


| Basic Information | |
|---|---|
| Family ID | F035270 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PNGSRLSCGRNARWRKAAERQKKRLASEATQFFPTGERPAASSAC |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.40 % |
| % of genes near scaffold ends (potentially truncated) | 83.72 % |
| % of genes from short scaffolds (< 2000 bps) | 81.98 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.698 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.465 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.256 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.488 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 2.33 |
| PF03992 | ABM | 1.74 |
| PF07883 | Cupin_2 | 1.74 |
| PF07311 | Dodecin | 1.74 |
| PF12680 | SnoaL_2 | 1.16 |
| PF06983 | 3-dmu-9_3-mt | 1.16 |
| PF03544 | TonB_C | 1.16 |
| PF07045 | DUF1330 | 1.16 |
| PF12681 | Glyoxalase_2 | 1.16 |
| PF01230 | HIT | 1.16 |
| PF04365 | BrnT_toxin | 0.58 |
| PF01152 | Bac_globin | 0.58 |
| PF14085 | DUF4265 | 0.58 |
| PF12158 | DUF3592 | 0.58 |
| PF03681 | Obsolete Pfam Family | 0.58 |
| PF04029 | 2-ph_phosp | 0.58 |
| PF09965 | DUF2199 | 0.58 |
| PF01243 | Putative_PNPOx | 0.58 |
| PF13620 | CarboxypepD_reg | 0.58 |
| PF04191 | PEMT | 0.58 |
| PF00012 | HSP70 | 0.58 |
| PF06271 | RDD | 0.58 |
| PF14485 | DUF4431 | 0.58 |
| PF09413 | DUF2007 | 0.58 |
| PF12587 | DUF3761 | 0.58 |
| PF08592 | Anthrone_oxy | 0.58 |
| PF01965 | DJ-1_PfpI | 0.58 |
| PF14534 | DUF4440 | 0.58 |
| PF10012 | DUF2255 | 0.58 |
| PF10387 | DUF2442 | 0.58 |
| PF11306 | DUF3108 | 0.58 |
| PF01872 | RibD_C | 0.58 |
| PF07927 | HicA_toxin | 0.58 |
| PF12867 | DinB_2 | 0.58 |
| PF13924 | Lipocalin_5 | 0.58 |
| PF13419 | HAD_2 | 0.58 |
| PF00717 | Peptidase_S24 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.74 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.16 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.16 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.16 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.16 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.16 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.58 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.58 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.58 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.70 % |
| Unclassified | root | N/A | 34.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10054759 | Not Available | 1277 | Open in IMG/M |
| 3300002560|JGI25383J37093_10140928 | Not Available | 648 | Open in IMG/M |
| 3300002909|JGI25388J43891_1028901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 918 | Open in IMG/M |
| 3300002909|JGI25388J43891_1030868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300005166|Ga0066674_10425477 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005171|Ga0066677_10052073 | Not Available | 2050 | Open in IMG/M |
| 3300005175|Ga0066673_10855039 | Not Available | 518 | Open in IMG/M |
| 3300005177|Ga0066690_10609883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300005177|Ga0066690_11057743 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005178|Ga0066688_10033927 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300005178|Ga0066688_10987654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300005180|Ga0066685_10081083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2141 | Open in IMG/M |
| 3300005180|Ga0066685_10450369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 894 | Open in IMG/M |
| 3300005187|Ga0066675_11018889 | Not Available | 621 | Open in IMG/M |
| 3300005187|Ga0066675_11418915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 508 | Open in IMG/M |
| 3300005187|Ga0066675_11427504 | Not Available | 506 | Open in IMG/M |
| 3300005434|Ga0070709_10570335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 868 | Open in IMG/M |
| 3300005440|Ga0070705_100303933 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005445|Ga0070708_100933151 | Not Available | 814 | Open in IMG/M |
| 3300005451|Ga0066681_10031412 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300005467|Ga0070706_100064867 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3376 | Open in IMG/M |
| 3300005468|Ga0070707_100411616 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300005468|Ga0070707_100898201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 850 | Open in IMG/M |
