


| Basic Information | |
|---|---|
| Family ID | F035402 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.98 % |
| % of genes near scaffold ends (potentially truncated) | 31.40 % |
| % of genes from short scaffolds (< 2000 bps) | 66.86 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.837 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.023 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 5.81 |
| PF00011 | HSP20 | 4.07 |
| PF09361 | Phasin_2 | 3.49 |
| PF04392 | ABC_sub_bind | 2.33 |
| PF13545 | HTH_Crp_2 | 2.33 |
| PF00118 | Cpn60_TCP1 | 2.33 |
| PF00027 | cNMP_binding | 1.74 |
| PF00140 | Sigma70_r1_2 | 1.16 |
| PF04055 | Radical_SAM | 1.16 |
| PF08281 | Sigma70_r4_2 | 1.16 |
| PF13472 | Lipase_GDSL_2 | 1.16 |
| PF02696 | SelO | 1.16 |
| PF00872 | Transposase_mut | 1.16 |
| PF02668 | TauD | 1.16 |
| PF04539 | Sigma70_r3 | 1.16 |
| PF01135 | PCMT | 1.16 |
| PF03401 | TctC | 0.58 |
| PF01321 | Creatinase_N | 0.58 |
| PF06240 | COXG | 0.58 |
| PF00491 | Arginase | 0.58 |
| PF05598 | DUF772 | 0.58 |
| PF07859 | Abhydrolase_3 | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF13586 | DDE_Tnp_1_2 | 0.58 |
| PF02826 | 2-Hacid_dh_C | 0.58 |
| PF04280 | Tim44 | 0.58 |
| PF00313 | CSD | 0.58 |
| PF01594 | AI-2E_transport | 0.58 |
| PF02517 | Rce1-like | 0.58 |
| PF14499 | DUF4437 | 0.58 |
| PF04546 | Sigma70_ner | 0.58 |
| PF02543 | Carbam_trans_N | 0.58 |
| PF03979 | Sigma70_r1_1 | 0.58 |
| PF00487 | FA_desaturase | 0.58 |
| PF13340 | DUF4096 | 0.58 |
| PF14026 | DUF4242 | 0.58 |
| PF01266 | DAO | 0.58 |
| PF02657 | SufE | 0.58 |
| PF04545 | Sigma70_r4 | 0.58 |
| PF13924 | Lipocalin_5 | 0.58 |
| PF00536 | SAM_1 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 5.81 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 4.07 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.49 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.33 |
| COG0397 | Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O) | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.16 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.16 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.16 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 1.16 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.16 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.16 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.58 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.58 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.58 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.58 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.58 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.58 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.58 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.58 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.58 |
| COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.58 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.84 % |
| Unclassified | root | N/A | 26.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16577670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2184 | Open in IMG/M |
| 2199352025|deepsgr__Contig_189460 | Not Available | 622 | Open in IMG/M |
| 2228664022|INPgaii200_c0663783 | Not Available | 505 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0630678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1643 | Open in IMG/M |
| 3300000550|F24TB_10015679 | Not Available | 2067 | Open in IMG/M |
| 3300000955|JGI1027J12803_100977175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300000955|JGI1027J12803_101341156 | Not Available | 545 | Open in IMG/M |
| 3300001545|JGI12630J15595_10008461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2223 | Open in IMG/M |
| 3300001545|JGI12630J15595_10010217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 69-89 | 2024 | Open in IMG/M |
| 3300001661|JGI12053J15887_10046145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2442 | Open in IMG/M |
| 3300002914|JGI25617J43924_10102637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1021 | Open in IMG/M |
| 3300002917|JGI25616J43925_10098796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1206 | Open in IMG/M |
| 3300004157|Ga0062590_101397747 | Not Available | 696 | Open in IMG/M |
| 3300005184|Ga0066671_10248016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1095 | Open in IMG/M |
| 3300005186|Ga0066676_10900295 | Not Available | 594 | Open in IMG/M |
