


| Basic Information | |
|---|---|
| Family ID | F035405 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AGVVLVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.58 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 86.63 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.349 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.372 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.581 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.953 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF02652 | Lactate_perm | 5.23 |
| PF06224 | HTH_42 | 3.49 |
| PF16177 | ACAS_N | 2.91 |
| PF07690 | MFS_1 | 2.91 |
| PF01979 | Amidohydro_1 | 2.33 |
| PF00486 | Trans_reg_C | 2.33 |
| PF07729 | FCD | 1.74 |
| PF00909 | Ammonium_transp | 1.74 |
| PF13722 | CstA_5TM | 1.74 |
| PF03466 | LysR_substrate | 1.74 |
| PF14833 | NAD_binding_11 | 1.16 |
| PF05199 | GMC_oxred_C | 1.16 |
| PF05163 | DinB | 1.16 |
| PF02075 | RuvC | 1.16 |
| PF01663 | Phosphodiest | 1.16 |
| PF13193 | AMP-binding_C | 1.16 |
| PF01370 | Epimerase | 1.16 |
| PF06439 | 3keto-disac_hyd | 1.16 |
| PF14588 | YjgF_endoribonc | 1.16 |
| PF09957 | VapB_antitoxin | 0.58 |
| PF13470 | PIN_3 | 0.58 |
| PF11746 | DUF3303 | 0.58 |
| PF01081 | Aldolase | 0.58 |
| PF13432 | TPR_16 | 0.58 |
| PF04055 | Radical_SAM | 0.58 |
| PF17167 | Glyco_hydro_36 | 0.58 |
| PF05598 | DUF772 | 0.58 |
| PF00365 | PFK | 0.58 |
| PF04608 | PgpA | 0.58 |
| PF02754 | CCG | 0.58 |
| PF03060 | NMO | 0.58 |
| PF13545 | HTH_Crp_2 | 0.58 |
| PF01402 | RHH_1 | 0.58 |
| PF01326 | PPDK_N | 0.58 |
| PF13620 | CarboxypepD_reg | 0.58 |
| PF06127 | Mpo1-like | 0.58 |
| PF02371 | Transposase_20 | 0.58 |
| PF01566 | Nramp | 0.58 |
| PF13521 | AAA_28 | 0.58 |
| PF13401 | AAA_22 | 0.58 |
| PF01471 | PG_binding_1 | 0.58 |
| PF05974 | DUF892 | 0.58 |
| PF03916 | NrfD | 0.58 |
| PF09821 | AAA_assoc_C | 0.58 |
| PF01087 | GalP_UDP_transf | 0.58 |
| PF07687 | M20_dimer | 0.58 |
| PF07719 | TPR_2 | 0.58 |
| PF13450 | NAD_binding_8 | 0.58 |
| PF13709 | DUF4159 | 0.58 |
| PF02357 | NusG | 0.58 |
| PF09363 | XFP_C | 0.58 |
| PF12838 | Fer4_7 | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF00933 | Glyco_hydro_3 | 0.58 |
| PF01568 | Molydop_binding | 0.58 |
| PF00083 | Sugar_tr | 0.58 |
| PF04185 | Phosphoesterase | 0.58 |
| PF08282 | Hydrolase_3 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG1620 | L-lactate permease | Energy production and conversion [C] | 5.23 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 3.49 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.33 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 1.74 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.74 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.74 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 1.16 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.16 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.16 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.58 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.58 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.58 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.58 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.58 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 0.58 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.58 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.58 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.58 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.58 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.58 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.35 % |
| Unclassified | root | N/A | 29.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100137395 | Not Available | 2308 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100193315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
| 3300004152|Ga0062386_101782343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300004971|Ga0072324_1244418 | Not Available | 688 | Open in IMG/M |
| 3300005176|Ga0066679_10592231 | Not Available | 723 | Open in IMG/M |
| 3300005434|Ga0070709_11511843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300005436|Ga0070713_100870466 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005542|Ga0070732_10452349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300005542|Ga0070732_10631503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005591|Ga0070761_10042182 | Not Available | 2562 | Open in IMG/M |
| 3300005712|Ga0070764_10612820 | Not Available | 664 | Open in IMG/M |