| 3300005468|Ga0070707_101558068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 628 | Open in IMG/M |
| 3300005518|Ga0070699_100294340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1456 | Open in IMG/M |
| 3300005518|Ga0070699_100707469 | Not Available | 920 | Open in IMG/M |
| 3300005553|Ga0066695_10119866 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae | 1624 | Open in IMG/M |
| 3300005553|Ga0066695_10327181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300005553|Ga0066695_10364602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 903 | Open in IMG/M |
| 3300005556|Ga0066707_10108775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1713 | Open in IMG/M |
| 3300005557|Ga0066704_10356066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300005557|Ga0066704_10642017 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005561|Ga0066699_10723895 | Not Available | 707 | Open in IMG/M |
| 3300005568|Ga0066703_10243861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1091 | Open in IMG/M |
| 3300005569|Ga0066705_10669651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
| 3300005574|Ga0066694_10060536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1733 | Open in IMG/M |
| 3300005574|Ga0066694_10396313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 650 | Open in IMG/M |
| 3300005575|Ga0066702_10087996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1751 | Open in IMG/M |
| 3300005576|Ga0066708_10053149 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300005587|Ga0066654_10678863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300005598|Ga0066706_10658356 | Not Available | 831 | Open in IMG/M |
| 3300005598|Ga0066706_11232295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia multivorans | 567 | Open in IMG/M |
| 3300006034|Ga0066656_10248895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300006046|Ga0066652_100666409 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 988 | Open in IMG/M |
| 3300006046|Ga0066652_101401910 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300006755|Ga0079222_10477505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 903 | Open in IMG/M |
| 3300006797|Ga0066659_11439160 | Not Available | 576 | Open in IMG/M |
| 3300006800|Ga0066660_10014897 | All Organisms → cellular organisms → Bacteria | 4356 | Open in IMG/M |
| 3300006800|Ga0066660_10083655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2208 | Open in IMG/M |
| 3300006806|Ga0079220_10173085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1217 | Open in IMG/M |
| 3300006806|Ga0079220_10455489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300006903|Ga0075426_10112016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1959 | Open in IMG/M |
| 3300006903|Ga0075426_10884192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300006914|Ga0075436_101496085 | Not Available | 513 | Open in IMG/M |
| 3300006954|Ga0079219_10134416 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300007076|Ga0075435_101736457 | Not Available | 548 | Open in IMG/M |
| 3300007258|Ga0099793_10525064 | Not Available | 589 | Open in IMG/M |
| 3300009012|Ga0066710_100416020 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300009012|Ga0066710_101598246 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300009088|Ga0099830_10120056 | Not Available | 1988 | Open in IMG/M |
| 3300009137|Ga0066709_102145280 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009137|Ga0066709_104146419 | Not Available | 527 | Open in IMG/M |
| 3300009147|Ga0114129_10790878 | Not Available | 1211 | Open in IMG/M |
| 3300010303|Ga0134082_10111531 | Not Available | 1088 | Open in IMG/M |
| 3300010303|Ga0134082_10198349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300010321|Ga0134067_10394625 | Not Available | 553 | Open in IMG/M |
| 3300010323|Ga0134086_10232068 | Not Available | 698 | Open in IMG/M |
| 3300010323|Ga0134086_10357710 | Not Available | 579 | Open in IMG/M |
| 3300010326|Ga0134065_10255517 | Not Available | 655 | Open in IMG/M |
| 3300010333|Ga0134080_10271679 | Not Available | 753 | Open in IMG/M |
| 3300010335|Ga0134063_10610208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300010337|Ga0134062_10195292 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300011269|Ga0137392_11117380 | Not Available | 645 | Open in IMG/M |
