


| Basic Information | |
|---|---|
| Family ID | F035268 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.59 % |
| % of genes near scaffold ends (potentially truncated) | 98.26 % |
| % of genes from short scaffolds (< 2000 bps) | 90.70 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.860 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.372 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.744 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.698 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF03069 | FmdA_AmdA | 41.86 |
| PF00296 | Bac_luciferase | 5.23 |
| PF05154 | TM2 | 4.07 |
| PF03795 | YCII | 3.49 |
| PF04392 | ABC_sub_bind | 2.91 |
| PF00903 | Glyoxalase | 2.91 |
| PF07681 | DoxX | 2.91 |
| PF00106 | adh_short | 2.33 |
| PF01435 | Peptidase_M48 | 2.33 |
| PF13420 | Acetyltransf_4 | 2.33 |
| PF01243 | Putative_PNPOx | 1.74 |
| PF03070 | TENA_THI-4 | 1.74 |
| PF13561 | adh_short_C2 | 1.16 |
| PF00581 | Rhodanese | 1.16 |
| PF04542 | Sigma70_r2 | 1.16 |
| PF12770 | CHAT | 1.16 |
| PF13649 | Methyltransf_25 | 1.16 |
| PF00072 | Response_reg | 0.58 |
| PF00496 | SBP_bac_5 | 0.58 |
| PF13474 | SnoaL_3 | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF02775 | TPP_enzyme_C | 0.58 |
| PF02633 | Creatininase | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF02776 | TPP_enzyme_N | 0.58 |
| PF13424 | TPR_12 | 0.58 |
| PF02518 | HATPase_c | 0.58 |
| PF13340 | DUF4096 | 0.58 |
| PF01244 | Peptidase_M19 | 0.58 |
| PF01841 | Transglut_core | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 41.86 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.23 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 4.07 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.49 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.91 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.91 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.16 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.16 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.16 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.16 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.58 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.86 % |
| Unclassified | root | N/A | 33.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11310977 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300000953|JGI11615J12901_10059010 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300002122|C687J26623_10013204 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300002558|JGI25385J37094_10011637 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3140 | Open in IMG/M |
| 3300002561|JGI25384J37096_10013252 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
| 3300002912|JGI25386J43895_10177365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300003347|JGI26128J50194_1001508 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300003996|Ga0055467_10181232 | Not Available | 643 | Open in IMG/M |
| 3300004052|Ga0055490_10094314 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300004157|Ga0062590_100261350 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300004157|Ga0062590_100276648 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300004268|Ga0066398_10074750 | Not Available | 740 | Open in IMG/M |
| 3300005178|Ga0066688_10373586 | Not Available | 924 | Open in IMG/M |
| 3300005180|Ga0066685_10376945 | Not Available | 985 | Open in IMG/M |
| 3300005183|Ga0068993_10023329 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005290|Ga0065712_10362854 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005295|Ga0065707_10221554 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005295|Ga0065707_10675525 | Not Available | 651 | Open in IMG/M |
| 3300005330|Ga0070690_100744014 | Not Available | 756 | Open in IMG/M |
| 3300005331|Ga0070670_102001717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300005332|Ga0066388_100464285 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300005340|Ga0070689_101168344 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005446|Ga0066686_10503248 | Not Available | 825 | Open in IMG/M |