| 3300005898|Ga0075276_10007048 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300006052|Ga0075029_100485235 | Not Available | 814 | Open in IMG/M |
| 3300006059|Ga0075017_100610158 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006059|Ga0075017_101193799 | Not Available | 596 | Open in IMG/M |
| 3300006059|Ga0075017_101573591 | Not Available | 519 | Open in IMG/M |
| 3300006174|Ga0075014_100947589 | Not Available | 518 | Open in IMG/M |
| 3300009522|Ga0116218_1436299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300009523|Ga0116221_1027811 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
| 3300009523|Ga0116221_1319984 | Not Available | 672 | Open in IMG/M |
| 3300009524|Ga0116225_1301809 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 715 | Open in IMG/M |
| 3300009617|Ga0116123_1119661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300009624|Ga0116105_1243801 | Not Available | 509 | Open in IMG/M |
| 3300009628|Ga0116125_1191286 | Not Available | 579 | Open in IMG/M |
| 3300009629|Ga0116119_1156273 | Not Available | 569 | Open in IMG/M |
| 3300009631|Ga0116115_1154917 | Not Available | 581 | Open in IMG/M |
| 3300009632|Ga0116102_1043899 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300009635|Ga0116117_1010140 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300009635|Ga0116117_1170855 | Not Available | 566 | Open in IMG/M |
| 3300009644|Ga0116121_1066150 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300009646|Ga0116132_1105446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300009683|Ga0116224_10650720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 504 | Open in IMG/M |
| 3300009759|Ga0116101_1166997 | Not Available | 547 | Open in IMG/M |
| 3300009764|Ga0116134_1015984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 3120 | Open in IMG/M |
| 3300009764|Ga0116134_1217307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300009824|Ga0116219_10014478 | All Organisms → cellular organisms → Bacteria | 5002 | Open in IMG/M |
| 3300010343|Ga0074044_11175729 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010379|Ga0136449_103466639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300011082|Ga0138526_1042691 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012202|Ga0137363_10522355 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300014153|Ga0181527_1254368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300014153|Ga0181527_1336723 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300014161|Ga0181529_10398640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300014162|Ga0181538_10659719 | Not Available | 543 | Open in IMG/M |
| 3300014165|Ga0181523_10561930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 628 | Open in IMG/M |
| 3300014169|Ga0181531_10152094 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300014200|Ga0181526_10001313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 23881 | Open in IMG/M |
| 3300014200|Ga0181526_10096534 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300014200|Ga0181526_10871629 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300014200|Ga0181526_10955305 | Not Available | 539 | Open in IMG/M |
| 3300014201|Ga0181537_10668888 | Not Available | 706 | Open in IMG/M |
| 3300014489|Ga0182018_10079208 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300014492|Ga0182013_10246172 | Not Available | 1038 | Open in IMG/M |
| 3300014493|Ga0182016_10053968 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300014494|Ga0182017_10556224 | Not Available | 700 | Open in IMG/M |
| 3300014494|Ga0182017_10895046 | Not Available | 534 | Open in IMG/M |
| 3300014495|Ga0182015_10109277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1911 | Open in IMG/M |
| 3300014638|Ga0181536_10026183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4508 | Open in IMG/M |
| 3300014638|Ga0181536_10343920 | Not Available | 680 | Open in IMG/M |
| 3300014655|Ga0181516_10377916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300014655|Ga0181516_10483727 | Not Available | 635 | Open in IMG/M |
| 3300014657|Ga0181522_10142216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1400 | Open in IMG/M |
| 3300014657|Ga0181522_10559813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300014657|Ga0181522_10622221 | Not Available | 656 | Open in IMG/M |
| 3300016702|Ga0181511_1281997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300016728|Ga0181500_1252923 | Not Available | 603 | Open in IMG/M |