| 3300012096|Ga0137389_10137410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1988 | Open in IMG/M |
| 3300012189|Ga0137388_10610871 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300012198|Ga0137364_10213051 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1418 | Open in IMG/M |
| 3300012198|Ga0137364_10564489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 857 | Open in IMG/M |
| 3300012198|Ga0137364_10659644 | Not Available | 789 | Open in IMG/M |
| 3300012199|Ga0137383_10047865 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
| 3300012200|Ga0137382_10228206 | Not Available | 1286 | Open in IMG/M |
| 3300012201|Ga0137365_10368769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Saccharophagus → Saccharophagus degradans | 1060 | Open in IMG/M |
| 3300012201|Ga0137365_10453939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 943 | Open in IMG/M |
| 3300012201|Ga0137365_10555279 | Not Available | 843 | Open in IMG/M |
| 3300012201|Ga0137365_10769783 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 703 | Open in IMG/M |
| 3300012202|Ga0137363_10005980 | All Organisms → cellular organisms → Bacteria | 7543 | Open in IMG/M |
| 3300012203|Ga0137399_11595183 | Not Available | 540 | Open in IMG/M |
| 3300012205|Ga0137362_10178998 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300012206|Ga0137380_10123603 | All Organisms → cellular organisms → Bacteria | 2364 | Open in IMG/M |
| 3300012207|Ga0137381_10303232 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1391 | Open in IMG/M |
| 3300012207|Ga0137381_11701806 | Not Available | 521 | Open in IMG/M |
| 3300012208|Ga0137376_10027708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4460 | Open in IMG/M |
| 3300012208|Ga0137376_10309746 | Not Available | 1370 | Open in IMG/M |
| 3300012208|Ga0137376_11643033 | Not Available | 533 | Open in IMG/M |
| 3300012209|Ga0137379_10150999 | Not Available | 2231 | Open in IMG/M |
| 3300012209|Ga0137379_11006697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 738 | Open in IMG/M |
| 3300012210|Ga0137378_10048612 | All Organisms → cellular organisms → Bacteria | 3813 | Open in IMG/M |
| 3300012210|Ga0137378_11598441 | Not Available | 561 | Open in IMG/M |
| 3300012210|Ga0137378_11730997 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012211|Ga0137377_10846856 | Not Available | 847 | Open in IMG/M |
| 3300012211|Ga0137377_10857209 | Not Available | 841 | Open in IMG/M |
| 3300012211|Ga0137377_11050127 | Not Available | 745 | Open in IMG/M |
| 3300012211|Ga0137377_11090170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 729 | Open in IMG/M |
| 3300012349|Ga0137387_10154624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1634 | Open in IMG/M |
| 3300012350|Ga0137372_10028020 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 5190 | Open in IMG/M |
| 3300012350|Ga0137372_10931637 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012351|Ga0137386_10889668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 638 | Open in IMG/M |
| 3300012353|Ga0137367_11089539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 540 | Open in IMG/M |
| 3300012356|Ga0137371_10320921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1205 | Open in IMG/M |
| 3300012357|Ga0137384_10252630 | Not Available | 1471 | Open in IMG/M |
| 3300012357|Ga0137384_10282195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1383 | Open in IMG/M |
| 3300012357|Ga0137384_10325483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1276 | Open in IMG/M |
| 3300012357|Ga0137384_11496608 | Not Available | 524 | Open in IMG/M |
| 3300012359|Ga0137385_10175339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1879 | Open in IMG/M |
| 3300012359|Ga0137385_10744486 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012405|Ga0134041_1196474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300012683|Ga0137398_10824440 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012685|Ga0137397_10373590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300012917|Ga0137395_10156216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae | 1565 | Open in IMG/M |