| 3300005435|Ga0070714_101699426 | Not Available | 616 | Open in IMG/M |
| 3300005518|Ga0070699_100785049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300005552|Ga0066701_10662291 | Not Available | 630 | Open in IMG/M |
| 3300005556|Ga0066707_10041648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2614 | Open in IMG/M |
| 3300005556|Ga0066707_10200160 | Not Available | 1288 | Open in IMG/M |
| 3300005557|Ga0066704_10259413 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005559|Ga0066700_10178129 | Not Available | 1457 | Open in IMG/M |
| 3300005560|Ga0066670_10195033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1212 | Open in IMG/M |
| 3300005587|Ga0066654_10022852 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300005921|Ga0070766_10142595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1459 | Open in IMG/M |
| 3300006031|Ga0066651_10544022 | Not Available | 615 | Open in IMG/M |
| 3300006038|Ga0075365_10027327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3630 | Open in IMG/M |
| 3300006038|Ga0075365_10623794 | Not Available | 762 | Open in IMG/M |
| 3300006046|Ga0066652_100810917 | Not Available | 895 | Open in IMG/M |
| 3300006046|Ga0066652_100857752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 868 | Open in IMG/M |
| 3300006175|Ga0070712_100066128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2568 | Open in IMG/M |
| 3300006175|Ga0070712_100149310 | Not Available | 1793 | Open in IMG/M |
| 3300006576|Ga0074047_10485070 | Not Available | 507 | Open in IMG/M |
| 3300006796|Ga0066665_10489093 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300006797|Ga0066659_10456210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300006844|Ga0075428_100181980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2274 | Open in IMG/M |
| 3300006845|Ga0075421_100047219 | All Organisms → cellular organisms → Bacteria | 5456 | Open in IMG/M |
| 3300006845|Ga0075421_100069859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4434 | Open in IMG/M |
| 3300006845|Ga0075421_100699245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1178 | Open in IMG/M |
| 3300006846|Ga0075430_100180563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1755 | Open in IMG/M |
| 3300006854|Ga0075425_100237291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2098 | Open in IMG/M |
| 3300006854|Ga0075425_101420779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300006871|Ga0075434_100097653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2942 | Open in IMG/M |
| 3300006871|Ga0075434_100192058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2062 | Open in IMG/M |
| 3300006871|Ga0075434_100712640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300006871|Ga0075434_100928908 | Not Available | 885 | Open in IMG/M |
| 3300006880|Ga0075429_100491516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1075 | Open in IMG/M |
| 3300006903|Ga0075426_10620305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 808 | Open in IMG/M |
| 3300006904|Ga0075424_102470536 | Not Available | 544 | Open in IMG/M |
| 3300006953|Ga0074063_13639662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2073 | Open in IMG/M |
| 3300006954|Ga0079219_10012976 | Not Available | 2868 | Open in IMG/M |
| 3300007076|Ga0075435_100092726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2494 | Open in IMG/M |
| 3300007258|Ga0099793_10017825 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| 3300007265|Ga0099794_10002591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6709 | Open in IMG/M |
| 3300009038|Ga0099829_10023964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4244 | Open in IMG/M |
| 3300009090|Ga0099827_10344554 | Not Available | 1267 | Open in IMG/M |
| 3300009100|Ga0075418_10790641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300009101|Ga0105247_10244371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1224 | Open in IMG/M |
| 3300009137|Ga0066709_101414203 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009137|Ga0066709_102254775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 749 | Open in IMG/M |
| 3300009168|Ga0105104_10315454 | Not Available | 861 | Open in IMG/M |
| 3300010036|Ga0126305_10239676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1163 | Open in IMG/M |
| 3300010037|Ga0126304_10206866 | Not Available | 1284 | Open in IMG/M |