| 3300017823|Ga0187818_10040411 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300017925|Ga0187856_1143614 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300017928|Ga0187806_1179483 | Not Available | 710 | Open in IMG/M |
| 3300017935|Ga0187848_10105198 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300017955|Ga0187817_10185938 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300017973|Ga0187780_10958676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300017995|Ga0187816_10226349 | Not Available | 815 | Open in IMG/M |
| 3300018006|Ga0187804_10040540 | Not Available | 1792 | Open in IMG/M |
| 3300018013|Ga0187873_1330693 | Not Available | 557 | Open in IMG/M |
| 3300018017|Ga0187872_10167904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300018017|Ga0187872_10394604 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018024|Ga0187881_10425430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
| 3300018026|Ga0187857_10179058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300018026|Ga0187857_10372101 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300018030|Ga0187869_10181808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1034 | Open in IMG/M |
| 3300018030|Ga0187869_10256248 | Not Available | 847 | Open in IMG/M |
| 3300018033|Ga0187867_10349723 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300018035|Ga0187875_10116712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300018035|Ga0187875_10163457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300018035|Ga0187875_10366076 | Not Available | 773 | Open in IMG/M |
| 3300018037|Ga0187883_10648616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 549 | Open in IMG/M |
| 3300018037|Ga0187883_10713575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018038|Ga0187855_10024287 | All Organisms → cellular organisms → Bacteria | 3931 | Open in IMG/M |
| 3300018040|Ga0187862_10799063 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018043|Ga0187887_10824022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 549 | Open in IMG/M |
| 3300018047|Ga0187859_10294438 | Not Available | 878 | Open in IMG/M |
| 3300018057|Ga0187858_10552338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300018058|Ga0187766_10558642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300018062|Ga0187784_11144221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300018085|Ga0187772_10024106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium 4572_32.1 | 3547 | Open in IMG/M |
| 3300018085|Ga0187772_10231483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1250 | Open in IMG/M |
| 3300018085|Ga0187772_10377615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300019275|Ga0187798_1683674 | Not Available | 707 | Open in IMG/M |
| 3300019284|Ga0187797_1299478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300019877|Ga0193722_1020003 | Not Available | 1728 | Open in IMG/M |
| 3300021088|Ga0210404_10082113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
| 3300021168|Ga0210406_10007525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11034 | Open in IMG/M |
| 3300021180|Ga0210396_11093754 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021402|Ga0210385_11041865 | Not Available | 628 | Open in IMG/M |
| 3300021402|Ga0210385_11233512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300021433|Ga0210391_10330172 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300021474|Ga0210390_10083624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2650 | Open in IMG/M |
| 3300022518|Ga0224548_1034637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300022522|Ga0242659_1083572 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300022877|Ga0224527_1079811 | Not Available | 556 | Open in IMG/M |
| 3300023091|Ga0224559_1153376 | Not Available | 818 | Open in IMG/M |
| 3300023101|Ga0224557_1009627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5906 | Open in IMG/M |
| 3300024288|Ga0179589_10428697 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025404|Ga0208936_1031492 | Not Available | 703 | Open in IMG/M |
| 3300025501|Ga0208563_1053777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300025507|Ga0208188_1096038 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025612|Ga0208691_1145361 | Not Available | 534 | Open in IMG/M |