| 3300005545|Ga0070695_100249823 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300005546|Ga0070696_100548957 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005549|Ga0070704_101625178 | Not Available | 596 | Open in IMG/M |
| 3300005555|Ga0066692_11012285 | Not Available | 508 | Open in IMG/M |
| 3300005577|Ga0068857_101295828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae | 707 | Open in IMG/M |
| 3300005586|Ga0066691_10757706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300005713|Ga0066905_100858010 | Not Available | 791 | Open in IMG/M |
| 3300005713|Ga0066905_101358584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 641 | Open in IMG/M |
| 3300005764|Ga0066903_105960218 | Not Available | 639 | Open in IMG/M |
| 3300005937|Ga0081455_10731657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 627 | Open in IMG/M |
| 3300006032|Ga0066696_10233169 | Not Available | 1185 | Open in IMG/M |
| 3300006049|Ga0075417_10486255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300006755|Ga0079222_11765829 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006806|Ga0079220_11856404 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300006846|Ga0075430_100904038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300006847|Ga0075431_101155394 | Not Available | 738 | Open in IMG/M |
| 3300006852|Ga0075433_10078696 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
| 3300006853|Ga0075420_101515782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 575 | Open in IMG/M |
| 3300006871|Ga0075434_102502144 | Not Available | 517 | Open in IMG/M |
| 3300006881|Ga0068865_101218720 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006954|Ga0079219_11105036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300006969|Ga0075419_11062960 | Not Available | 592 | Open in IMG/M |
| 3300007076|Ga0075435_101587471 | Not Available | 574 | Open in IMG/M |
| 3300007258|Ga0099793_10673772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300009012|Ga0066710_100763371 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300009012|Ga0066710_102811902 | Not Available | 688 | Open in IMG/M |
| 3300009012|Ga0066710_103620412 | Not Available | 582 | Open in IMG/M |
| 3300009012|Ga0066710_104472125 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009053|Ga0105095_10316169 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300009088|Ga0099830_10486529 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300009089|Ga0099828_10471860 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300009089|Ga0099828_11758576 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009090|Ga0099827_11911167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 517 | Open in IMG/M |
| 3300009100|Ga0075418_12638858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 548 | Open in IMG/M |
| 3300009147|Ga0114129_11874861 | Not Available | 727 | Open in IMG/M |
| 3300009162|Ga0075423_10307449 | Not Available | 1662 | Open in IMG/M |
| 3300009174|Ga0105241_11553663 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300009176|Ga0105242_10679717 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300009553|Ga0105249_12201634 | Not Available | 624 | Open in IMG/M |
| 3300009837|Ga0105058_1082766 | Not Available | 741 | Open in IMG/M |
| 3300010046|Ga0126384_10038394 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300010047|Ga0126382_11180321 | Not Available | 684 | Open in IMG/M |
| 3300010047|Ga0126382_12325552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300010304|Ga0134088_10065201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1686 | Open in IMG/M |
| 3300010322|Ga0134084_10443685 | Not Available | 515 | Open in IMG/M |
| 3300010337|Ga0134062_10276523 | Not Available | 788 | Open in IMG/M |
| 3300010360|Ga0126372_10021971 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300010360|Ga0126372_10063689 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300010360|Ga0126372_10668682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae | 1008 | Open in IMG/M |
| 3300010362|Ga0126377_10587421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium | 1157 | Open in IMG/M |