| 3300012918|Ga0137396_10803564 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012925|Ga0137419_10152261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1670 | Open in IMG/M |
| 3300012930|Ga0137407_11284782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300012944|Ga0137410_10182158 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300012975|Ga0134110_10211775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 816 | Open in IMG/M |
| 3300014150|Ga0134081_10415911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300014154|Ga0134075_10547392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300014166|Ga0134079_10312672 | Not Available | 702 | Open in IMG/M |
| 3300015052|Ga0137411_1256633 | Not Available | 1343 | Open in IMG/M |
| 3300015245|Ga0137409_10036189 | All Organisms → cellular organisms → Bacteria | 4759 | Open in IMG/M |
| 3300015245|Ga0137409_10616512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 915 | Open in IMG/M |
| 3300015359|Ga0134085_10115765 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300018431|Ga0066655_11082989 | Not Available | 559 | Open in IMG/M |
| 3300018433|Ga0066667_10045626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2604 | Open in IMG/M |
| 3300018433|Ga0066667_10058158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2375 | Open in IMG/M |
| 3300018433|Ga0066667_10813882 | Not Available | 796 | Open in IMG/M |
| 3300018433|Ga0066667_11860558 | Not Available | 547 | Open in IMG/M |
| 3300018468|Ga0066662_12602985 | Not Available | 534 | Open in IMG/M |
| 3300018482|Ga0066669_11372884 | Not Available | 640 | Open in IMG/M |
| 3300018482|Ga0066669_11573584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300024284|Ga0247671_1004781 | Not Available | 2370 | Open in IMG/M |
| 3300025910|Ga0207684_10287694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
| 3300025922|Ga0207646_10567708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1019 | Open in IMG/M |
| 3300025922|Ga0207646_10777898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 853 | Open in IMG/M |
| 3300026277|Ga0209350_1077589 | Not Available | 905 | Open in IMG/M |
| 3300026296|Ga0209235_1009670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 5350 | Open in IMG/M |
| 3300026297|Ga0209237_1244078 | Not Available | 552 | Open in IMG/M |
| 3300026300|Ga0209027_1173026 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300026301|Ga0209238_1008544 | All Organisms → cellular organisms → Bacteria | 4050 | Open in IMG/M |
| 3300026301|Ga0209238_1234983 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026318|Ga0209471_1225284 | Not Available | 683 | Open in IMG/M |
| 3300026329|Ga0209375_1074655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1593 | Open in IMG/M |
| 3300026330|Ga0209473_1238149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
| 3300026333|Ga0209158_1009501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4875 | Open in IMG/M |
| 3300026333|Ga0209158_1016794 | All Organisms → cellular organisms → Bacteria | 3391 | Open in IMG/M |
| 3300026333|Ga0209158_1109596 | Not Available | 1044 | Open in IMG/M |
| 3300026527|Ga0209059_1052538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1789 | Open in IMG/M |
| 3300026540|Ga0209376_1277779 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300026547|Ga0209156_10064354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1897 | Open in IMG/M |
| 3300026547|Ga0209156_10327130 | Not Available | 681 | Open in IMG/M |
| 3300026552|Ga0209577_10003013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 15931 | Open in IMG/M |
| 3300027775|Ga0209177_10518584 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027882|Ga0209590_11022720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300027903|Ga0209488_10933064 | Not Available | 606 | Open in IMG/M |
| 3300028536|Ga0137415_10277309 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300028536|Ga0137415_10425547 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300028878|Ga0307278_10330307 | Not Available | 673 | Open in IMG/M |
| 3300031962|Ga0307479_10475597 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_100547592 | 3300002560 | Grasslands Soil | MVLSNGSRLSCGRNARGRKEAERQKKRLAGEATQFFPPKRPAASSAG* |
| JGI25383J37093_101409281 | 3300002560 | Grasslands Soil | SHRIPPVVLPNGSRLSCGRKARTRKAVERQIKRLVGEATQFFPT* |