| 3300025906|Ga0207699_10988461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300026529|Ga0209806_1227460 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027376|Ga0209004_1046276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300027591|Ga0209733_1001100 | All Organisms → cellular organisms → Bacteria | 5805 | Open in IMG/M |
| 3300027684|Ga0209626_1150930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027696|Ga0208696_1290750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027842|Ga0209580_10430754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300027842|Ga0209580_10634422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300027854|Ga0209517_10208258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300027869|Ga0209579_10697371 | Not Available | 550 | Open in IMG/M |
| 3300027889|Ga0209380_10539468 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027895|Ga0209624_10175860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300028047|Ga0209526_10169502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300028574|Ga0302153_10074418 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300028748|Ga0302156_10253744 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300028762|Ga0302202_10364178 | Not Available | 679 | Open in IMG/M |
| 3300028765|Ga0302198_10118599 | Not Available | 1411 | Open in IMG/M |
| 3300028789|Ga0302232_10240315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300028873|Ga0302197_10473607 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028906|Ga0308309_10008931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6192 | Open in IMG/M |
| 3300028906|Ga0308309_10047499 | Not Available | 3072 | Open in IMG/M |
| 3300029918|Ga0302143_1117949 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300029943|Ga0311340_11274016 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300029951|Ga0311371_10328873 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300029953|Ga0311343_10600054 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300029986|Ga0302188_10063672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1704 | Open in IMG/M |
| 3300029986|Ga0302188_10217038 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300029999|Ga0311339_10379191 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300030041|Ga0302274_10040308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 2855 | Open in IMG/M |
| 3300030053|Ga0302177_10389964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300030507|Ga0302192_10089662 | Not Available | 1457 | Open in IMG/M |
| 3300030707|Ga0310038_10059432 | Not Available | 2119 | Open in IMG/M |
| 3300030740|Ga0265460_12518378 | Not Available | 548 | Open in IMG/M |
| 3300031235|Ga0265330_10459117 | Not Available | 541 | Open in IMG/M |
| 3300031236|Ga0302324_100569900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300031474|Ga0170818_111177966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300031525|Ga0302326_10176715 | All Organisms → cellular organisms → Bacteria | 3617 | Open in IMG/M |
| 3300031708|Ga0310686_101631939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300031708|Ga0310686_113011614 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031712|Ga0265342_10662801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300031715|Ga0307476_10953184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031754|Ga0307475_10890832 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031823|Ga0307478_11019416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300032205|Ga0307472_102455888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300032783|Ga0335079_10972903 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032805|Ga0335078_12446987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 541 | Open in IMG/M |
| 3300032805|Ga0335078_12553507 | Not Available | 525 | Open in IMG/M |
| 3300032892|Ga0335081_11230269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300033158|Ga0335077_11595136 | Not Available | 621 | Open in IMG/M |
| 3300033158|Ga0335077_11956151 | Not Available | 546 | Open in IMG/M |
| 3300033982|Ga0371487_0302497 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300033983|Ga0371488_0203864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300034282|Ga0370492_0057027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1602 | Open in IMG/M |