| 3300010366|Ga0126379_11905420 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010398|Ga0126383_10557585 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300010398|Ga0126383_11101168 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300010398|Ga0126383_11866250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300010401|Ga0134121_10573429 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010403|Ga0134123_11804393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 665 | Open in IMG/M |
| 3300011271|Ga0137393_10151616 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300011429|Ga0137455_1155694 | Not Available | 682 | Open in IMG/M |
| 3300011443|Ga0137457_1129472 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012202|Ga0137363_10941809 | Not Available | 733 | Open in IMG/M |
| 3300012202|Ga0137363_11016327 | Not Available | 704 | Open in IMG/M |
| 3300012203|Ga0137399_10647929 | Not Available | 889 | Open in IMG/M |
| 3300012203|Ga0137399_11589272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 542 | Open in IMG/M |
| 3300012206|Ga0137380_10297656 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300012206|Ga0137380_10335663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
| 3300012349|Ga0137387_11014988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
| 3300012351|Ga0137386_10186558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1489 | Open in IMG/M |
| 3300012582|Ga0137358_10861214 | Not Available | 597 | Open in IMG/M |
| 3300012685|Ga0137397_10544670 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012922|Ga0137394_10551940 | Not Available | 976 | Open in IMG/M |
| 3300012925|Ga0137419_11120119 | Not Available | 656 | Open in IMG/M |
| 3300012929|Ga0137404_11539501 | Not Available | 616 | Open in IMG/M |
| 3300012930|Ga0137407_11987773 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012948|Ga0126375_10633064 | Not Available | 822 | Open in IMG/M |
| 3300012957|Ga0164303_10443687 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012961|Ga0164302_10774429 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012977|Ga0134087_10205263 | Not Available | 884 | Open in IMG/M |
| 3300013102|Ga0157371_10118678 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300014166|Ga0134079_10113409 | Not Available | 1051 | Open in IMG/M |
| 3300014325|Ga0163163_11364569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae | 771 | Open in IMG/M |
| 3300014326|Ga0157380_11017203 | Not Available | 863 | Open in IMG/M |
| 3300017974|Ga0187777_11212928 | Not Available | 552 | Open in IMG/M |
| 3300018074|Ga0184640_10077017 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300018082|Ga0184639_10472319 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300020060|Ga0193717_1050833 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300021560|Ga0126371_11943985 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300022694|Ga0222623_10396770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300025173|Ga0209824_10074599 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300025899|Ga0207642_10672623 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025916|Ga0207663_10829243 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 737 | Open in IMG/M |
| 3300025925|Ga0207650_10508979 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300025927|Ga0207687_11941919 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025932|Ga0207690_11481541 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300025971|Ga0210102_1057416 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300025992|Ga0208775_1014135 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300026041|Ga0207639_11172449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae | 721 | Open in IMG/M |
| 3300026295|Ga0209234_1088456 | Not Available | 1173 | Open in IMG/M |
| 3300026315|Ga0209686_1015199 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
| 3300026329|Ga0209375_1243116 | Not Available | 611 | Open in IMG/M |
| 3300026333|Ga0209158_1336868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300026335|Ga0209804_1137925 | Not Available | 1099 | Open in IMG/M |
| 3300026335|Ga0209804_1241217 | Not Available | 694 | Open in IMG/M |
| 3300026354|Ga0257180_1021358 | Not Available | 843 | Open in IMG/M |
