ga0075425_1014185881 | 3300006854 | Populus Rhizosphere | MEILRDRLGRYRQLDLSVIGRKSGKTITKTVWFVAEKEKLYLLPV |
| Ga0073928_1000329426 | 3300006893 | Iron-Sulfur Acid Spring | MPNLKDNLKERLSRYRQIAISVIARKSGKTVSIPVWFVLDGEKLYLLP* |
| Ga0099791_100975813 | 3300007255 | Vadose Zone Soil | MPTQKDTLKNRLARYRQIKISLIGRRSGQIISVPVWFILEGEKFFLLPT* |
| Ga0099791_106805282 | 3300007255 | Vadose Zone Soil | VQSSTDTLKERLARYRQIKISVIGRSSGRTISIPVWFVFEGNK |
| Ga0116222_12093201 | 3300009521 | Peatlands Soil | MPTSKATLKDRLARYRQIKLSVIGRKAGQTISAPVWFVLE* |
| Ga0116221_10829233 | 3300009523 | Peatlands Soil | MPASKDNLKGRLARYRHIKLGVIGRKSGQTISIPVWFV |
| Ga0116124_11471633 | 3300009634 | Peatland | MAGSKDDLKARLARYRQIKISVIGRKSGKTISIPVWFVLERQKLYL |
| Ga0116118_10087555 | 3300009637 | Peatland | MPRKTDDLKERLARYRQIKISVIGRKSGQTISIPV* |
| Ga0116120_10390911 | 3300009641 | Peatland | MAGSKDDLKARLARYRQIKISVIGRKSGTTFSVPVWFVLEGEMLFLL |
| Ga0116120_10523263 | 3300009641 | Peatland | MPTPKDDLRERLARYRQIKISVIGRKSGQTISIPVWFVL |
| Ga0116132_11095252 | 3300009646 | Peatland | MEVRMAGSKDGIKDRLARYRQIKLGVIGRKSGQTISIPVWFVLEDT |
| Ga0116131_100343012 | 3300009760 | Peatland | MPNLKDNLKERLARYRQIKISVIGRKSGQTISIPVWFVLEGEKLYLL |
| Ga0134082_102280141 | 3300010303 | Grasslands Soil | MSSVVEMQVPSSKETLKDRLARFRQIKISVIGRKLGRTISIPVWFVLEGQK |
| Ga0134064_100264023 | 3300010325 | Grasslands Soil | VKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLE |
| Ga0134064_101268411 | 3300010325 | Grasslands Soil | MAGSKNDLKDRLTRYRQIKISVIGRKSGQTISVPVWFVLEGKKLYL |
| Ga0134065_102907492 | 3300010326 | Grasslands Soil | MAGSKNDLKDRLTRYRQIKISVIGRKSGQTISVPVWLV |
| Ga0074046_102930732 | 3300010339 | Bog Forest Soil | VKESELKARLARYREIKISVIGRKSGKTISMPVWFVLEGE |
| Ga0074045_104588021 | 3300010341 | Bog Forest Soil | MNQMEVRMAGSKDSLKDRLTRYRRIKITVIGRKSGKTISIPVWFVLEDKNLYL |
| Ga0074044_104772101 | 3300010343 | Bog Forest Soil | VKEPELKDRLARHRQVKISVLGRKSGKTISITVWFVLNGEKLYLLP |
| Ga0126372_111388422 | 3300010360 | Tropical Forest Soil | VKQKELKDRLARYRQIELGVIGRKSGKTISIPVWFVLE |
| Ga0126378_130737891 | 3300010361 | Tropical Forest Soil | SPVKKNDLKDRLARYRQIKLSVIGRKSGKTISIPLCFVLEGDKL* |
| Ga0136449_1000699735 | 3300010379 | Peatlands Soil | VPSSSETLKDRLARYRQIKLSVIGRKSGKTISIPVRFVLEDEKLYLLPVRGSEPF* |
| Ga0136449_1002226621 | 3300010379 | Peatlands Soil | MPNQKDNLKDRLTRYRQIKIIVVGRKSGKTISIPVWFVLESDKLFCQ* |
| Ga0137391_105345522 | 3300011270 | Vadose Zone Soil | MKASELKDRLACYRQIKLSVIGRKSGKTISIPVWFVLEGE |