| 3300034282|Ga0370492_0415311 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.37% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 10.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.98% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.07% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.49% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.16% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.16% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.16% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.16% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.16% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.16% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.16% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022877 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001373952 | 3300002245 | Forest Soil | IFIAGVILVVFDAVRRWIAVMNGAPAPEEAFGPPITAAGEVKMGCC* |
| JGIcombinedJ26739_1001933151 | 3300002245 | Forest Soil | MCIFIAGVILVVFDAVRRWIAVMNGAPAPEEAFGPPITAAGEVKMGCC* |
| Ga0062386_1017823432 | 3300004152 | Bog Forest Soil | LVVCDAVLRWIKTLNGAPVPQDAFGPPLTVTGEVKMGCC* |
| Ga0072324_12444182 | 3300004971 | Peatlands Soil | LMTIFIVGVILVVFDAVRRWIKTLNGEPAPQEAFGTPLTAAGEVRMGCC* |
| Ga0066679_105922311 | 3300005176 | Soil | FIAGVVLVMIDALRRWYQVLRGAPVPREAFGTPVTASGEIRMGCC* |
| Ga0070709_115118431 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGFIIGVLVILFDALKRWLKVLNGAPAPEEAFGPPLTSAGEIKMGCC* |
| Ga0070713_1008704662 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FILGVVLVLFDAVRRWIQAYKGAPAPVEAFGPPVTATGEVKMGCC* |
| Ga0070732_104523491 | 3300005542 | Surface Soil | VIFVTGVVLVLLDSVRRWYKVLNGAPAPQEAFGPPVTAAGEVKMGCC* |
| Ga0070732_106315031 | 3300005542 | Surface Soil | FDAVRRWIAVLKGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0070761_100421822 | 3300005591 | Soil | VIFIVGVVLVLIEATRRWIAVMRGAPAPEEAFGPPITASGEIKMGCC* |
| Ga0070764_106128202 | 3300005712 | Soil | IFIVGVVLVLIEATRRWIAVMRGAPAPEEAFGPPITASGEIKMGCC* |
| Ga0075276_100070484 | 3300005898 | Rice Paddy Soil | IAAIKRWIMVMNGAPIPEEAFGEPIDEKGEVKMGCC* |
| Ga0075029_1004852352 | 3300006052 | Watersheds | FIVGVVLVVFDAVRRWIATLNGAPAPQEAFGPPLTDAGEVKMGCC* |
| Ga0075017_1006101581 | 3300006059 | Watersheds | VVFDAVRRWIMTLNGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0075017_1011937992 | 3300006059 | Watersheds | VVFDAVRRWIAAMNGAAAPVEAFGPPLTAAGEVKMGCC* |
| Ga0075017_1015735912 | 3300006059 | Watersheds | FILGVVLVVFDAIRRWIAALNGAPAPVEAFGPPLTAAGEVKMGCC* |
| Ga0075014_1009475892 | 3300006174 | Watersheds | MTIFILGVVLVVFNAVRRWIAVLNGAPAPVEAFGPPLTAAGEVKMGCC* |
| Ga0116218_14362991 | 3300009522 | Peatlands Soil | IFIVGVVLVVFDAVRRWFAVLNGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0116221_10278113 | 3300009523 | Peatlands Soil | SILMTIFIVGVVLVVFDAVRRWIAVLKGAPAPQEAFGPPLTAAGEVRMGCC* |
| Ga0116221_13199842 | 3300009523 | Peatlands Soil | GVVLVVFDAVRRWIAVAKGAPAPLEAFGPPLTTAGEVKMGCC* |
| Ga0116225_13018091 | 3300009524 | Peatlands Soil | ILMTIFIVGVVLVVFDAVRRWFAVLNGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0116123_11196612 | 3300009617 | Peatland | IFILGVILVVFDAVRRWIAVLRGAPAPQEAFGPPVTAGGEVKMGCC* |
| Ga0116105_12438011 | 3300009624 | Peatland | AVRRWIAVLNGAPAPQEAFGPPLTVSGEVKMGCC* |
| Ga0116125_11912862 | 3300009628 | Peatland | LVVFDAVGRWIAAANGAPTPREAFGPPLTAGGEVKMGCC* |
| Ga0116119_11562732 | 3300009629 | Peatland | LMAIFIVGVVLVGFNAARRWIAVLRGAPAPEEAFGEPVTAGGEIKMGCC* |
| Ga0116115_11549171 | 3300009631 | Peatland | IVGVVLVVFDAARRWIAVLKGAPLPQEAFGPPLTAVGDVKMGCC* |
| Ga0116102_10438993 | 3300009632 | Peatland | LVVFAAARRWVAVLQGAPAPEEAFGEPVTEGGDVKMGCC* |
| Ga0116117_10101403 | 3300009635 | Peatland | VLLVVFDAARRWIATLNGAPVPTEAFGPPLTTTGEVKMGCC* |
| Ga0116117_11708551 | 3300009635 | Peatland | FLVVFDAVGRWIAAANGAPTPREAFGPPLTAGGEVKMGCC* |
| Ga0116121_10661501 | 3300009644 | Peatland | DAVRRWIAVLNGAPAPTEAFGPPVTVEGEIRMGCC* |
| Ga0116132_11054461 | 3300009646 | Peatland | IFIVGVVLVVFDAARRWIAVLNGAPLPQEAFGPPLTAVGDVKMGCC* |
| Ga0116224_106507201 | 3300009683 | Peatlands Soil | ILVLFDAVRRWIAVSNGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0116101_11669972 | 3300009759 | Peatland | YLDTTLMAIFIIGVVLVVFNAVQRWVAVLNGAPAPTEAFGPPVTVEGEVKMGCC* |
| Ga0116134_10159841 | 3300009764 | Peatland | VLVVIDAVRRWIKTLNGAPVPQEAFGPPLTAAGEVKMGCC* |
| Ga0116134_12173072 | 3300009764 | Peatland | IFIVGVVLVVFSAVRRWIAVLNGAPAPQEAFGPPLTDNGDVKMGCC* |
| Ga0116219_100144781 | 3300009824 | Peatlands Soil | TIFIAGVVLVVFDAVRRWIMVAKGAPAPLEAFGPPLTAAGEVKMGCC* |
| Ga0074044_111757291 | 3300010343 | Bog Forest Soil | SVLMTIFILGVVLVVFDAVRRWIAVAKGAPAPQEAFGPPLTATGEVKMGCC* |
| Ga0136449_1034666392 | 3300010379 | Peatlands Soil | VVFDAVRRWIKTLNGEPAPQEAFGTPLTAAGEVRMGCC* |