| 3300026507|Ga0257165_1050752 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300026528|Ga0209378_1192167 | Not Available | 695 | Open in IMG/M |
| 3300026528|Ga0209378_1294706 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026536|Ga0209058_1040652 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300026536|Ga0209058_1075495 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300026540|Ga0209376_1223442 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300027364|Ga0209967_1012290 | Not Available | 1208 | Open in IMG/M |
| 3300027552|Ga0209982_1014140 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300027678|Ga0209011_1032492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1651 | Open in IMG/M |
| 3300027765|Ga0209073_10454488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300027787|Ga0209074_10372733 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027873|Ga0209814_10315104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300027875|Ga0209283_10217228 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300027882|Ga0209590_10274910 | Not Available | 1078 | Open in IMG/M |
| 3300027907|Ga0207428_10884453 | Not Available | 632 | Open in IMG/M |
| 3300027909|Ga0209382_11175950 | Not Available | 786 | Open in IMG/M |
| 3300027910|Ga0209583_10718127 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027947|Ga0209868_1006339 | Not Available | 1113 | Open in IMG/M |
| 3300028536|Ga0137415_10563640 | Not Available | 949 | Open in IMG/M |
| 3300028587|Ga0247828_10769842 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300028589|Ga0247818_10395340 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300028596|Ga0247821_10527376 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300028809|Ga0247824_10520458 | Not Available | 704 | Open in IMG/M |
| 3300028814|Ga0307302_10149751 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300028878|Ga0307278_10210670 | Not Available | 866 | Open in IMG/M |
| 3300031538|Ga0310888_10660014 | Not Available | 639 | Open in IMG/M |
| 3300031548|Ga0307408_100264680 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300031679|Ga0318561_10271342 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300031713|Ga0318496_10055523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2059 | Open in IMG/M |
| 3300031720|Ga0307469_10100851 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300031720|Ga0307469_10441265 | Not Available | 1124 | Open in IMG/M |
| 3300031720|Ga0307469_10896353 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031764|Ga0318535_10072413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1476 | Open in IMG/M |
| 3300031765|Ga0318554_10062064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2062 | Open in IMG/M |
| 3300031793|Ga0318548_10068608 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300031893|Ga0318536_10151715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300031908|Ga0310900_10791532 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031947|Ga0310909_10134427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2020 | Open in IMG/M |
| 3300032180|Ga0307471_100600882 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300032180|Ga0307471_102171427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 699 | Open in IMG/M |
| 3300032180|Ga0307471_103584452 | Not Available | 549 | Open in IMG/M |
| 3300032770|Ga0335085_10258201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2090 | Open in IMG/M |
| 3300034660|Ga0314781_149323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300034773|Ga0364936_134343 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.74% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.16% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.16% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.58% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_113109773 | 3300000890 | Soil | AWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA* |
| JGI11615J12901_100590101 | 3300000953 | Soil | GGTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPHAAD* |
| C687J26623_100132041 | 3300002122 | Soil | AWILALAFTSGPADVLAYMPAVAWRSGTGMVVWPDVKN* |