| Ga0137391_114054741 | 3300011270 | Vadose Zone Soil | MAGSKDCLKDRLSHYSRIKISVIGRNFGRTISIPV |
| Ga0137393_102334344 | 3300011271 | Vadose Zone Soil | MPKSKDDLKERLARYRQIKIGVIGRKSGQTISIPVWFVLESERL* |
| Ga0137389_102950743 | 3300012096 | Vadose Zone Soil | VPRSTNDLKERLTRYRQIKISVIGRKSGKKISIPVWFVLE |
| Ga0137388_107913901 | 3300012189 | Vadose Zone Soil | MSTPKNDLQERLARYRQIKISVTGRTSGRTVTIPVWFFLDGKKVYL |
| Ga0137364_104941871 | 3300012198 | Vadose Zone Soil | MSSVVEMQVRSSKETLKDRLARYRQIKLSVTGRKSGKMISMPVWF |
| Ga0137365_101500791 | 3300012201 | Vadose Zone Soil | MAGSKNDLKDRLSRYQQTKISVIGRKSGQTISIPVW |
| Ga0137399_113193751 | 3300012203 | Vadose Zone Soil | VPTSKGSLKERLTRFRQIRISVIGRKSGNTISIPVW |
| Ga0137362_105136973 | 3300012205 | Vadose Zone Soil | VTTSKDGLKDRLGRYRQIRITVIGRKSGRKISVPVWFVVEGNE |
| Ga0137362_115586752 | 3300012205 | Vadose Zone Soil | KGSLKERLSRYRQIKLSVIGRKTGQTISIPVWFVLESERL* |
| Ga0137380_101717272 | 3300012206 | Vadose Zone Soil | VPSSKDGLKDRLARYRQIKLSVIGRKSGRLISIPVWFVLEGEKL* |
| Ga0137376_113437421 | 3300012208 | Vadose Zone Soil | MPKATEGLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLEG |
| Ga0137379_103130591 | 3300012209 | Vadose Zone Soil | MPAPKDSLKDRLARYRHIKISVIGRKSGQTISIPVWFVL |
| Ga0137379_114039631 | 3300012209 | Vadose Zone Soil | MATPKNGLKERLTRYRQIKISVVGRKTGRMISIPVWFVLEGERL* |
| Ga0137379_114509551 | 3300012209 | Vadose Zone Soil | MPSSSETLKERLARYRQIRISVIGRKSGKTISIPVWF |
| Ga0137378_101022102 | 3300012210 | Vadose Zone Soil | VKKNELKTGLSRYRQIKLSVIGRKSGRLISIPVWFVLEGEKL* |
| Ga0137377_106624231 | 3300012211 | Vadose Zone Soil | MAGSKNDLKDRLTCNRQIKISVIGRKSGQTISVPVWFV |
| Ga0137377_109023111 | 3300012211 | Vadose Zone Soil | MAHSKKDLTDRLTRYRQIKISVIGRKSGQTISNPIWF |
| Ga0137370_103496891 | 3300012285 | Vadose Zone Soil | VKENDLKQRLASYHQIKLSVIGRKSGRTISILVWF |
| Ga0137387_112292212 | 3300012349 | Vadose Zone Soil | MSNPKDDLKERLARYRQIKLSVIGRKSGQTISIPVWFV |
| Ga0137366_102339401 | 3300012354 | Vadose Zone Soil | RLARYRQIKLSVIGRKSGRLISIPVWFVLEGEKL* |
| Ga0137366_102812963 | 3300012354 | Vadose Zone Soil | MEVRMAGSKNDLKDRLTRYRQVKISVIGRKSGRKISIPVWFVVDGG |
| Ga0137385_108878083 | 3300012359 | Vadose Zone Soil | MPAPKGTLKERLARYHQIKISVIGRKSGQTISIPVWLVL |
| Ga0137360_103799232 | 3300012361 | Vadose Zone Soil | VPSSKDGLKDRLARYRQIKLSVIGRKSGRMISIAVWFALEGEKL* |
| Ga0137390_104354483 | 3300012363 | Vadose Zone Soil | MPAPRDSLKDRLARYRQIKISVIGRKSGQTIPIPVWFVLEGE |