| Ga0138526_10426912 | 3300011082 | Peatlands Soil | FIAGVILVVFDAVRRWIAVLNGAPAPVEAFGPPLTAAGEVKMGCC* |
| Ga0137363_105223551 | 3300012202 | Vadose Zone Soil | IFILGVVLVVFDAVRRWIAVLNGAPAPVEAFGPPLNAAGEVKMGCC* |
| Ga0181527_12543682 | 3300014153 | Bog | AAWRWYRVFKGAPIPQEAFGPPLTVSGDVKMGCC* |
| Ga0181527_13367232 | 3300014153 | Bog | LTGIFILGVVLVVCDAARRWVAVLNGAEPPAEAFGEPVTAAGEIKMGCC* |
| Ga0181529_103986401 | 3300014161 | Bog | TTLMGIFIVGVILVLFDAARRWIAVLRGAAPPAEAFGPPVITKEQVKMGCC* |
| Ga0181538_106597192 | 3300014162 | Bog | FIVGVIVVVFEAVRRWIKVLNGAPAPQEAFGPPLTAAGDVKMGCC* |
| Ga0181523_105619302 | 3300014165 | Bog | AGVVLVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGEVKMGCC* |
| Ga0181531_101520941 | 3300014169 | Bog | ILVVFDAVRRWIATLNGAPVPTEAFGPPLTDAGEVKMGCC* |
| Ga0181526_100013131 | 3300014200 | Bog | ILTTIFIVGVLLVAFGALRRWIAVLNGAPAPAEAFGPPMTPDGEVRMGCC* |
| Ga0181526_100965342 | 3300014200 | Bog | MGFTGYQDTTLMVIFITGVVLVLIDAFRRWIMVLNGAPVPEEAFGPPVAPNGEVVKMRCC |
| Ga0181526_108716292 | 3300014200 | Bog | VLVVFDAVRRWIAVLNGAPAPTEAFGPPVTVEGEIRMGCC* |
| Ga0181526_109553052 | 3300014200 | Bog | VVFDAARRWIAVLNGAQPPAEAFGPPLTAGNEIKMGCC* |
| Ga0181537_106688882 | 3300014201 | Bog | WLDTVLMIVFITGVVLVVADAVRRWIMVLNGAPVPVEAFGPPVTKEGEIKMGCC* |
| Ga0182018_100792083 | 3300014489 | Palsa | VGVVLVVFSAVRRWIAVLNGAPAPQEAFGPPLTAAGDVKMGCC* |
| Ga0182013_102461721 | 3300014492 | Bog | KWFAGWLDTCLMVLFITGVILVLIDAIRRWFLVLNGAPPPEEAFGPPVSKEGEIKMGCC* |
| Ga0182016_100539687 | 3300014493 | Bog | VIFITGVVLVLIDAIRRWIMVLNGAPVPVEAFGPPVTEKGEVKMGCC* |
| Ga0182017_105562243 | 3300014494 | Fen | MAIFIAGVILVVLHAVRRWVAVWNGAPVPPEAFGPPAGADGAIRMGCC* |
| Ga0182017_108950462 | 3300014494 | Fen | VLVVFDSARRWIAVLRGAPAPVEAFGPPVGAGGDIRMGCC* |
| Ga0182015_101092771 | 3300014495 | Palsa | TIFIAGVLLVVFGAVRRWTAVLNGAPAPVEAFGPPVTPDGDVRMGCC* |
| Ga0181536_100261835 | 3300014638 | Bog | LVVFDAVRRWIAVSKGAAPPAEAFGPPVSAAGEIKMGCC* |
| Ga0181536_103439201 | 3300014638 | Bog | IFIVGVVLVVFDAVRRWIAVSKGAAPPAEAFGPPVTAGGEIKMGCC* |
| Ga0181516_103779161 | 3300014655 | Bog | FITGVVLVLIDAFRRWIMVLNGAPVPEEAFGPPVAPNGEVVKMRCC* |
| Ga0181516_104837271 | 3300014655 | Bog | ITGVILVLIDAIRRWIMVLNGAPVPVEAFGPPVSEKGEVKMGCC* |
| Ga0181522_101422163 | 3300014657 | Bog | GVVLVVFDAVRRWIATLNGAPAPKEAFGPPITDKGEIKMGCC* |
| Ga0181522_105598132 | 3300014657 | Bog | GVVLVVFDAVRRWIATLNGAPAPKEAFGPPITDEGEIKMGCC* |
| Ga0181522_106222211 | 3300014657 | Bog | LLMTIFIVGVVLVLIDSVRRWIMVLNGAPVPEEAFGPPVIAAGAANARCC* |
| Ga0181511_12819972 | 3300016702 | Peatland | VVLVVCDAARRWIKTLNGAPAPVEAFGPPLTVTGEVKMGCC |
| Ga0181500_12529231 | 3300016728 | Peatland | MVIFITGVVLVLIDAVRRWIMVLNGAPVPVEAFGPPVTEKGEVKMGCC |
| Ga0187818_100404111 | 3300017823 | Freshwater Sediment | GVVLVVFDAVRRWIMVAKGAPAPMEAFGPPLTAAGEVKMGCC |
| Ga0187856_11436142 | 3300017925 | Peatland | FDAVRRWIAVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0187806_11794831 | 3300017928 | Freshwater Sediment | MTIFIVGVVLVVFNAVRRWFLVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0187848_101051982 | 3300017935 | Peatland | SILMGIFIVGVVLVVFDAVRRWIAVSKGAAPPAEAFGPPVTAGGEIKMGCC |
| Ga0187817_101859383 | 3300017955 | Freshwater Sediment | VLVVFDAVRRWIAVLNGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0187780_109586761 | 3300017973 | Tropical Peatland | IVGVILVLFNAAWSWYRVLHGAPVPQEAFGPPLTDSGDVKMGCC |
| Ga0187816_102263491 | 3300017995 | Freshwater Sediment | MSIFIVGVVLVLFDAVRRWIKVAKGAPAPLEAFGPPLTAAGEVKMGCC |
| Ga0187804_100405403 | 3300018006 | Freshwater Sediment | IVGVVLVVFNAVRRWFLVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0187873_13306932 | 3300018013 | Peatland | VVVFEAVRRWIKVLNGAPAPQEAFGPPLTATGDVKMGCC |
| Ga0187872_101679042 | 3300018017 | Peatland | VGVVLVVFDAVRRWIKTLNGAPVPQEAFGPPLTAAGEVKMGCC |
| Ga0187872_103946042 | 3300018017 | Peatland | FNAVQRWVAVLNGAPAPTEAFGPPVTVEGEVKMGCC |
| Ga0187881_104254302 | 3300018024 | Peatland | FDAVRRWIAVLRGAPAPQEAFGPPVTAGGEVKMGCC |
| Ga0187857_101790581 | 3300018026 | Peatland | IVGVILVVFDAVRRWIKTLNGEPAPQEAFGTPLTAAGEVRMGCC |
| Ga0187857_103721012 | 3300018026 | Peatland | LVVFDAVRRWIAVLNGAPAPTEAFGPPVTVEGEIRMGCC |
| Ga0187869_101818081 | 3300018030 | Peatland | DAVRRWIKTLNGAPAPQECFGPPLTATGEVRMGCC |
| Ga0187869_102562482 | 3300018030 | Peatland | SGLMAIFIVGVVLVGCSAARRWIAVLRGAPAPEEAFGEPVTEGGDVKMGCC |
| Ga0187867_103497232 | 3300018033 | Peatland | VVVDAVRRWILTLNGSPAPRECFGPPLTATGEVKMGCC |
| Ga0187875_101167122 | 3300018035 | Peatland | DSALISIFIVGVVLVVFSAARRWIAVLNGAPAPTEAFGPPLTAAGDVKMGCC |