| 3300010303|Ga0134082_10026647 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300010321|Ga0134067_10045680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1398 | Open in IMG/M |
| 3300010337|Ga0134062_10018563 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
| 3300010373|Ga0134128_10754901 | Not Available | 1079 | Open in IMG/M |
| 3300011119|Ga0105246_10751507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300011120|Ga0150983_11738071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300011120|Ga0150983_13288346 | Not Available | 647 | Open in IMG/M |
| 3300011120|Ga0150983_13288684 | Not Available | 636 | Open in IMG/M |
| 3300011120|Ga0150983_16485155 | Not Available | 517 | Open in IMG/M |
| 3300012096|Ga0137389_10031521 | All Organisms → cellular organisms → Bacteria | 3853 | Open in IMG/M |
| 3300012199|Ga0137383_10364725 | Not Available | 1058 | Open in IMG/M |
| 3300012200|Ga0137382_10036676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2977 | Open in IMG/M |
| 3300012200|Ga0137382_10210197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 113-3-9 | 1339 | Open in IMG/M |
| 3300012201|Ga0137365_10530439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
| 3300012204|Ga0137374_10089011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2955 | Open in IMG/M |
| 3300012204|Ga0137374_11017145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300012206|Ga0137380_10123556 | Not Available | 2364 | Open in IMG/M |
| 3300012206|Ga0137380_10485288 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012206|Ga0137380_10631006 | Not Available | 935 | Open in IMG/M |
| 3300012209|Ga0137379_10010217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8918 | Open in IMG/M |
| 3300012209|Ga0137379_10193606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1946 | Open in IMG/M |
| 3300012209|Ga0137379_10194876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1939 | Open in IMG/M |
| 3300012211|Ga0137377_10058756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3572 | Open in IMG/M |
| 3300012361|Ga0137360_10624249 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012361|Ga0137360_10745263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 842 | Open in IMG/M |
| 3300012363|Ga0137390_10980692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300012917|Ga0137395_10015428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4306 | Open in IMG/M |
| 3300012925|Ga0137419_10732864 | Not Available | 804 | Open in IMG/M |
| 3300012941|Ga0162652_100030233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 808 | Open in IMG/M |
| 3300012957|Ga0164303_10784614 | Not Available | 653 | Open in IMG/M |
| 3300012961|Ga0164302_10267024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1097 | Open in IMG/M |
| 3300012976|Ga0134076_10577064 | Not Available | 522 | Open in IMG/M |
| 3300014745|Ga0157377_10292098 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300015077|Ga0173483_10232370 | Not Available | 867 | Open in IMG/M |
| 3300015242|Ga0137412_10065216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2963 | Open in IMG/M |
| 3300015245|Ga0137409_10304623 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300015371|Ga0132258_10526700 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300015371|Ga0132258_10573394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2830 | Open in IMG/M |
| 3300015371|Ga0132258_12930035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1185 | Open in IMG/M |
| 3300015372|Ga0132256_101319012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300017657|Ga0134074_1042751 | Not Available | 1527 | Open in IMG/M |
| 3300018000|Ga0184604_10006459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2252 | Open in IMG/M |
| 3300018433|Ga0066667_10271366 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300018465|Ga0190269_10839110 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300018468|Ga0066662_10852382 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300018469|Ga0190270_10867021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300019887|Ga0193729_1283297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300021178|Ga0210408_10128990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
| 3300021178|Ga0210408_10157778 | Not Available | 1798 | Open in IMG/M |
| 3300021178|Ga0210408_10251381 | Not Available | 1408 | Open in IMG/M |