| Ga0137390_118851321 | 3300012363 | Vadose Zone Soil | MTIATKKDLKERLARYRQIKLSVIGRKTGQTISIPVWFV |
| Ga0137396_112915842 | 3300012918 | Vadose Zone Soil | MPTQKDTLKNRLARYRQIKIILIGRRSGQIISVPAWFMLEGEKLYLLPT* |
| Ga0137359_108180231 | 3300012923 | Vadose Zone Soil | MAQNSGQVVLVEMQVPSSKETLKDRLTRCRQIKISLIGRKSGRTISIPVWFVLE |
| Ga0137416_104629773 | 3300012927 | Vadose Zone Soil | MQVPSSKETLRERLSRYRQIKISVIGRKSGQIISIPIWFVLDG |
| Ga0137404_121564871 | 3300012929 | Vadose Zone Soil | VPTSKGSLKERLTRFRQIRISVIGRKSGNTISIPVWFVLE |
| Ga0182018_101948873 | 3300014489 | Palsa | VATSKDTLKARLARYRQIKIGVIGRKSGRKISIPVWFALDDEKLHLLPV |
| Ga0182017_101101744 | 3300014494 | Fen | VKESELKSRLARYRQMKISVVGRKSARTISIPVWFVVDPEWCARMHY* |
| Ga0181522_106570382 | 3300014657 | Bog | MSSKDELLERLGRYRQIEITVIGRKSGKKVSRPVWFVLE |
| Ga0137409_103166213 | 3300015245 | Vadose Zone Soil | VQSSTDTLKERLARYRQIKISVIGRSSGRTISIPVWFVFEGN |
| Ga0132258_124750011 | 3300015371 | Arabidopsis Rhizosphere | MPSPKDDLKERLARYRQIKLSMIGRKSGKTISIPVWFVLEGEKLYLVP |
| Ga0182032_114408171 | 3300016357 | Soil | MPSARDGLKERLAKYRQMKLSVIGRKSGKPISIPVWFV |
| Ga0181515_14611611 | 3300016730 | Peatland | MPTAKDDLKERLARYRQTKLSVIGRKSGKAISIPVWFVVESGKLCLLPVR |
| Ga0187802_104319441 | 3300017822 | Freshwater Sediment | VKQSELNDRLARYRQIKLSVVGRESGKTISIPVWF |
| Ga0187820_10172293 | 3300017924 | Freshwater Sediment | MPTAKDDLKDRLARYRQVKISVFGRKSGETISIPVWFVLEGE |
| Ga0187814_102483481 | 3300017932 | Freshwater Sediment | VPTAKDSLKDRLVRYRQITIGVIGRKSGRKISRPVW |
| Ga0187803_102533072 | 3300017934 | Freshwater Sediment | MQTPNNDLKDRLARYREIKISVIGRKSGRTIAIAVWFVLEGDKLYLL |
| Ga0187803_104104832 | 3300017934 | Freshwater Sediment | AGSKDSLRDRLARYRQIKISVVGRKSGRTISIPVWKW |
| Ga0187803_104580092 | 3300017934 | Freshwater Sediment | VKNNDLEARLARFRQIKLTVIGRKTGQTISIPVWFVL |
| Ga0187775_103168421 | 3300017939 | Tropical Peatland | MTDSAEDLKTRLARTRQIKILVTGRKSGATITIPVWFVLDEDKLYLL |
| Ga0187808_102762553 | 3300017942 | Freshwater Sediment | VKDSLRERLERYRQVQLSVTGRKSGKTITIPVWFVLDG |
| Ga0187808_104214362 | 3300017942 | Freshwater Sediment | MEVRMAGSKDSPKDRLSRCRQIKISVIGRQSGRMISIPVWFILEGAKR |
| Ga0187819_101873232 | 3300017943 | Freshwater Sediment | MAGSKDSPKDRLSRCRQIKISVIGRQSGRMISIPVWFILEGAKR |
| Ga0187819_105996342 | 3300017943 | Freshwater Sediment | MKQSELKARLARFRQIRISVIGRKSGQTISIPIER |
| Ga0187879_100565381 | 3300017946 | Peatland | MPSSGETLKERLARYRQIKMSMIGRKFGKTISIPVS |
| Ga0187879_103786021 | 3300017946 | Peatland | PKPKDNLKERLTHYRQIKPSVIGRKSGRTISAVSAED |