| JGI25388J43891_10289012 | 3300002909 | Grasslands Soil | MESRVLPNGSRLSCGRNARWRKVLERLRGFAGEATEFLPT |
| JGI25388J43891_10308681 | 3300002909 | Grasslands Soil | CVVPPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0066674_104254771 | 3300005166 | Soil | VLPNGSRLSCGRNAGGRKEVERLIELVGEATQFFSACERPAAS |
| Ga0066677_100520733 | 3300005171 | Soil | MVIVLLPNGSRLSCGRNARGRKAAERQKKSLAGEATQFFLTCERPAASSAC* |
| Ga0066673_108550391 | 3300005175 | Soil | LLPNGSRLSCGRNARGRKAVDPQIKRLAGEATQFFPPERPTA |
| Ga0066690_106098832 | 3300005177 | Soil | PNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0066690_110577431 | 3300005177 | Soil | VDLRVLPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPA |
| Ga0066688_100339272 | 3300005178 | Soil | MTCVVPPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0066688_109876542 | 3300005178 | Soil | MWPSNGSRLSCGRDVRGRKAVEWQTRRLAGEATQFFPHERP |
| Ga0066685_100810831 | 3300005180 | Soil | VQQSNGSRLSCGRNAHVRKDVEPPKRIVREATQFFLGCER |
| Ga0066685_104503692 | 3300005180 | Soil | LPNGSRLSCGRNARRRKAVQRQKKKLAGEATQFFPTGERPAASSAC* |
| Ga0066675_110188891 | 3300005187 | Soil | VPNGSRLSCGRNTRARKELEPQTQRLASEATQFFPTCERPA |
| Ga0066675_114189152 | 3300005187 | Soil | MSLPNGSRLSCGRNARWRKVVERQTKRQAGEATQFFPHERPTA |
| Ga0066675_114275041 | 3300005187 | Soil | VTLPNGSRLSCGRNGGGRKVAEPLIEFAGVATQFLLTGERPAASSAC* |
| Ga0070709_105703351 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MCLSVHDEPLPPNRSRLSCRRNRRWRKEAEAQRKKLAGEATQFFPNCQRPSASSAC |
| Ga0070705_1003039331 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MCLSVHDEVLLPNGSRLSCGRNARRRKEAELETKRQAGEATQFLPTCERPPASSAC* |
| Ga0070708_1009331511 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLPNGSRLSCGRNAQRRKELERLTKRLASEATQFFPTGERPT |
| Ga0066681_100314121 | 3300005451 | Soil | MWLSWLLPNGSRLSCGRNIRGRKVVERRRRLGGEATQFFLTCERPPASGA |
| Ga0070706_1000648671 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAWLPNGSQLSCGRNARWRKAVEPQTKRLAREGTQFLPQERPAAST |
| Ga0070707_1004116161 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTLLPNGSRLSCGRKARGRKAVERQTKRLAGEATQFFLTSERPT |
| Ga0070707_1008982011 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPPNESRLSCGRNARWRKAVQRQTKRLAGEATQFLPTCERP |
| Ga0070707_1015580681 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLRDGVPAPNGSRLSCGRNAWGRKAAERQIKKLIGEATQFFPQERPAASSAC* |
| Ga0070699_1002943402 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGTPVAVLPNESRLSCGRNARRRKALERQTKRPAGEATQFFPQQRPAASSAC* |
| Ga0070699_1007074692 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MHCLRLLPNGSRLSCGRNAQGRKETEPQTKRLASEGTQFLPTGERPSASSAC* |
| Ga0066695_101198661 | 3300005553 | Soil | LPNESRLSCGRNRRWRKVVEAQKKKLAGEATQFLPTCERPSASSAS* |
| Ga0066695_103271811 | 3300005553 | Soil | PNGSRLSCGRSARGRKELERQTKRLASEAPQFLPT* |
| Ga0066695_103646021 | 3300005553 | Soil | MRERTRTDGGLLSNGSRLSCGRNRRWRKEVEAQRKRLAGEATQFFPTCERPA |
| Ga0066707_101087753 | 3300005556 | Soil | MNPNNAAPANGSRLSCGRHGRRRKALERQTKRLASEATQFLPHGRSPASSAC* |
| Ga0066704_103560661 | 3300005557 | Soil | PPNGSRLSCGRSARGRKELERQTKRLASEAPQFLPT* |
| Ga0066704_106420171 | 3300005557 | Soil | MDLRVLSNGSRLSCGRNAQWRKAAERQTKRLASETTQFLPTRERPA |
| Ga0066699_107238952 | 3300005561 | Soil | VLPNGSRLSCGRNTRGRKDVEPQKQRLASEATQLLPTCERPP |
| Ga0066703_102438614 | 3300005568 | Soil | SRLSCGRKARWRKAVERQKKRLAGEATQFFHTGERPSASSAC* |
| Ga0066705_106696511 | 3300005569 | Soil | MRPNRPRFSCGRHDRWRKVVGRQTKSLAGEATQFFPQE |
| Ga0066694_100605364 | 3300005574 | Soil | PPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0066694_103963131 | 3300005574 | Soil | SRLSCGRNARGRKAVERQTKRLAGEATQFFPRERPAASSAC* |
| Ga0066702_100879963 | 3300005575 | Soil | SRLSCGRNAYQRKDLEPLIVPAGEATQFFPHERPAASSAC* |
| Ga0066708_100531495 | 3300005576 | Soil | VPPNGSRLSCGRNGRWRKEVEAQRKRLAGEATQFLP |
| Ga0066708_101429634 | 3300005576 | Soil | VDYGTRPNGSRLSCGRNARWRKEVEGQIKRLAGEATQF |
| Ga0066654_106788632 | 3300005587 | Soil | MGEGVLPNGSRLSCGRNARWRKVVERQTKRQAGEATQFFPHERP |
| Ga0066706_106583561 | 3300005598 | Soil | MVSDAGSGLPNGSRLSCGRNAGGRKAPKLPVELAGEGTQFIPPARPAA |
| Ga0066706_112322952 | 3300005598 | Soil | DLRVLPNGSRLSCGRNVCWRQAVESQTKSLAGEVTQFFPLARPAASSAC* |
| Ga0066656_102488953 | 3300006034 | Soil | MEGYHSDRWLLPNGSRLSCGRNARGRKEVERQKKRLASEGTQFVP |
| Ga0066652_1006664093 | 3300006046 | Soil | PNGSRLSCGRNARWRKAVEPQTERLATEATQGLPCL* |