| 3300021432|Ga0210384_10546214 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300021475|Ga0210392_10867670 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021478|Ga0210402_11604452 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300021479|Ga0210410_10073402 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
| 3300022557|Ga0212123_10022516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7024 | Open in IMG/M |
| 3300024347|Ga0179591_1182051 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300025910|Ga0207684_10063125 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300025910|Ga0207684_10176227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1843 | Open in IMG/M |
| 3300025910|Ga0207684_10675133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300025915|Ga0207693_10005265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10819 | Open in IMG/M |
| 3300025928|Ga0207700_11606377 | Not Available | 575 | Open in IMG/M |
| 3300025961|Ga0207712_11768841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300026304|Ga0209240_1280422 | Not Available | 514 | Open in IMG/M |
| 3300026310|Ga0209239_1000866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17730 | Open in IMG/M |
| 3300026310|Ga0209239_1018557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 3494 | Open in IMG/M |
| 3300026343|Ga0209159_1019732 | All Organisms → cellular organisms → Bacteria | 3818 | Open in IMG/M |
| 3300026538|Ga0209056_10092096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2507 | Open in IMG/M |
| 3300026550|Ga0209474_10699291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300026551|Ga0209648_10021904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5585 | Open in IMG/M |
| 3300026552|Ga0209577_10352897 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300026555|Ga0179593_1135850 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300026555|Ga0179593_1221432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3734 | Open in IMG/M |
| 3300027181|Ga0208997_1002845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2027 | Open in IMG/M |
| 3300027521|Ga0209524_1006091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2318 | Open in IMG/M |
| 3300027605|Ga0209329_1024930 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300027610|Ga0209528_1023791 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300027651|Ga0209217_1017719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 69-89 | 2299 | Open in IMG/M |
| 3300027655|Ga0209388_1001758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5134 | Open in IMG/M |
| 3300027875|Ga0209283_10057963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2479 | Open in IMG/M |
| 3300027907|Ga0207428_10443521 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300027909|Ga0209382_10042475 | All Organisms → cellular organisms → Bacteria | 5445 | Open in IMG/M |
| 3300027909|Ga0209382_10077020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3934 | Open in IMG/M |
| 3300027909|Ga0209382_10443662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1439 | Open in IMG/M |
| 3300028536|Ga0137415_10017406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7128 | Open in IMG/M |
| 3300028708|Ga0307295_10065664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 950 | Open in IMG/M |
| 3300028712|Ga0307285_10189385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300028796|Ga0307287_10242938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300028814|Ga0307302_10031494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2438 | Open in IMG/M |
| 3300028819|Ga0307296_10044140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2351 | Open in IMG/M |
| 3300029636|Ga0222749_10790827 | Not Available | 519 | Open in IMG/M |
| 3300030884|Ga0265758_105141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 620 | Open in IMG/M |
| 3300030986|Ga0308154_113657 | Not Available | 558 | Open in IMG/M |
| 3300030987|Ga0308155_1000481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 113-3-9 | 1859 | Open in IMG/M |
| 3300031093|Ga0308197_10467340 | Not Available | 510 | Open in IMG/M |
| 3300031099|Ga0308181_1007855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1459 | Open in IMG/M |
| 3300031198|Ga0307500_10032264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300031226|Ga0307497_10288861 | Not Available | 748 | Open in IMG/M |
| 3300031231|Ga0170824_110849876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300031231|Ga0170824_126346284 | Not Available | 503 | Open in IMG/M |