| Ga0187879_107162591 | 3300017946 | Peatland | MKESDLEDRLARYRQIKVSVVGRKSGKTIPIPVWFVLEDEKLYL |
| Ga0187847_101212842 | 3300017948 | Peatland | MKRSIDSLKDRLARYRQIKISVIGRKSGQTISIPVWFVLEGEKLYLL |
| Ga0187876_10028595 | 3300018003 | Peatland | MPRKTDDLKERLARYRQIKISVIGRKSGQTISIPV |
| Ga0187876_10919592 | 3300018003 | Peatland | VTSSTDNLKDRLARYRQIKLSVIGRKSGPTISIPVWFVLEGE |
| Ga0187878_13185771 | 3300018005 | Peatland | MPTPKKIDLKDRLSHYRQIKISVIGRKSGQTISIPVWFV |
| Ga0187810_101895862 | 3300018012 | Freshwater Sediment | MHNLKVTTSKDTLKARLARFRQIKLSVIGRKSGKAISIPVWFHP |
| Ga0187810_102642992 | 3300018012 | Freshwater Sediment | MAGSKDSPKDRLSRCREIKISVIGRKSGRMISIPVWFILEGAKR |
| Ga0187861_104301172 | 3300018020 | Peatland | MAGSKDGIKDRLARYRQIKLGVIGRKSGQTISIPVWFVLE |
| Ga0187882_11191611 | 3300018021 | Peatland | MPTLKKIDLKDRFARYRQIKISVVGRKSGRTISIPVWFVLE |
| Ga0187864_102215172 | 3300018022 | Peatland | VPSSSETLKDRLARYRQIKLSVIGRKSGKTISIPVRFVLEDEKLYLLPVRGSEPF |
| Ga0187857_100789841 | 3300018026 | Peatland | MPTLKKIDLKDRFARYRQIKISVVGRKSGRTISIPVWFVLEGERL |
| Ga0187857_101263991 | 3300018026 | Peatland | MPTAKDDLKERLARYRQTKLSVIGRKSGKAISIPVWFVVESGKLCL |
| Ga0187869_102457081 | 3300018030 | Peatland | VTSSTDNLKDRLARYRQIKLSVIGRKSGPTISIPVWFV |
| Ga0187772_109935192 | 3300018085 | Tropical Peatland | MATSKNTLRERLARYRQINLTVTGRKSGKVISIPVWFVLDGEKLYL |
| Ga0187769_100180017 | 3300018086 | Tropical Peatland | MAGKNGLKERLARYRQITISVTGRKSGKTISNPVWFVLEGD |
| Ga0187770_108040143 | 3300018090 | Tropical Peatland | MSTGTTSSKDDLKARLTRFRQIKLGVIGRKSGKTISIPVWFVL |
| Ga0066662_116983241 | 3300018468 | Grasslands Soil | MPSSKKTLKARLARYRQIKISVIGRKSGRTISIPVWF |
| Ga0193715_10295893 | 3300019878 | Soil | MSSPKNVLQQRLAHYRQIKLSVTGRKSGRTISVPVWFVLDGLAVCGI |
| Ga0193707_10010625 | 3300019881 | Soil | MSSPKNDLQQRLAHYRQIKLSVTGRKSGRTISVPVWFVLDGLAVCGI |
| Ga0210403_100152321 | 3300020580 | Soil | MPTQKDALKDHLSRYRQIKISVIGRKSGRTISNPVWFVLDDEKLY |
| Ga0210403_102936901 | 3300020580 | Soil | MPNPKATVKERLARYRQIKISVIGRKSGEPISIPVWFV |
| Ga0210399_111160192 | 3300020581 | Soil | VATSKDLLRERLGRYREITIRVIGRKSGRKISIPVWFVLEGET |
| Ga0215015_101370797 | 3300021046 | Soil | MPTPENELKERLARYRQIKISVTGRKTGRTISIPVWFIG |
| Ga0210408_107956501 | 3300021178 | Soil | VTVAKDTLMERLARYRQIKISVIGRKSGKTISIPVWFVLE |
| Ga0210397_110936142 | 3300021403 | Soil | MPRKSNNLKDRLARYRQIKLSVIGRKSGKTISNPVWFVAE |
| Ga0210384_107367952 | 3300021432 | Soil | MLTQKDALKDRLARYRQIQITVIGWKSGHKTSGIKKP |