| Ga0066652_1014019101 | 3300006046 | Soil | QPWSLRVLPNGSRLSCGRNHRWRKEVEAQRKKLAGEATQFLPT* |
| Ga0079222_104775053 | 3300006755 | Agricultural Soil | MALPNESRLSCGRNARRRKAVQPQRKKPASEATQFF |
| Ga0066653_104189551 | 3300006791 | Soil | VLPPNGSRLSCGRTPRGRKELESQTKRLASEATQFF |
| Ga0066659_114391602 | 3300006797 | Soil | MGLPNGSRLSCGRNRCWRKETERPIESVGEATQFVPTRERPPAS |
| Ga0066660_100148971 | 3300006800 | Soil | VRTPPNGSRLSCGRNIRRRKEAEPQTKRLASEATQFLPTCERPA |
| Ga0066660_100836551 | 3300006800 | Soil | KDHWMLLGGAVPPLPNGSRLSCGRNAYQRKDLEPLIVPAGEATQFFPHERPAASSAC* |
| Ga0079220_101730856 | 3300006806 | Agricultural Soil | VLPNGSRLSCGRNAQRRKELERQRQRLASEANTILPYL* |
| Ga0079220_104554891 | 3300006806 | Agricultural Soil | RLSCGRNARRRKAVEAQKKRLAGEATQFFPQERPAASSAC* |
| Ga0075426_100869801 | 3300006903 | Populus Rhizosphere | LGENFHEGLPNGSRLSCGRNARGRKAVEPQKKGLVGEAT |
| Ga0075426_101120164 | 3300006903 | Populus Rhizosphere | RMAFQVMWMLPPNESRLSCGRNARRRKAVEPQTKKLAGEATQFFPQERPTASSAC* |
| Ga0075426_108841922 | 3300006903 | Populus Rhizosphere | SCGRNARWRKAVERQTKKLASEARQFVPTCERPAASSAC* |
| Ga0075436_1014960852 | 3300006914 | Populus Rhizosphere | LPNESRLSCGRNARGRKEVGRQKQRLAGEATEFLPHERPPASSAC* |
| Ga0079219_101344164 | 3300006954 | Agricultural Soil | NESRLSCGRNARGRKAAERQKKRLAGEATQLFPQERPAASSAC* |
| Ga0075435_1017364571 | 3300007076 | Populus Rhizosphere | RLSCGRNARRRKAVEPQKKGLAGEATQFFPHERPPASSAC* |
| Ga0099793_105250641 | 3300007258 | Vadose Zone Soil | VLPNGSRLSCGRRARGRKAVERQIKRLASEATQFLPTCERPSA |
| Ga0066710_1004160204 | 3300009012 | Grasslands Soil | MMRIFYVTPPNGSRVSCGRNRPCRKAVEAQRKRLAGEATQFL |
| Ga0066710_1015982462 | 3300009012 | Grasslands Soil | REAISHLVEPPTGSRLSSGRNAGGRKAVQRQKKTLGGEATQFFPLERPAASSAC |
| Ga0099830_101200565 | 3300009088 | Vadose Zone Soil | AFGEPPNGSRLSCGRNVRGRKAVERQTKRLAGEATQLFPTCERPAASSAG* |
| Ga0066709_1021452801 | 3300009137 | Grasslands Soil | MDLRVLSNGSRLSCGRNAQWRKAAERQTKRLASETTQFLPTRERPAA |
| Ga0066709_1041464191 | 3300009137 | Grasslands Soil | SRLSCGRNARGRKAAERQKKSLAGEATQFFLTCERPAASSAC* |
| Ga0099792_106206231 | 3300009143 | Vadose Zone Soil | MPVSRQGFAQPPNGSRLSCGRNARWRKAVERQIKRPASEATQ |
| Ga0114129_107908781 | 3300009147 | Populus Rhizosphere | MPPCVLPNGSRLSCGRNARGRKETEPQTKRLASEATQFFLT |
| Ga0134082_101115311 | 3300010303 | Grasslands Soil | SRLSCGRNARWRKAVEPQTKMLAGEGTQFFPHERPAASSAC* |
| Ga0134082_101983492 | 3300010303 | Grasslands Soil | RNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0134067_103946251 | 3300010321 | Grasslands Soil | TLPNGSRLSCGRNAGGRKAVKAQVKRLASEATQFFPRERPAASSAC* |
| Ga0134086_102320681 | 3300010323 | Grasslands Soil | KDVGVMPNGSRLSCGRNAFGRKAAHPQIKRLAGEATQFFPHERPAASSAC* |
| Ga0134086_103577101 | 3300010323 | Grasslands Soil | MAPPPNGSRLSCGHAARGRKELEPQTKRLAGEATQFFPQERP |
| Ga0134065_102555172 | 3300010326 | Grasslands Soil | VLLPNGSGLSCGRNGGGRKVAEPLIEFAGVATQFLPTRERPAASSAC* |
| Ga0134080_102716793 | 3300010333 | Grasslands Soil | VQPNGSRLSCGRKARWRKELEPQTKRLASKSTQLFLTCERP |
| Ga0134063_106102081 | 3300010335 | Grasslands Soil | ESRLSCGRNRRWRKVVEAQKTKLAGEATQFLPTRERPAASSAC* |
| Ga0134062_101952924 | 3300010337 | Grasslands Soil | MMPNGSRLSCGRSAQWRKAAERQTKRLASEATQFLPTCER |
| Ga0137392_111173802 | 3300011269 | Vadose Zone Soil | VLRPNGSRLSCGRNGRGRKEAEWQITRLASESTQFFPTGERPA |
| Ga0137391_104131591 | 3300011270 | Vadose Zone Soil | MPVGRHNGSRLSCGRNARRRKAAERQKKRLASEAT |
| Ga0137389_101374101 | 3300012096 | Vadose Zone Soil | VLLPNGSRLSCGRRTRWRKAVERQTKRLAGEATQFLPTGARPAA |
| Ga0137388_106108711 | 3300012189 | Vadose Zone Soil | PNGSRLSCGRNARWRKAAERQKKRLASEATQFFPTGERPAASSAC* |
| Ga0137364_102130514 | 3300012198 | Vadose Zone Soil | MRERTRTDGGLLSNGSRLSCGRNRRWRKEVEAQRKRLAGEATQFFPTCERP |
| Ga0137364_105644891 | 3300012198 | Vadose Zone Soil | MARPNGSCLSCGRNGRRRKGVEAQRKRLAGEATQFFPT |
| Ga0137364_106596441 | 3300012198 | Vadose Zone Soil | EKVMTHLLAEICLRPTGSRLSCGRNARRRKDLEQEEKGLATEATQFFPTCERPSASSAC* |
| Ga0137383_100478656 | 3300012199 | Vadose Zone Soil | MDLRVLSNGSRLSCGRNAQWRKAAERQTKRLASETTQFLPTRERPAASSAC* |
| Ga0137382_102282061 | 3300012200 | Vadose Zone Soil | MASCVPNGSRLSCGRRARRRKELEPQIKRLASEATQFFP |
| Ga0137365_103687693 | 3300012201 | Vadose Zone Soil | MEEELPNGSRLSCGRNACGHKTVEPQTKRLAGEATQFFPTGERPA |
| Ga0137365_104539392 | 3300012201 | Vadose Zone Soil | LIGSAPPNGSRLSCGRNARWRKAVEPQTKRLAGEGTQFFSPERPA |