| Ga0187875_101634572 | 3300018035 | Peatland | ILGVILVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGDVKMGCC |
| Ga0187875_103660761 | 3300018035 | Peatland | TTIFIAGVLLVAFGALRRWIAVLNGAPAPAEAFGPPVTPDGEVRMGCC |
| Ga0187883_106486162 | 3300018037 | Peatland | GVVLVVFDAARRWAAVWNGAPPPAEAFGKPVTAAGNVKMGCC |
| Ga0187883_107135752 | 3300018037 | Peatland | VILVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGDVKMGCC |
| Ga0187855_100242871 | 3300018038 | Peatland | ILTTIFIVGVLLVAFGALRRWIAVLNGAPAPAEAFGPPMTPDGEVRMGCC |
| Ga0187862_107990632 | 3300018040 | Peatland | VGVVLVVFNAARRWIAVLHGAPAPDDAFGEPVNDAGDIKMGCC |
| Ga0187887_108240221 | 3300018043 | Peatland | IFIVGVVLVVFSAARRWIAVMQGAPAPQEAFGEPVTAAGEIKMGCC |
| Ga0187859_102944383 | 3300018047 | Peatland | LMSIFIIGVVLVVFDAVRRWIATLNGAPVPQEAFGPPLTEAGEVKMGCC |
| Ga0187858_105523381 | 3300018057 | Peatland | IFIVGVVLVVFSAVRRWIAVLNGAPAPTEAFGPPLTAAGDVKMGCC |
| Ga0187766_105586421 | 3300018058 | Tropical Peatland | IVGVVLVLFNAAWSWYRVLHGAPVPQEAFCPPLTAAGDVKMGCC |
| Ga0187784_111442211 | 3300018062 | Tropical Peatland | SIFIVGVVLVVFDAARRWVAAWNGAPAPTEAFGSPITAEGEVRMGCC |
| Ga0187772_100241061 | 3300018085 | Tropical Peatland | VFNAMRRWFLVLNGAPAPQEAFGPPLTAAGEVNMGCC |
| Ga0187772_102314832 | 3300018085 | Tropical Peatland | GVILVVFDAVRRWIAVLQGAPAPQEAFGPPLTVTGEVKMGCC |
| Ga0187772_103776152 | 3300018085 | Tropical Peatland | FDAVRRWMAVVNGAPAPQEAFGSPLTSAGEVKMGCC |
| Ga0187798_16836742 | 3300019275 | Peatland | MAIFIVGVVLVIFDAVRRWIAAANGAPVPQEAFGPPLTVAGEVKMG |
| Ga0187797_12994781 | 3300019284 | Peatland | MTLFIVGVVLVVFDAVRRWFAAMHGAPVPAEAFGPPVTDSGDIKMGCC |
| Ga0193722_10200032 | 3300019877 | Soil | QPARRWIKTLNGEPAPQEAFGPPLTEAGEVKMGCC |
| Ga0210404_100821131 | 3300021088 | Soil | VLVLLDSVRRWYLVLKGAPAPQEAFGPPITAAGEIKMGCC |
| Ga0210406_100075251 | 3300021168 | Soil | TLMTIFITGVILVVFDAVRRWIAVLNGAPAPQEAFGPPLTTAGEVKMGCC |
| Ga0210396_110937541 | 3300021180 | Soil | MSIFILGVILVLFDAVRRWIAVANGAPAPVEAFGPPLTATGEVKMGCC |
| Ga0210385_110418651 | 3300021402 | Soil | ISIFVVGVVLVVFSAVRRWIAALNGAPAPQEAFGPPLTTSGDVKMGCC |
| Ga0210385_112335121 | 3300021402 | Soil | GAVRRWIAVLNGAPAPAEAFGPPVTEDGGVRMGCC |
| Ga0210391_103301721 | 3300021433 | Soil | FIAGVVLVMFDAVRRWIAVINGAPAPKEAFGPPVTAAGEVKMGCC |
| Ga0210390_100836243 | 3300021474 | Soil | LDSTLMVIFITGVVLVLVDSVRRWYLVFKGAPAPQEAFGPPVSATGEIRMGCC |
| Ga0224548_10346372 | 3300022518 | Soil | TILMSIFIAGVVLVLFDAVRRWIMVAKGAPAPQEAFGPPLTVEGEVKMGCC |
| Ga0242659_10835722 | 3300022522 | Soil | DTILMTIFIVGVVLVVFDAVRRWIMVAKGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0224527_10798111 | 3300022877 | Soil | LDTTLMVIFITGVVLVLIDAIRRWFMVLNGAPVPEEAFGPPVTEKGEVKMGCC |
| Ga0224559_11533761 | 3300023091 | Soil | AIFILGVVLVLIDAVRRWILVLNGAPVPVEAFGPPVTKEGEIKMGCC |
| Ga0224557_10096271 | 3300023101 | Soil | EAVRRWIKVLNGAPAPQEAFGPPLTAAGDVKMGCC |
| Ga0179589_104286971 | 3300024288 | Vadose Zone Soil | GVGLVLFDGVGRWIQALRGVPAPVEAFGRPVTATGEVKMGCC |
| Ga0208936_10314922 | 3300025404 | Peatland | VGVFLVVFDAVGRWIAAANGAPTPREAFGPPLTAGGEVKMGCC |
| Ga0208563_10537773 | 3300025501 | Peatland | IFIVGVVLVVFDAARRWIAVLNGAPLPQEAFGPPLTAVGDVKMGCC |
| Ga0208188_10960381 | 3300025507 | Peatland | DSVLMTIFIVGVVLVVFDAVRRWIKTLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0208691_11453611 | 3300025612 | Peatland | VIFILGVVLVLIDAIRRWILVLNGAPPPEEAFGPPVSKEGEVKMGCC |
| Ga0207699_109884612 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGFIIGVLVILFDALKRWLKVLNGAPAPEEAFGPPLTSAGEIKMGCC |
| Ga0209806_12274601 | 3300026529 | Soil | VLVVFDAARRWYQVLHGAPVPQEAFGPPLTVTGEVKMGCC |
| Ga0209004_10462761 | 3300027376 | Forest Soil | VIFVAGVVLVLLDSVRRWYKVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0209733_10011001 | 3300027591 | Forest Soil | IFILGVILVVFDAVRRWIKTLNGAPAPVEAFGPPLTDAGEVKMGCC |
| Ga0209626_11509301 | 3300027684 | Forest Soil | GVVLVLFDAVRRWIMVAKGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0208696_12907501 | 3300027696 | Peatlands Soil | LMTIFIVGVVLVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0209580_104307541 | 3300027842 | Surface Soil | FDAVRRWIAVLKGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0209580_106344221 | 3300027842 | Surface Soil | VIFVTGVVLVLLDSVRRWYKVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0209517_102082582 | 3300027854 | Peatlands Soil | LVVFDAVRRWIKTLNGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0209579_106973711 | 3300027869 | Surface Soil | IFIVGVVLVVFDAARRWIAASKGAPAPQEAFGPPLTTTGEVKMGCC |
| Ga0209380_105394682 | 3300027889 | Soil | GYLDTALMAVFIVGVALVLYEAVRRWIAVLNGAPAPAEAFGPPVTVEGEIKMGCC |