| Ga0210390_112036281 | 3300021474 | Soil | VSAPKDSLKERLARYRQIKISVIGRKSGKTISIPV |
| Ga0210402_102928163 | 3300021478 | Soil | MLTQKDTLKDRLARYCQIRITVIGRKSGRTISMPDTATS |
| Ga0210402_110111921 | 3300021478 | Soil | MPTPKDNLKERLSRCRQIKISVIERKSGKTISIPVWF |
| Ga0224545_10022816 | 3300022881 | Soil | MPNAKDSLQDRLVRYRQINISVIGRKSGKTISIPVWFVLESEKLYLLLVPLCKHTEQR |
| Ga0224551_10893131 | 3300023259 | Soil | MPSCECSLKERLTRYRQIKISVSGRKSGKTISIPVWFVLEGGKLYLL |
| Ga0209171_1000280125 | 3300025320 | Iron-Sulfur Acid Spring | MPNLKDNLKERLSRYRQIAISVIARKSGKTVSIPVWFVLDGEKLYLLP |
| Ga0209881_11880491 | 3300026273 | Soil | MTGSKDVLENRLLRYRQIKISVIGRKSGRTISIPVWFVLE |
| Ga0209154_10422826 | 3300026317 | Soil | VTASKGSLKERLSRYRQIKVSVIGRKSGQTISIPVWFVLEGEKLYLL |
| Ga0209803_10107361 | 3300026332 | Soil | VPSSKETLKDRLPRYRQIKLSVTGRKSGKMISMPVWFVL |
| Ga0209158_13436081 | 3300026333 | Soil | MPAPKDSLKDRLARYRHIKISVIGRKSGQTISIPVWFVLEGE |
| Ga0209806_11088421 | 3300026529 | Soil | VKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLEGEKLY |
| Ga0209806_11426801 | 3300026529 | Soil | VPSSKETLKDRLPRYRQIKLSVTGRKSGKMISMPVWFVLEGEKLY |
| Ga0179587_101799613 | 3300026557 | Vadose Zone Soil | MPTQKDTLKNRLARYRQIKISLIGRRSGQIISVPVWFILEVEKLFLLPT |
| Ga0208730_10017791 | 3300027047 | Forest Soil | MPTQKDALKDHLSRYRQIKISVIGRKSGRTISNPV |
| Ga0209220_10636201 | 3300027587 | Forest Soil | MPTPKDSLKERLARYRQIKITVVGRNSGKTISNPVWFVLE |
| Ga0208324_11635891 | 3300027604 | Peatlands Soil | MTGSTEDLKKRLGRTRQIKISVTGRKSGATITIPVWFVLEADKLYL |
| Ga0208827_11501141 | 3300027641 | Peatlands Soil | MPTPKDDLKDRLARYRQIEISVIGRKSGQTISIPVWFVLEGEK |
| Ga0209007_11622611 | 3300027652 | Forest Soil | VATSKDTLKERLARYRQIKISVIGRKSGRKISIPV |
| Ga0209011_10284871 | 3300027678 | Forest Soil | VTAPKGSIKERLSRYREIKLSVTGRKSGQTISIPV |
| Ga0209446_12054382 | 3300027698 | Bog Forest Soil | MPTAKDSLKDRLARYRQITIGVIGRKSRRKISIPVWFALEDSDTLYLL |
| Ga0209908_100356101 | 3300027745 | Thawing Permafrost | LIERTPMSHSSNDTLKDRLARYRQINISVIGRKSGHTISIPVWFVVEGEKLY |
| Ga0209689_12127691 | 3300027748 | Soil | VRSSKETLKDRLPRYRQIKLSVTGRKSGKMISMPVWFV |
| Ga0209689_12779711 | 3300027748 | Soil | VKENKLKDRLARYRQIKLSVTGRKSGKMISMPVWFVLEGEKLYL |
| Ga0209772_102592482 | 3300027768 | Bog Forest Soil | VPTVKDSLRERLARYRQIRISVTGRKSGRTVTIPVW |
| Ga0209448_101109772 | 3300027783 | Bog Forest Soil | MAHSSKDSLKERLARYRQIKLSVIGRKSGKTISIPVWFVVEGHKL |
| Ga0209274_100223513 | 3300027853 | Soil | MKPSTDNLKDRLARYREIKISVIGRKSGKTISIPISICFV |