| Ga0137365_105552792 | 3300012201 | Vadose Zone Soil | DCKALQPPNGSRLSCGRNGGGRKVAEPLIEFAGVATQFLPTRERPAASSAC* |
| Ga0137365_107697831 | 3300012201 | Vadose Zone Soil | MGILWPPPNGSRLSCGRNGRWRKVVERQIKGLGGEATQFFPTRERPA |
| Ga0137363_100059804 | 3300012202 | Vadose Zone Soil | MVVVLLPNGSRLSCGRNRRWRKEVEAQIKRLAGEARQFFPQERPAASSAG* |
| Ga0137399_115951831 | 3300012203 | Vadose Zone Soil | CGRNARRRKVVERQMKRLAREATQFFPIGERPAASSAC* |
| Ga0137362_101789981 | 3300012205 | Vadose Zone Soil | LSCGRNARGRKAVERQTKRLAGEATQFFLTWERPAASSAG* |
| Ga0137380_101236035 | 3300012206 | Vadose Zone Soil | VWKIAWPPNGSRLSCGRNAGGRKAVEPQIKRLASEATQFLPSWERPA |
| Ga0137381_103032323 | 3300012207 | Vadose Zone Soil | MGVALPNGSRLSCGRNGRWRKAVEPQKKRLAGEPTQFLR |
| Ga0137381_117018061 | 3300012207 | Vadose Zone Soil | GSRLSCGRNARWRKALEPQKKRLGGEATQFFPHERPAASSAC* |
| Ga0137376_100277081 | 3300012208 | Vadose Zone Soil | MWKYAGLPNGSRLSCGRNAHRRKAAERQKKRLVGEATQFFPTCERPA |
| Ga0137376_103097461 | 3300012208 | Vadose Zone Soil | NIDGRKELERQTKRLASEATQFLPTGERPAASSAC* |
| Ga0137376_116430331 | 3300012208 | Vadose Zone Soil | NGKRMLLPNGSRLSCGRNARWRKAVEPQTKMLAGEGTQFFPHERPAASSAC* |
| Ga0137379_101509993 | 3300012209 | Vadose Zone Soil | LCLARVAQPNGSRLSCGRNVRRRKVVERQIKRLAGEATQFLPTCERPP |
| Ga0137379_110066971 | 3300012209 | Vadose Zone Soil | RNARRRKAVERQIKRLAGEATQFFLTGERPAASSAC* |
| Ga0137378_100486124 | 3300012210 | Vadose Zone Soil | MRPPNGSRLSCGRSARGRKAMEPQIKRLASEATQFFPHERPAASSAC* |
| Ga0137378_115984412 | 3300012210 | Vadose Zone Soil | VLEHVAPSNGLHSSCGRNSGGRKAVERQIKRLAGEATQFLPTGARPAAS |
| Ga0137378_117309973 | 3300012210 | Vadose Zone Soil | RNARGRKELERQTKKLASEVTQFFPTCERPAASSAC* |
| Ga0137377_108468562 | 3300012211 | Vadose Zone Soil | SCGRNARRRKAVERQKKRLGGEATQFFPHERPPASSAC* |
| Ga0137377_108572092 | 3300012211 | Vadose Zone Soil | MPPNGSRLSCGRKVRGRKAADRQIKRLAGEATQFFPHERPP |
| Ga0137377_110501272 | 3300012211 | Vadose Zone Soil | MASEKRDGALPNGSRLSCGRNGSWRKAVEPQTKRLVAKATQFLPTCERPA |
| Ga0137377_110901701 | 3300012211 | Vadose Zone Soil | PNGSRLSCGRNAGGRKAAEPPIEPAGEGTEFFAPERPTASSAC* |
| Ga0137387_101546241 | 3300012349 | Vadose Zone Soil | VLPNGSRLSCGRNAQRRKVVERRERCGGEGTQLFPTCERS |
| Ga0137372_100280207 | 3300012350 | Vadose Zone Soil | MNPNTAAPPNGSRLSCGRRTRWRKAVERQTKRLAGEATQFLPTGGRPTASSAC* |
| Ga0137372_109316371 | 3300012350 | Vadose Zone Soil | VQPNGSRLSCGRTARGRKAVEPQTKGLAGEATQFLPT |
| Ga0137386_108896681 | 3300012351 | Vadose Zone Soil | MEVAFMAVLPNGSRLSCGRNRRWRKEVEAQRKRLAGEATQFFPTCERP |
| Ga0137367_110895392 | 3300012353 | Vadose Zone Soil | MNPNTAAPPNGSRLSRGRRTRWRKAVERQTKRLAGEATQFLPTGGRPTA |
| Ga0137371_103209211 | 3300012356 | Vadose Zone Soil | MSLMPPPNGSRLSCGRNTRWRKAAEWQTKRLAGEATQFLST |
| Ga0137384_102526304 | 3300012357 | Vadose Zone Soil | LCLARVAQPNGSRLSCGRNVRRRKVVERQIKRLAGEATQFLPTC |
| Ga0137384_102821951 | 3300012357 | Vadose Zone Soil | MHEASESLETLPNGSRLSCGRNRPWRKEVEAQRKRLAGEATQFFPTCERPPASSAC* |
| Ga0137384_103254834 | 3300012357 | Vadose Zone Soil | VTDVSALPNGSRLSCGRNARGRKEVELQKQRLASEGTQFFP |
| Ga0137384_114966081 | 3300012357 | Vadose Zone Soil | GRNARRRKAAEPQIKRLAGEATQFFPQERPAASSAC* |
| Ga0137385_101753391 | 3300012359 | Vadose Zone Soil | VPPPIAVAVPRNGSRLSCGRNARGRKAVERQTKRLAGEATQFFPTCERP |
| Ga0137385_107444861 | 3300012359 | Vadose Zone Soil | MRPNGPRLSCGRSARWRKDVEAQRERLAGEATQFLP |
| Ga0134041_11964741 | 3300012405 | Grasslands Soil | VIGPPNGSRLSCGRNARRRKAVEPQIKRPAGEGTQ |
| Ga0137398_108244402 | 3300012683 | Vadose Zone Soil | NGSRLSCGRNAGWRKAVEPQIKRLASEATQFFPP* |
| Ga0137397_103735901 | 3300012685 | Vadose Zone Soil | VGSVVPNGSRLSCGRNGRGRKAAERQTKRLAGEATQFLP |
| Ga0137395_101562164 | 3300012917 | Vadose Zone Soil | SYRIRPVVLPYGSRLSCGRKARTRKAVERQIKRLVGEATQFFPT* |
| Ga0137396_106020622 | 3300012918 | Vadose Zone Soil | MGLPNGSRLSCGRLAPGRKELERQTKRLASEATQF |
| Ga0137396_108035641 | 3300012918 | Vadose Zone Soil | VTSLVLLPNESRLSCGRNSRWRKAVEPLIEPAGEATQLFPT |
| Ga0137419_101522611 | 3300012925 | Vadose Zone Soil | MPPPNGSRLSCGRNARGRKEMEQQTKKLAGEATQFLPTCERPAASS |
| Ga0137407_112847821 | 3300012930 | Vadose Zone Soil | LLPNGSRLSCGRNARERKEVEAQRKRLAGEATQFFLLGERPSASS |
| Ga0137410_101821581 | 3300012944 | Vadose Zone Soil | VIGVMLPNGSRLSCGRTARGRKEWEPQTQRLAGEATQFIPTCERPAASSAC* |
| Ga0134110_102117752 | 3300012975 | Grasslands Soil | MSLPNGSRLSCGRNARWRKVVERQTKRQAGEATQFFPHER |