| JGI25385J37094_100116375 | 3300002558 | Grasslands Soil | LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA* |
| JGI25384J37096_100132521 | 3300002561 | Grasslands Soil | LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWTELAA* |
| JGI25386J43895_101773652 | 3300002912 | Grasslands Soil | ELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA* |
| JGI26128J50194_10015084 | 3300003347 | Arabidopsis Thaliana Rhizosphere | AELLAWVLALAFTRGPAEVLAYMPAVAWRSGTGMVVWPGLQS* |
| Ga0055467_101812322 | 3300003996 | Natural And Restored Wetlands | TAELLAWILVLAMTRGPADVLAYMPAIAWRSGTGMVVWNELGGADAP* |
| Ga0055490_100943141 | 3300004052 | Natural And Restored Wetlands | ELLAWILALAFTSGPAEVLAYMPAIAWRSGTGMVVWPGVQN* |
| Ga0062590_1002613501 | 3300004157 | Soil | AELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA* |
| Ga0062590_1002766483 | 3300004157 | Soil | TAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSDLA* |
| Ga0066398_100747502 | 3300004268 | Tropical Forest Soil | GGTAELLAWVLVLAFTRGAADVLAYMPAVAWRSGTGMVVWNEMAR* |
| Ga0066688_103735862 | 3300005178 | Soil | ELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED* |
| Ga0066685_103769452 | 3300005180 | Soil | LSWFLVLAMTHGPADVLAYMPAVAWRSGTGMVAWNELADGAAARRS* |
| Ga0068993_100233293 | 3300005183 | Natural And Restored Wetlands | ELLAWVLALAFTTGPAEVLAYMPALAWRSGTGMVVWNGLAS* |
| Ga0068993_100873031 | 3300005183 | Natural And Restored Wetlands | AELLAWIAALPFTAGPAEVLGYAPSVAWRTGTGMVAWPRLA* |
| Ga0065712_103628541 | 3300005290 | Miscanthus Rhizosphere | LAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPQVAN* |
| Ga0065707_102215544 | 3300005295 | Switchgrass Rhizosphere | TAELLAWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN* |
| Ga0065707_106755252 | 3300005295 | Switchgrass Rhizosphere | LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAQ* |
| Ga0070690_1007440141 | 3300005330 | Switchgrass Rhizosphere | GGTAELLAWVLVLAFTRGPADVLAYMPAIAWRSGTGMVVWNEMA* |
| Ga0070670_1020017171 | 3300005331 | Switchgrass Rhizosphere | AELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGKFA* |
| Ga0066388_1004642853 | 3300005332 | Tropical Forest Soil | LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVVWDGFAGSAAALV* |
| Ga0070689_1011683442 | 3300005340 | Switchgrass Rhizosphere | ELIAWVLAMAFTKGSAEVLAYMPALAWRSGTGMVVWPHLA* |
| Ga0066686_105032481 | 3300005446 | Soil | GTAELLAWVLVLALTRGPADVLAYMPAVAWRSGTGMVVWNEMA* |
| Ga0070695_1002498233 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS* |
| Ga0070696_1005489573 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVRN* |
| Ga0070704_1016251781 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNDMA* |
| Ga0066692_110122851 | 3300005555 | Soil | AELLAWVLVLARTRGPADVLAYMPAVAWRSGTGMVVWNEMA* |
| Ga0068857_1012958282 | 3300005577 | Corn Rhizosphere | LAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELVS* |
| Ga0066691_107577062 | 3300005586 | Soil | TAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA* |
| Ga0066905_1008580101 | 3300005713 | Tropical Forest Soil | GTAELNAWITTLAFTRGPADVLAYMPAIAWRSGTGMVVWNELR* |
| Ga0066905_1013585842 | 3300005713 | Tropical Forest Soil | LVLAFTRGPADVLAYMPAVAWRSGTGMVAWNELTA* |
| Ga0066903_1059602182 | 3300005764 | Tropical Forest Soil | TAELLAWVLVLAFTTGPAEVLAYMPAIAWRSGTGMVVWNGLGS* |
| Ga0081455_107316572 | 3300005937 | Tabebuia Heterophylla Rhizosphere | IAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA* |
| Ga0066696_102331691 | 3300006032 | Soil | LAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA* |
| Ga0075417_104862552 | 3300006049 | Populus Rhizosphere | LAWIAVLPFTTGPADVLAYMPALAWRSGTGMVVWNELAA* |
| Ga0079222_117658291 | 3300006755 | Agricultural Soil | TAELLAWMVALAFTSGPAEVLAYMPAIAWRSGTGMVVWPDVKN* |
| Ga0079220_118564041 | 3300006806 | Agricultural Soil | AELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR* |
| Ga0075430_1009040381 | 3300006846 | Populus Rhizosphere | ELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA* |
| Ga0075431_1011553941 | 3300006847 | Populus Rhizosphere | GTAELLAWVLVLAFTAGPADVLAYMPAVAWRSGTGMVVWNELAP* |
| Ga0075433_100786961 | 3300006852 | Populus Rhizosphere | VLAFTSGPADVLAYMPAIAWRTGTGMVVWNEVAR* |