| 3300031424|Ga0308179_1026731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 665 | Open in IMG/M |
| 3300031424|Ga0308179_1054100 | Not Available | 527 | Open in IMG/M |
| 3300031573|Ga0310915_10016967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4355 | Open in IMG/M |
| 3300031720|Ga0307469_11600469 | Not Available | 626 | Open in IMG/M |
| 3300032174|Ga0307470_10363861 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032180|Ga0307471_100581324 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300032180|Ga0307471_103976497 | Not Available | 522 | Open in IMG/M |
| 3300034643|Ga0370545_014196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1257 | Open in IMG/M |
| 3300034643|Ga0370545_028762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 987 | Open in IMG/M |
| 3300034680|Ga0370541_000971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1936 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.16% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01624340 | 2088090014 | Soil | MWFYLQMWLPLLTVALTTAICFSVASFIMGQPKPQR |
| deepsgr_03264530 | 2199352025 | Soil | MWFYVQMWFPVLTIALTAAICFSVASFIMGHTKPQR |
| INPgaii200_06637832 | 2228664022 | Soil | MWAYLQMWFPLLTVALTAAICLSTVSFIMGQSKPQR |
| ICChiseqgaiiDRAFT_06306783 | 3300000033 | Soil | VWFYVQMWFSILTIVLTVAIGIGVVSFIMGHAKPHV* |
| F24TB_100156793 | 3300000550 | Soil | MWFYVQMSFPLLTVALTAAICLSVVSFIMGQAKPQR* |
| JGI1027J12803_1009771752 | 3300000955 | Soil | MWSYVQMWYPLLIIALTAAICLSVVSFIMGQTKPQP* |
| JGI1027J12803_1013411562 | 3300000955 | Soil | FYIQTWFPLLTIALTAAICFSVASFIMGHAKPQRR* |
| JGI12630J15595_100084614 | 3300001545 | Forest Soil | MWFYFQMWFPLLTVVLTAAICFSVTSFIMGQASPQA* |
| JGI12630J15595_100102172 | 3300001545 | Forest Soil | MLFYIQTWLPLLTIALTAAICFSVASFIMGQARPQA* |
| JGI12053J15887_100461455 | 3300001661 | Forest Soil | MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKP |
| JGI25617J43924_101026371 | 3300002914 | Grasslands Soil | PQEDRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR* |
| JGI25616J43925_100987961 | 3300002917 | Grasslands Soil | EHRQMWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR* |
| Ga0062590_1013977471 | 3300004157 | Soil | MWLYVQTWLPILTIALTAAICFGVASFMMGYHTKRQPWVL* |
| Ga0066671_102480162 | 3300005184 | Soil | MWFYVQMWFPLLTIALAAAICFSVVSFIMGHAQPQPMIEDQA* |
| Ga0066676_109002951 | 3300005186 | Soil | PPPQEDRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR* |
| Ga0070714_1016994262 | 3300005435 | Agricultural Soil | DRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR* |
| Ga0070699_1007850491 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA* |
| Ga0066701_106622912 | 3300005552 | Soil | MWLYVQTWLPLLTIGLTAAICFSVAAFIMGQPQRRQ* |
| Ga0066707_100416486 | 3300005556 | Soil | MWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR* |
| Ga0066707_102001601 | 3300005556 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKP |
| Ga0066704_102594132 | 3300005557 | Soil | MWLYVQMWFPLLTVALTAAICFSVMSFIMGYSKPHA* |
| Ga0066700_101781291 | 3300005559 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMERSVKPHQL* |
| Ga0066670_101950331 | 3300005560 | Soil | MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR* |
| Ga0066654_100228523 | 3300005587 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPQR* |
| Ga0070766_101425954 | 3300005921 | Soil | MWFYIQMVLPLLTFGLAAAICFSVVSSIVAHAKPHP* |
| Ga0066651_105440221 | 3300006031 | Soil | RQMWSYVEMWSPLLTIALAAAICLGVVSYIMGQAKPQP* |
| Ga0075365_100273279 | 3300006038 | Populus Endosphere | MWFYVQMWLPVLTVALTAAICFSVASFIMAGSVKPHQL* |
| Ga0075365_106237942 | 3300006038 | Populus Endosphere | QMWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKLQP* |
| Ga0066652_1008109171 | 3300006046 | Soil | GRQMWFYVQMLFPLLTIALTAAICLSVVSFIMGKAKPHP* |
| Ga0066652_1008577521 | 3300006046 | Soil | GRQMWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR* |
| Ga0070712_1000661284 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR* |
| Ga0070712_1001493103 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFYVQMGFPLLTIALTAAICLTVVSFIMGQGKIHR* |
| Ga0074047_104850701 | 3300006576 | Soil | EDRQMWFYVQMGLPLLTIALTAAICLSVVSFIMGQAKPQR* |
| Ga0066665_104890931 | 3300006796 | Soil | MWFYVQMWFPLLTIALTAAICFSVASFIMGRSVKPQR* |
| Ga0066659_104562104 | 3300006797 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQP |
| Ga0075428_1001819802 | 3300006844 | Populus Rhizosphere | MWFYVQMWLPIFTVALTAAICFSVAAFIMGRSVKPHQL* |
| Ga0075421_10004721911 | 3300006845 | Populus Rhizosphere | MWFYTQMLFPVLLVGLTAAICFSVASFMVGQPKPHP* |