| Ga0134081_104159112 | 3300014150 | Grasslands Soil | RMTCVVPPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG* |
| Ga0134075_105473921 | 3300014154 | Grasslands Soil | LLPNGSRLSCGRNARRRKAVQRQKKKLAGEATQFFPTGERPAASSAC* |
| Ga0134079_103126721 | 3300014166 | Grasslands Soil | RRWRKVVEAQKTKLAGEATQFLPTCERPSASSAS* |
| Ga0137411_12566332 | 3300015052 | Vadose Zone Soil | FRDTPLDDASGPNGSRLSCGRNARRRKAVERQIKRLAGEATQFLPTCERPPASSAC* |
| Ga0137409_100361894 | 3300015245 | Vadose Zone Soil | MPNGSRLSCGRNARWRKAVEPQTKRLGGEATQFLPTGERPAASSAC* |
| Ga0137409_106165122 | 3300015245 | Vadose Zone Soil | MVYWKPPNGSRLSCGRNARGRKAVKPQKKRLAGEATQFF |
| Ga0134085_101157651 | 3300015359 | Grasslands Soil | APNGSRLSCGRNARARKAVEPQKQRLAGEATQFFLTGERPTASSGC* |
| Ga0066655_110829891 | 3300018431 | Grasslands Soil | RFTESGGRKGGWRKAVERQKKRLAGGATEFFLICERPAASSA |
| Ga0066667_100456263 | 3300018433 | Grasslands Soil | MTCVVPPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAASSAG |
| Ga0066667_100581584 | 3300018433 | Grasslands Soil | MNPNNAAPPNGSRLSCGRHGRRRKALERQTKRLASEATQFLPHGRSPASSAC |
| Ga0066667_108138823 | 3300018433 | Grasslands Soil | VLPNGSRLSCGRNARGRKVVEPQTKRPASEATQLFLTCERPPAS |
| Ga0066667_118605581 | 3300018433 | Grasslands Soil | SRLSCGRNARGRKAAERQKKSLAGEATQFFLTCERPAASSAC |
| Ga0066662_126029852 | 3300018468 | Grasslands Soil | RNARGRKAAERQKKSLAGEATQFFLTCERPAASSAC |
| Ga0066669_113728843 | 3300018482 | Grasslands Soil | VLPNGSRLSCGRNGRWRKAVERQTKRLAGEATQFLPTCERP |
| Ga0066669_115735841 | 3300018482 | Grasslands Soil | VLPNGSRLSCGRNAGGRKAVDPQIKRLAGEATQFFPPERPTA |
| Ga0247671_10047811 | 3300024284 | Soil | FLWRPNGSRLSCGRNARWRKVVEQQIKRLAGEAAQFFPQARPPASSAC |
| Ga0207684_102876943 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGTPVAVLPNESRLSCGRNARRRKALERQTKRPAGEATQFFPQQRPA |
| Ga0207646_105677082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNGSRLSCGRNAQRRKELERLTKRLASEATQFFPTGER |
| Ga0207646_107778983 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPPNESRLSCGRNARWRKAVQRQTKRLAGEATQFLPTCE |
| Ga0209350_10775891 | 3300026277 | Grasslands Soil | VRPNGSRLSCGRSAGRRKELEQQTKRLASEGTQFFPPE |
| Ga0209235_10096706 | 3300026296 | Grasslands Soil | MVLSNGSRLSCGRNARGRKEAERQKKRLAGEATQFFPPKRPAASSAG |
| Ga0209237_12440782 | 3300026297 | Grasslands Soil | SCGRNARRRKAPEGQIKKLVGEATQLFLTCERPAASSAC |
| Ga0209027_11730261 | 3300026300 | Grasslands Soil | GSRLSCGRKARWRKAVERQKKRLAGEATQFFHTGERPSASSAC |
| Ga0209238_10085442 | 3300026301 | Grasslands Soil | MDLRVLSNGSRLSCGRNAQWRKAAERQTKRLASETTQFLPTRERPAASSAC |
| Ga0209238_12349831 | 3300026301 | Grasslands Soil | NADGRKPAEWQIKRLASEATQFFPTGERPAASSAC |
| Ga0209471_12252842 | 3300026318 | Soil | LAVLPNGSRLSCGRKARWRKAVERQKKRLAGEATQFFHTGERPS |
| Ga0209375_10746552 | 3300026329 | Soil | MNPNNAAPANGSRLSCGRHGRRRKALERQTKRLASEATQFLPHGRSPASSAC |
| Ga0209473_12381491 | 3300026330 | Soil | LNVLPNGSRLSCGRNAGGRKAVDPQIKRLAGEATQFFPPERPTASS |
| Ga0209158_10095012 | 3300026333 | Soil | MWKYAGLPNGSRLSCGRSARGRKELERQTKRLASEAPQFLPT |
| Ga0209158_10167946 | 3300026333 | Soil | VDLRVLPNGSRLSCGRNTGGRKEVERLMELNGEATQFFLTGERPAAS |
| Ga0209158_11095962 | 3300026333 | Soil | MVIVLLPNGSRLSCGRNARGRKAAERQKKSLAGEATQFFLTCERPAASSAC |
| Ga0209059_10525383 | 3300026527 | Soil | PPLPNGSRLSCGRNAYQRKDLEPLIVPAGEATQFFPHERPAASSAC |
| Ga0209376_12777791 | 3300026540 | Soil | SRLSCGRNGRRRKAVERQIKRLAGEATQFFHTCERPAASSAC |
| Ga0209156_100643545 | 3300026547 | Soil | MVPPNGSRLSCGRNTRARKELEPQTQRLASEATQFFPTCERPAASSAC |
| Ga0209156_103271301 | 3300026547 | Soil | MPLVVAPPNGSRLSCGRDARWRKEAGPLIELDGETTQFFHTDERPAASSAC |
| Ga0209577_1000301322 | 3300026552 | Soil | VPPLPNGSRLSCGRNAYQRKDLEPLIVPAGEATQFFPHERPAASSAC |
| Ga0209177_105185841 | 3300027775 | Agricultural Soil | NESRLSCGRNARGRKAAERQKKRLAGEATQLFPQERPAASSAC |
| Ga0209590_110227201 | 3300027882 | Vadose Zone Soil | SCGRNAGGRKAVDWQKKRLASEATQFFHTCERPAASSAC |
| Ga0209488_109330641 | 3300027903 | Vadose Zone Soil | RNARGRKAMERHRKTLGGAATQFLPTGERPAASSAC |
| Ga0137415_102773094 | 3300028536 | Vadose Zone Soil | MLPPNGSRLSCGRNTGGRKAVERQTKKLAGEATQFFYTCE |
| Ga0137415_104255471 | 3300028536 | Vadose Zone Soil | GRNGRGRKALEWQTKRQASEATQFFLTGERPAASSAC |
| Ga0307278_103303071 | 3300028878 | Soil | SCGRNGGGRKAVGRQRKRLAGEATQFFLTGERPAASSAC |
| Ga0307479_104755971 | 3300031962 | Hardwood Forest Soil | VLRPNESRLSCGRNARRRKEVDPQKKRLVGEATQFFPQERPTAQAH |
| ⦗Top⦘ |