| Ga0075420_1015157821 | 3300006853 | Populus Rhizosphere | WVLVLAFTAGPADVLAYMPAVAWRSGTGMVVWNEFSA* |
| Ga0075434_1025021441 | 3300006871 | Populus Rhizosphere | TAELLAWIAVLPFTTGPADVVGYAPTLAWRTGTGMVAWPCSS* |
| Ga0068865_1012187201 | 3300006881 | Miscanthus Rhizosphere | LAMAFTKGSAEVLAYMPALAWRSGTGMVVWPHLA* |
| Ga0079219_111050362 | 3300006954 | Agricultural Soil | CVAVLPFPTGPADVLTYMPAIAWRSGTGMVVWDGIAG* |
| Ga0075419_110629602 | 3300006969 | Populus Rhizosphere | GTAELLAWIVALAFTRGSADVLAYMPAVAWRSGTGMVAWNELAA* |
| Ga0075435_1015874711 | 3300007076 | Populus Rhizosphere | TAELLAWVLVMAFTNGPADVLAYMPAVAWRSGTGMVVWNEFSA* |
| Ga0099793_106737722 | 3300007258 | Vadose Zone Soil | AELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMD* |
| Ga0066710_1007633711 | 3300009012 | Grasslands Soil | LLSWFLVLAMTHGPADVLAYMPAVAWRSGTGMVAWNELADAAAARRS |
| Ga0066710_1028119022 | 3300009012 | Grasslands Soil | WFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWSELAGD |
| Ga0066710_1036204122 | 3300009012 | Grasslands Soil | VLAFTAGPADVLAYMPAIAWRTGTGMVVWNELAAATAE |
| Ga0066710_1044721252 | 3300009012 | Grasslands Soil | LTMAFTRGPADVLAYMPAIEWRTGTGMVVWNEMAS |
| Ga0105095_103161692 | 3300009053 | Freshwater Sediment | AELLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWSELA* |
| Ga0099830_104865291 | 3300009088 | Vadose Zone Soil | LVLAFTAGPAEVLAYMPAIAWRSGTGMVVWDGLSR* |
| Ga0099828_104718601 | 3300009089 | Vadose Zone Soil | TAELLAWILVLAFTAGPAEVLAYMPAIAWRSGTGMVVWNGLSR* |
| Ga0099828_117585762 | 3300009089 | Vadose Zone Soil | ELLAWFMALAFTSGPAEVLVYMPAIAWRSGTGMVIWNEMA* |
| Ga0099827_119111671 | 3300009090 | Vadose Zone Soil | PADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMD* |
| Ga0075418_126388582 | 3300009100 | Populus Rhizosphere | LVLAFTAGPADVLAYMPAVAWRSGTGMVVWNEFSV* |
| Ga0114129_118748612 | 3300009147 | Populus Rhizosphere | LLSWFLVLAFTAGAADVLAYMPAVAWRSGTGMVTWNEMA* |
| Ga0075423_103074494 | 3300009162 | Populus Rhizosphere | LAWIVTLAFTRGPADVLAYMPAIAWRSGTGMVVWNEVT* |
| Ga0105241_115536632 | 3300009174 | Corn Rhizosphere | VLALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN* |
| Ga0105242_106797173 | 3300009176 | Miscanthus Rhizosphere | WMVALAFTTGPAEVLAYMPAIVWRSGTGMVVWPDVRN* |
| Ga0114945_103956761 | 3300009444 | Thermal Springs | TAELLAWIAVLPFTAGPAELLAYTASTAWRTGVGMAAWPVSS* |
| Ga0105249_122016342 | 3300009553 | Switchgrass Rhizosphere | GGTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNEMA* |
| Ga0105058_10827662 | 3300009837 | Groundwater Sand | WVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR* |
| Ga0126384_100383941 | 3300010046 | Tropical Forest Soil | AELLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNGLAA* |
| Ga0126382_111803212 | 3300010047 | Tropical Forest Soil | LVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAG* |
| Ga0126382_123255521 | 3300010047 | Tropical Forest Soil | LVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR* |
| Ga0134088_100652013 | 3300010304 | Grasslands Soil | LLAWVLVLAFTQGPADVLAYMPAVAWRSGTGMVVWNEMAK* |
| Ga0134084_104436852 | 3300010322 | Grasslands Soil | AWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA* |
| Ga0134062_102765232 | 3300010337 | Grasslands Soil | ELLSWFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWGELAGD* |
| Ga0126372_100219717 | 3300010360 | Tropical Forest Soil | GGTAELLAWIVALAFTRGSADVLAYMPAVAWRSGTGMVAWNDLAA* |
| Ga0126372_100636895 | 3300010360 | Tropical Forest Soil | VLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA* |
| Ga0126372_106686821 | 3300010360 | Tropical Forest Soil | LVMAFTRGPAEVLAYMPAIAWRTGTGMVIWNELAS* |
| Ga0126377_105874211 | 3300010362 | Tropical Forest Soil | GTAELLAWIAALPFTAGPAEVLGYAPSLAWRTGTGMVVWPRLV* |
| Ga0126379_119054202 | 3300010366 | Tropical Forest Soil | EVAATLAFTEGPADVLAYMPAIDWRTGTGMVIWNQLAGR* |
| Ga0126383_105575853 | 3300010398 | Tropical Forest Soil | IAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPDLA* |
| Ga0126383_111011681 | 3300010398 | Tropical Forest Soil | TLVLAFTKGPAEVLAYMPALAWRSGTGMVVWPQLA* |
| Ga0126383_118662503 | 3300010398 | Tropical Forest Soil | WVLALAFTAGPAEVLAYVPALAWRTGTGMVVWNQLT* |
| Ga0134121_105734291 | 3300010401 | Terrestrial Soil | LLAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS* |