| Ga0075421_1000698592 | 3300006845 | Populus Rhizosphere | MWSYVQMSYPLLTIALAAAMCFVVVSFIMGQSKPHR* |
| Ga0075421_1006992452 | 3300006845 | Populus Rhizosphere | MWSYVQMWYPLLTIALTAAICLSVVSFIMGQAKPQP* |
| Ga0075430_1001805634 | 3300006846 | Populus Rhizosphere | MWFYVQMWFPLLTVVLTAAVCLSVVSFIMGQAKPQS* |
| Ga0075425_1002372913 | 3300006854 | Populus Rhizosphere | MWFYIQTWFPFLTIALTAAICFSVASFIMGQARPQA* |
| Ga0075425_1014207792 | 3300006854 | Populus Rhizosphere | MWPDVQTWLPLFTIVLSAAVGLSVVSFIMGQAKVGR* |
| Ga0075434_1000976535 | 3300006871 | Populus Rhizosphere | MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA* |
| Ga0075434_1001920583 | 3300006871 | Populus Rhizosphere | MWLHIQTWLPLLTIALTAALCFSVASFIMGQTRPEKR* |
| Ga0075434_1007126402 | 3300006871 | Populus Rhizosphere | MWSFIQMWSPLLTVAFAAAICLSVVSFIMGQAKKPHP* |
| Ga0075434_1009289081 | 3300006871 | Populus Rhizosphere | MWFHFQTWFPLLTVALTATICFGVVSFIIGHTKPH |
| Ga0075429_1004915162 | 3300006880 | Populus Rhizosphere | MWSYVQMWFPLLTIVLTAAICLSVVSFIVRQPKVHR* |
| Ga0075426_106203052 | 3300006903 | Populus Rhizosphere | MWSYVQMWSPLLTVALAAAVCFGVVSVIMAQAKPH |
| Ga0075424_1024705363 | 3300006904 | Populus Rhizosphere | EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA* |
| Ga0074063_136396623 | 3300006953 | Soil | MWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA* |
| Ga0079219_100129763 | 3300006954 | Agricultural Soil | MWLYIQAWLPLFTVALTAAICFSVASFVMAQAKVQP* |
| Ga0075435_1000927264 | 3300007076 | Populus Rhizosphere | MWFYVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR* |
| Ga0099793_100178253 | 3300007258 | Vadose Zone Soil | MWLYVQMWFPLLTVALTAAICFSVVSFIMGHTKLHA* |
| Ga0099794_100025919 | 3300007265 | Vadose Zone Soil | MWFDVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR* |
| Ga0099829_100239646 | 3300009038 | Vadose Zone Soil | MWSNVQMWFPVLTIVLTAAICISVVSFIVGQSKPQS* |
| Ga0099827_103445543 | 3300009090 | Vadose Zone Soil | RQMWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR* |
| Ga0075418_107906412 | 3300009100 | Populus Rhizosphere | MWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKLQP* |
| Ga0105247_102443713 | 3300009101 | Switchgrass Rhizosphere | MWPHVQTWLPLFTIVLSAAVGLSVASFIMGQTQVHR* |
| Ga0066709_1014142031 | 3300009137 | Grasslands Soil | MWFYVQMGFPLLTVALTAAICFSVVSFIMGHAKPYA* |
| Ga0066709_1022547752 | 3300009137 | Grasslands Soil | MWFYVQMWFPLLTIALTAAICISVVSFIMGQAKPHP* |
| Ga0105104_103154541 | 3300009168 | Freshwater Sediment | MMWSYVQMLFPLLTVALAAAICLVVVSFIVGQPKSQP* |
| Ga0126305_102396761 | 3300010036 | Serpentine Soil | RQDSLEDRQMWHYVQMWVPLLTIGLTAAMCFSVAAFLIAQPRGR* |
| Ga0126304_102068663 | 3300010037 | Serpentine Soil | MSFYVQMFSPLLTIALAAAICFGVTSYIVGLAKLRP* |
| Ga0134082_100266472 | 3300010303 | Grasslands Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQL* |
| Ga0134067_100456804 | 3300010321 | Grasslands Soil | MWFYVQMGFPLLTIALTAAICFSVVSFIMGHAKPYAHA |
| Ga0134062_100185634 | 3300010337 | Grasslands Soil | MWFYVQMWLPVWTVAFTAAICFSVASFIMGRSVKPQR* |
| Ga0134128_107549011 | 3300010373 | Terrestrial Soil | MWFYVQTWFPLLTVTLTAAICFSVVSFIMGHAKPHA* |
| Ga0105246_107515072 | 3300011119 | Miscanthus Rhizosphere | MWIYVQMWLPSLAVALTAAICFSVASFIMGQTKPQ* |
| Ga0150983_117380713 | 3300011120 | Forest Soil | MWFYIQMWLPVWTVALTAAICFSVASFIMRRSVKPHQ |
| Ga0150983_132883462 | 3300011120 | Forest Soil | MWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKPQP* |
| Ga0150983_132886841 | 3300011120 | Forest Soil | MWLYIQTWLPLLTIALTAAICFSVTSFIMGQAKPQA* |
| Ga0150983_164851551 | 3300011120 | Forest Soil | PPPQEDRQMWFYVQMWFPLLTIALTAAICFSVASLIMGQATPQR* |
| Ga0137389_100315211 | 3300012096 | Vadose Zone Soil | MWFYVQMWLPVFTVALTAAICFSVTSFIMGRSVKPHQL* |
| Ga0137383_103647251 | 3300012199 | Vadose Zone Soil | MWFYVQMWFPLLTIALTAAICFSVVSFIMGQPKLQR* |
| Ga0137382_100366762 | 3300012200 | Vadose Zone Soil | MWFYVQMWFPLLPVVLTAAVCLSVVSFIMGQAKPHP* |
| Ga0137382_102101972 | 3300012200 | Vadose Zone Soil | MWSYVQMWSPLLTVTLAAAICLSVVSFIMGKAKPHP* |
| Ga0137365_105304392 | 3300012201 | Vadose Zone Soil | MWLYVQMWFPLLTVALTAAICFSVVSFIMGYSKPHISG* |
| Ga0137374_100890113 | 3300012204 | Vadose Zone Soil | MWFYVQTWLPILAVALTAAICFSVASFVMGQSVKPHQQ* |
| Ga0137374_110171452 | 3300012204 | Vadose Zone Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKPHQP |
| Ga0137380_101235562 | 3300012206 | Vadose Zone Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKAQR* |