| Ga0209624_101758603 | 3300027895 | Forest Soil | IAGVVLVVADAVRRWILVAKGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0209526_101695021 | 3300028047 | Forest Soil | LMLIFITGVILVVFDAVRRWIAVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0302153_100744181 | 3300028574 | Bog | DTTLMVIFIVGVLLVVADATRRWIMVLNGAPVPEEAFGPPVTKEGEIKMGCC |
| Ga0302156_102537441 | 3300028748 | Bog | ILMSIFILGVILVVFDAVRRWIAVLNGAPAPVEAFGPPLTATGDVKMGCC |
| Ga0302202_103641781 | 3300028762 | Bog | LDTCLMVLFITGVILVLIDAIRRWFLVLNGAPPPEEAFGPPVSKEGEIKMGCC |
| Ga0302198_101185991 | 3300028765 | Bog | KWFAGWLDTCLMVLFITGVILVLIDAIRRWFLVLNGAPPPEEAFGPPVSKEGEIKMGCC |
| Ga0302232_102403151 | 3300028789 | Palsa | FILGVVLVVFDAVRRWIAVLNGAPAPQEAFGPPLTVGGEVKMGCC |
| Ga0302197_104736071 | 3300028873 | Bog | SIFILGVILVVFDAVRRWIAVANGAPAPVEAFGPPLTATGEVKMGCC |
| Ga0308309_100089311 | 3300028906 | Soil | IFIVGVVLVVFDAVRRWIMVAKGAPAPLEAFGPPLTAAGEVKMGCC |
| Ga0308309_100474991 | 3300028906 | Soil | DSVLMAIFIVGVVLVLFSAIRRWIAVLNGAPAPQEAFGPPLTAAGDVKMGCC |
| Ga0302143_11179491 | 3300029918 | Bog | VLMTIFILGVVLVVFDAVRRWIAVLNGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0311340_112740161 | 3300029943 | Palsa | ILGVVLVVFDAVRRWIAVANGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0311371_103288734 | 3300029951 | Palsa | LMSIFILGVILVVFDAVRRWIAVANGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0311343_106000541 | 3300029953 | Bog | VLDTSLMVIFIAGVVLVLIDAVRRWIIVLRGGPAPEEAFGPPEIKEGQVKMGCC |
| Ga0302188_100636721 | 3300029986 | Bog | DTGLMAIFIVGVVLVVFSAVRRWIAVMQGAPAPEEAFGEPVTGSGEIKMGCC |
| Ga0302188_102170381 | 3300029986 | Bog | GVLDTSLMVIFIAGVVLVLIDAVRRWIIVLRGGPAPEEAFGPPEIKEGQVKMGCC |
| Ga0311339_103791911 | 3300029999 | Palsa | VVFDAVRRWIAVANGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0302274_100403085 | 3300030041 | Bog | DSILMSIFILGVILVVFDAVRRWIAVLNGAPAPVEAFGPPLTATGDVKMGCC |
| Ga0302177_103899641 | 3300030053 | Palsa | VFDAVRRWVSVLNGAQPPAEAFGEPVTAGNEVKMGCC |
| Ga0302192_100896621 | 3300030507 | Bog | AGWLDTCLMVLFITGVILVLIDAIRRWFLVLNGAPPPEEAFGPPVSKEGEIKMGCC |
| Ga0310038_100594322 | 3300030707 | Peatlands Soil | VVFDAVRRWIKTLNGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0265460_125183782 | 3300030740 | Soil | VVLVVFDAVRRWIAVLNGAPAPVEAFGPPLTAAGEVKMGCC |
| Ga0265330_104591171 | 3300031235 | Rhizosphere | LTAMFIIGVVLVVFDAVRRWIAVLNGAPAPAEAFGPPVTVEGEIRMGCC |
| Ga0302324_1005699001 | 3300031236 | Palsa | LMAIFIVGVVLVVFSAVRRWIAVLNGAPAPQEAFGPPVTAAGEVKMGCC |
| Ga0170818_1111779662 | 3300031474 | Forest Soil | DSVLMTIFILGVILVVFDAVRRWIKTLHGEPAPVEAFGPPLTDAGEVKMGCC |
| Ga0302326_101767151 | 3300031525 | Palsa | SILTTIFIAGVFLVVYGAVRRWIAVLNGAPAPAEAFGPPVTPEGGVRMGCC |
| Ga0310686_1016319391 | 3300031708 | Soil | ILVLFDAVRRWIAVMNGAPAPQEAFGPPVTAAGEVKMGCC |
| Ga0310686_1130116142 | 3300031708 | Soil | DVFDAARRCMLTLNGAPAPQEAFGPPLTSAGEVTMGCC |
| Ga0265342_106628011 | 3300031712 | Rhizosphere | GYVDSILMTLFIAGVLLVIIDAARRWVAVMRGASVPVEAFGPPVAASGEIRMGCC |
| Ga0307476_109531841 | 3300031715 | Hardwood Forest Soil | MCIFIAGVILVVFDAVRRWIAVMNGAPTPQEAFGPPLTAAGEVKMGCC |
| Ga0307475_108908322 | 3300031754 | Hardwood Forest Soil | TILMSIFIAGVVLVVFDAVRRWILVAKGAPAPLEAFGPPLTAAGEVKMGCC |
| Ga0307478_110194161 | 3300031823 | Hardwood Forest Soil | MCIFIAGVILVVFDAVRRWIAVTNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0307472_1024558881 | 3300032205 | Hardwood Forest Soil | FVAGVVLVLLDSIRRWYKVLNGAPAPQEAFGPPLTAAGEVKMGCC |
| Ga0335079_109729032 | 3300032783 | Soil | AVFITGVLLVVGDAVRRWIAVLQGAPAPAEAFGSPVDASGEVRMGCC |
| Ga0335078_124469872 | 3300032805 | Soil | VLMIIFIVGVILVVINAVIRWIKTAKGVPIPQEAWGPPLTEAGEVKMGCC |
| Ga0335078_125535072 | 3300032805 | Soil | MVAFIAGVILVLFDAIRRWIATARGAPLPPEAFGPPATLEGQTRIGCC |
| Ga0335081_112302691 | 3300032892 | Soil | GVILVLCNAAWTWYRVLGGAPVPQEAFGPPVTASGEVKMGCC |
| Ga0335077_115951361 | 3300033158 | Soil | IIGVVLVVFNAIQRWIAVLNGAPAPAEAFGPPVTDEGDIRMGCC |
| Ga0335077_119561511 | 3300033158 | Soil | DTILMCIFILGVIVVVFDAALRWYKVLNGAPAPEAAFGPPLTATGDIKMGCC |
| Ga0371487_0302497_475_654 | 3300033982 | Peat Soil | MQFTGYLDSLLMAIFIAGSILVLFEAVRRWIAAAQGAPAPPGAFGPPATASGDIRMGCC |
| Ga0371488_0203864_825_971 | 3300033983 | Peat Soil | MAIFIVGVILVVFNAAWRWYRVFQGAPIPQEAFGPPLTVSGDVKMGCC |
| Ga0370492_0057027_3_140 | 3300034282 | Untreated Peat Soil | FIVGVVLVVVDAVRRWIAVLNGAAPPTEAFGPPVTAGNQIKMGCC |
| Ga0370492_0415311_10_156 | 3300034282 | Untreated Peat Soil | MILFITGVILVLIDAIRRWFLVLNGAPPPEEAFGPPVTKEGEIKMGCC |
| ⦗Top⦘ |