| Ga0209517_100154648 | 3300027854 | Peatlands Soil | MPTSKATLKDRLARYRQIKLSVIGRKTGQTISIPV |
| Ga0209283_104114141 | 3300027875 | Vadose Zone Soil | MPTQKDTLKDRLARYRQIKISVIGPKSGQTISIPVWFVLEDKKLY |
| Ga0209624_109464411 | 3300027895 | Forest Soil | VATPKNILKERLGRYRQIKISVIGRKSGQRISIPVWFVLE |
| Ga0137415_101814262 | 3300028536 | Vadose Zone Soil | MPTQKDTLKNRLARYRQIKISLIGRRSGQIISVPVWFILEGEKLFLLPT |
| Ga0302219_100681992 | 3300028747 | Palsa | MPVSKDNLKDRLARYREIRISVIGRKSGKTISVPV |
| Ga0308309_101566226 | 3300028906 | Soil | VTVAKDTLKEHLARYRQIKISVIGRKSGKTISIPVWFVLEGKKVYLLPV |
| Ga0308309_118817102 | 3300028906 | Soil | VPKPKDDLEDRLSRYRQIKISVIGRKSGKTISNPVWFVAEGETL |
| Ga0311333_115365301 | 3300030114 | Fen | VKESELKSRLTRYRQIKLSVICRKSGQTISVPAWFVLEGERLYLLP |
| Ga0310039_100402611 | 3300030706 | Peatlands Soil | VKESELKARLARYREIKISVIGRKSGKTISMPVWFVL |
| Ga0310038_104459041 | 3300030707 | Peatlands Soil | MPKPKDDLKERLSRYRQIKISVIGRKSGTTISVPVWFVLEG |
| Ga0265460_124306011 | 3300030740 | Soil | MPTVRNGLEERLARYRQIKIGLIGRKSGKTISIPVWFVLEDEKL |
| Ga0170822_166555722 | 3300031122 | Forest Soil | MQTPNNDLKQHLTRYRQIKISVIGRKSGKTISIPVCFVLEGEKLSLH |
| Ga0310686_1172133151 | 3300031708 | Soil | VATAQDILKERLGRYRQITTSVIGRKSGRRISIPVW |
| Ga0307476_100239978 | 3300031715 | Hardwood Forest Soil | VTVAKDTLKEHLARYRQIKISVIGRKSGKTISIPVWFVLEGKKV |
| Ga0307476_104808772 | 3300031715 | Hardwood Forest Soil | MTGAKDTLKEHLARYRQIKISVIGRKSGKTISIPVWFVLEGKKV |
| Ga0307469_118425902 | 3300031720 | Hardwood Forest Soil | MPPPKDDLKERLARYRQIKLSVIGRKSGKTISMPVWFVLE |
| Ga0307475_108809242 | 3300031754 | Hardwood Forest Soil | VPTSKDTLKERLTRYRQIKISVIGRKSGRKISMPVWF |
| Ga0307473_112430761 | 3300031820 | Hardwood Forest Soil | VQSSKKNDLKSRLARYRQIKLSVIGRKSGRTISIPVWFVL |
| Ga0310909_116786041 | 3300031947 | Soil | MPTPKDDLKQRLASYRQIKLSVIGRKSGRTISVPVWFVLE |
| Ga0306926_123679902 | 3300031954 | Soil | MPTPKDDLKQRLASYRQIKLSVIGRKSGRTISVPVWFVLEAEKLLLLS |
| Ga0311301_103787471 | 3300032160 | Peatlands Soil | MPNQKDNLKDRLTRYRQIKIIVVGRKSGKTISIPVWFVLESDKLFCQ |
| Ga0311301_114000652 | 3300032160 | Peatlands Soil | MAVSKDGLRHRLARYRQIKISVIGRKSGWKISIPA |
| Ga0307471_1034145062 | 3300032180 | Hardwood Forest Soil | MPSAKETLKDRLTRYQQIKISVTGRKLGREISIPVWFVLDGEKL |
| Ga0335079_116345541 | 3300032783 | Soil | MPKSNSELKERLERYRQIKITVVGRKSGKDISIPVWFV |
| Ga0335074_100270737 | 3300032895 | Soil | MAHFSKELKERLARYKQIQLGVTGRKSGRTISRPVWFVV |
| ⦗Top⦘ |