| Ga0137380_104852882 | 3300012206 | Vadose Zone Soil | MWLYFQMWFPLLTVALTAAICFSVVSFIMGHAKPYA* |
| Ga0137380_106310063 | 3300012206 | Vadose Zone Soil | WFHIQTWFPLLTIILSAAICLSVVSFIMRQAKPQP* |
| Ga0137379_100102175 | 3300012209 | Vadose Zone Soil | MWFHIQTWFPLLTIILSAAICLSVVSFIMRQAKPQP* |
| Ga0137379_101936061 | 3300012209 | Vadose Zone Soil | MWFYVQMGLPLLTIALTAAICLSVASFIMGQAKIHR* |
| Ga0137379_101948762 | 3300012209 | Vadose Zone Soil | MWFYVQMWFPLLTVALTAAICFSVASFIMGRSVKPQR* |
| Ga0137377_100587562 | 3300012211 | Vadose Zone Soil | MWFYVQMWFPLLTIALTAGICFSVVSFIMGQPKLQR* |
| Ga0137360_106242492 | 3300012361 | Vadose Zone Soil | MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQ |
| Ga0137360_107452631 | 3300012361 | Vadose Zone Soil | RVGAPQEDRQMSFYVQTWLPLLTVALTAAICFSVASFMMGHTKPQR* |
| Ga0137390_109806921 | 3300012363 | Vadose Zone Soil | DTGQFQEDRQMWLYIQTWLPLLTIALTAAICFSVASFIMGQARPQRR* |
| Ga0137395_100154286 | 3300012917 | Vadose Zone Soil | MWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR* |
| Ga0137419_107328642 | 3300012925 | Vadose Zone Soil | MLPYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHP* |
| Ga0162652_1000302333 | 3300012941 | Soil | MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKPR |
| Ga0164303_107846141 | 3300012957 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKSHQL* |
| Ga0164302_102670242 | 3300012961 | Soil | MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKPHQLQSLHPFRA* |
| Ga0134076_105770642 | 3300012976 | Grasslands Soil | MWLYVQTWLPLLTIGLTAAICFSVAAFIMAQPQRAVGSHVRR |
| Ga0157377_102920982 | 3300014745 | Miscanthus Rhizosphere | MWFYVQMWFPLLTVALTAAICFSVVSFIIGRGVKPRQL* |
| Ga0173483_102323703 | 3300015077 | Soil | MWFYIRTWFPLLTIALTAAICFSVASFIMGQTRPQ |
| Ga0137412_100652164 | 3300015242 | Vadose Zone Soil | MWFYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHP* |
| Ga0137409_103046233 | 3300015245 | Vadose Zone Soil | MWSYVQMWVPLLTIALAAAICFSVVSFIMGRAKPHRL* |
| Ga0132258_105267005 | 3300015371 | Arabidopsis Rhizosphere | MWFYVQMWFPLLTVALTAAICFSVVSFIMGHAKPHA* |
| Ga0132258_105733946 | 3300015371 | Arabidopsis Rhizosphere | MWFYVQTWFPLFTIALTAAICFSVVSLIMGHAKPHA* |
| Ga0132258_129300351 | 3300015371 | Arabidopsis Rhizosphere | MWFYIQMWFPLLTIVLTAAICFSVATFIMGQAKPHA* |
| Ga0132256_1013190122 | 3300015372 | Arabidopsis Rhizosphere | MWSNVQMWYPLLTMSLTAAICLSVVSFIMGQTKPQP* |
| Ga0134074_10427512 | 3300017657 | Grasslands Soil | MWFYVQMWLPVWTVALTAAICFGVASFIMGRSVKPHQL |
| Ga0184604_100064594 | 3300018000 | Groundwater Sediment | MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKPRQL |
| Ga0066667_102713663 | 3300018433 | Grasslands Soil | MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR |
| Ga0190269_108391102 | 3300018465 | Soil | MWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQ |
| Ga0066662_108523821 | 3300018468 | Grasslands Soil | EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA |
| Ga0190270_108670213 | 3300018469 | Soil | MWFYVQMWFPLLTIALTAAICFSVVSFIMGQSVKPRQL |
| Ga0193729_12832971 | 3300019887 | Soil | VVLWQMWFPLLTIALTAAICFSVVSFIMGRSVKPR |
| Ga0210408_101289901 | 3300021178 | Soil | MFFYIQTWLPLPDNRLTAAICFSVTSFIMKHSEPHP |
| Ga0210408_101577785 | 3300021178 | Soil | MWLYIQTWLPLLTIALTAAICFSVTSFIMGQAKPQA |
| Ga0210408_102513814 | 3300021178 | Soil | MWLYIQTWLPLLTVALTVAICFSVTSFIMGQAKPQA |
| Ga0210384_105462142 | 3300021432 | Soil | MWFYVQMWFPLLTIALTAAICFSVASLIMGQATPQR |
| Ga0210392_108676702 | 3300021475 | Soil | MWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR |
| Ga0210402_116044522 | 3300021478 | Soil | MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKP |
| Ga0210410_100734021 | 3300021479 | Soil | MWLYIQTWLPLLTIALTAAICFSVTSFIMGQPKPQR |
| Ga0212123_100225162 | 3300022557 | Iron-Sulfur Acid Spring | MWLHIQTWLPLLTIALTAAICFSVASFIMGQAGPQRP |
| Ga0179591_11820513 | 3300024347 | Vadose Zone Soil | MWFYVQMGLPLLTIALTAAICLSVVSFIMGRAKTQL |
| Ga0207684_100631252 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFYVQMWLPLVTVALTAAICFSVASFIMGQSKPQA |
| Ga0207684_101762272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA |
| Ga0207684_106751332 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA |
| Ga0207693_100052653 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFYIQTWLPLLTIALTAAICFSVTSFIMKHSEPHP |
| Ga0207700_116063771 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPEDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA |
| Ga0207712_117688412 | 3300025961 | Switchgrass Rhizosphere | AEPEDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA |
| Ga0209240_12804221 | 3300026304 | Grasslands Soil | MWLYVQMWFPLLTVALTAAICFSVVSFIMGHTKLHA |
| Ga0209239_100086616 | 3300026310 | Grasslands Soil | MWFYVQMWFPLLPVVLTAAVCLSVVSFIMGQAKPHP |
| Ga0209239_10185573 | 3300026310 | Grasslands Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQL |
| Ga0209159_10197326 | 3300026343 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPH |
| Ga0209056_100920963 | 3300026538 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPQR |
| Ga0209474_106992912 | 3300026550 | Soil | MWFYVQMWFPLLTIALAAAICFSVVSFIMGHAQPQPMIEDQA |
| Ga0209648_100219042 | 3300026551 | Grasslands Soil | MWFYVQMWLPVWTIALTAAICFSVASFMMRRSVKPRQL |
| Ga0209577_103528971 | 3300026552 | Soil | MWLYVQMWFPLLTVALTAAICFSVMSFIMGYSKPHA |
| Ga0179593_11358504 | 3300026555 | Vadose Zone Soil | MWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR |
| Ga0179593_12214322 | 3300026555 | Vadose Zone Soil | MWFYVQMWFPLLTIALTAALCFCVVSFIRGHTKQPHRR |
| Ga0208997_10028452 | 3300027181 | Forest Soil | MWFYVQTWFPLLSIALTAAICFSVASFILGHTEPKRR |
| Ga0209524_10060914 | 3300027521 | Forest Soil | MWFYVQMGFPLLTVALTAALCFSVVSFIMSHAKPYA |
| Ga0209329_10249302 | 3300027605 | Forest Soil | MWFYVQMLFPLLTIALTAAICLSVVSFIMGQAKPLR |
| Ga0209528_10237912 | 3300027610 | Forest Soil | MWFYVQMGFPLLTVALAAALCFSVVSFIMSHAKPYA |
| Ga0209217_10177193 | 3300027651 | Forest Soil | MLFYIQTWLPLLTIALTAAICFSVASFIMGQARPQA |
| Ga0209388_10017588 | 3300027655 | Vadose Zone Soil | MWFDVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR |
| Ga0209283_100579633 | 3300027875 | Vadose Zone Soil | MWSNVQMWFPVLTIVLTAAICISVVSFIVGQSKPQS |
| Ga0207428_104435212 | 3300027907 | Populus Rhizosphere | DRQMWSYVQMWFPLLTIVLTAAICLSVVSFIVRQPKVHR |
| Ga0209382_100424757 | 3300027909 | Populus Rhizosphere | MWFYTQMLFPVLLVGLTAAICFSVASFMVGQPKPHP |
| Ga0209382_100770206 | 3300027909 | Populus Rhizosphere | MWSYVQMSYPLLTIALAAAMCFVVVSFIMGQSKPHR |
| Ga0209382_104436621 | 3300027909 | Populus Rhizosphere | MWFYVQMWLPIFTVALTAAICFSVAAFIMGRSVKPHQL |
| Ga0137415_100174065 | 3300028536 | Vadose Zone Soil | MLLYVQMWFPLLTISLTAAICLSVMSFIMGQGKIHR |
| Ga0307295_100656641 | 3300028708 | Soil | VLFYVQMWSPLLTIALTAAICFSVVSFIIGRGVKPRQL |
| Ga0307285_101893852 | 3300028712 | Soil | MWFYVQMWFPLLTIALTAAICFSVVSFIMGQSVKP |
| Ga0307287_102429382 | 3300028796 | Soil | VLFYVQMWSPLLTIALTAAICFSVVSFIIGRGVKPR |
| Ga0307302_100314943 | 3300028814 | Soil | MWLYIQAWLPLFTVALTAAICFSVASFVMAQAKPQP |
| Ga0307296_100441403 | 3300028819 | Soil | MWLFIQTWLPLLGIILTASVCFAAASFFMAQARPQRR |
| Ga0222749_107908271 | 3300029636 | Soil | PQKDRQMWFYVQMWFPLLTIALTAAICLSVVSFIMGQAKPQR |
| Ga0265758_1051412 | 3300030884 | Soil | MWFYAQMALPLLTVGLAAAICFSVASFIVAHAEPHS |
| Ga0308154_1136571 | 3300030986 | Soil | MWSYVQMWYPLWTVALTAAICLSVVSFIMGQAKPQP |
| Ga0308155_10004812 | 3300030987 | Soil | MWSYVQMWSPLLTVGLAAAICLSVVSFIMGKAKPHP |
| Ga0308197_104673401 | 3300031093 | Soil | MWLYVQMWFPLLTIALTAAICLSVVSFIMGQAKPQP |
| Ga0308181_10078551 | 3300031099 | Soil | RERRQMWSYVQMWYPLWTVALTAAICLSVVSFIMGQAKPQP |
| Ga0307500_100322641 | 3300031198 | Soil | MWFYVQMWFPLLTVALTAAICFSVVSFIMGHTKSQR |
| Ga0307497_102888613 | 3300031226 | Soil | MFYVQMWFPVLTVALTAAICFSVASFIMGHTKPGEDQA |
| Ga0170824_1108498761 | 3300031231 | Forest Soil | QDDRQMWLFIQTFLPLLTIALTAAICFSVESFIIGQARPQ |
| Ga0170824_1263462841 | 3300031231 | Forest Soil | WFYVQMGFPLLAIALTAAICLTVVSFIMGQGKIHR |
| Ga0308179_10267312 | 3300031424 | Soil | MWSYVQMWSPFLTVALAAAICVGVVSFIMGKTKPHP |
| Ga0308179_10541002 | 3300031424 | Soil | MWLYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHR |
| Ga0310915_100169672 | 3300031573 | Soil | MWFYVQMLFPLLTVALTAAICLSVVSFIMGHAKPQR |
| Ga0307469_116004691 | 3300031720 | Hardwood Forest Soil | MWFYVQTGFPLLAIALTAAICFGVVSFIMGTPPTH |
| Ga0307470_103638612 | 3300032174 | Hardwood Forest Soil | MWFYVQMWFPLLTVALTAAICFSVASFIMGQPKPQ |
| Ga0307471_1005813242 | 3300032180 | Hardwood Forest Soil | MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKPHQLQSLHPFRA |
| Ga0307471_1039764972 | 3300032180 | Hardwood Forest Soil | MWLYVQMWFPLLTIALTAAICFSVVSFIMGHAKPQRNR |
| Ga0370545_014196_1071_1178 | 3300034643 | Soil | MWLYVQMWLPTLAVALTAAICFSIASFIMEHTKPQ |
| Ga0370545_028762_344_451 | 3300034643 | Soil | MWFYVQMWLPTLAVALTAAICFSVASFIMGHTKPQ |
| Ga0370541_000971_365_481 | 3300034680 | Soil | MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKPHQL |
| ⦗Top⦘ |