| Ga0134123_118043931 | 3300010403 | Terrestrial Soil | AELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA* |
| Ga0137393_101516165 | 3300011271 | Vadose Zone Soil | WMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVRN* |
| Ga0137455_11556941 | 3300011429 | Soil | AWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALS* |
| Ga0137457_11294722 | 3300011443 | Soil | LLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALS* |
| Ga0137363_109418092 | 3300012202 | Vadose Zone Soil | LAWVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAQ* |
| Ga0137363_110163272 | 3300012202 | Vadose Zone Soil | LAMTRGPADVLAYMPAVAWRSGTGMVAWGELAGD* |
| Ga0137399_106479291 | 3300012203 | Vadose Zone Soil | LAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWNELAA* |
| Ga0137399_115892722 | 3300012203 | Vadose Zone Soil | VALAFTTGPAEVLAYMPAVAWRSGTGMVVWNTLAA* |
| Ga0137380_102976561 | 3300012206 | Vadose Zone Soil | ELLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPTLA* |
| Ga0137380_103356631 | 3300012206 | Vadose Zone Soil | GPADVLAYMPAVAWRTGTGMVVWNEFAEPSATRT* |
| Ga0137387_110149882 | 3300012349 | Vadose Zone Soil | ELLAWVLVLAFTRGPVDVLTYMPAVAWRSGTGMVIWNELAR* |
| Ga0137386_101865583 | 3300012351 | Vadose Zone Soil | ALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA* |
| Ga0137358_108612141 | 3300012582 | Vadose Zone Soil | ELLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPGLI* |
| Ga0137397_105446703 | 3300012685 | Vadose Zone Soil | AWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN* |
| Ga0137394_105519402 | 3300012922 | Vadose Zone Soil | ELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAP* |
| Ga0137419_111201192 | 3300012925 | Vadose Zone Soil | SWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPGLI* |
| Ga0137404_115395011 | 3300012929 | Vadose Zone Soil | TAELLAWVLVLAFTQGPADILAYMPALAWRSGTGMVVWNDMAK* |
| Ga0137407_119877733 | 3300012930 | Vadose Zone Soil | IVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA* |
| Ga0126375_106330642 | 3300012948 | Tropical Forest Soil | WVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNEMA* |
| Ga0164303_104436871 | 3300012957 | Soil | ELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGLVVWPAVAH* |
| Ga0164302_107744291 | 3300012961 | Soil | WMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVAN* |
| Ga0134087_102052632 | 3300012977 | Grasslands Soil | WFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWSALAGD* |
| Ga0157371_101186781 | 3300013102 | Corn Rhizosphere | GGTAELLAWVLALAFTRGPAEVLAYMPAVAWRSGTGMVVWPGLQS* |
| Ga0134079_101134091 | 3300014166 | Grasslands Soil | GGTAELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED* |
| Ga0163163_113645691 | 3300014325 | Switchgrass Rhizosphere | LLAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELVS* |
| Ga0157380_110172031 | 3300014326 | Switchgrass Rhizosphere | SELLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALA* |
| Ga0187777_112129281 | 3300017974 | Tropical Peatland | AWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWDEMAS |
| Ga0184640_100770173 | 3300018074 | Groundwater Sediment | AWVAVLPFTAGPADVLAYMPAIAWRSGTGMVVWNELAS |
| Ga0184639_104723192 | 3300018082 | Groundwater Sediment | WILTLAFTTGPAEVLAYMPAIAWRSGTGMVVWSGVKN |
| Ga0193717_10508331 | 3300020060 | Soil | ARNPYVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS |
| Ga0126371_119439851 | 3300021560 | Tropical Forest Soil | AWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA |
| Ga0222623_103967702 | 3300022694 | Groundwater Sediment | LVLPFTHGPADVLTYMPAVAWRSGTGMVVWNELAR |
| Ga0209824_100745991 | 3300025173 | Wastewater | AWILVLAFTTGPADVLAYMPAIAWRSGTGMVVWNHFA |
| Ga0207642_106726232 | 3300025899 | Miscanthus Rhizosphere | ELLAWVLVMAFTRGPAEALAYMPAIAWRSGTGMVIWNELAS |
| Ga0207663_108292431 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGTAELLAWVVALAFTSGPAEVLAYMPAIAWRTGTGMVVWPDVKN |
| Ga0207650_105089791 | 3300025925 | Switchgrass Rhizosphere | ELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPQVAN |
| Ga0207687_119419192 | 3300025927 | Miscanthus Rhizosphere | LAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA |
| Ga0207690_114815411 | 3300025932 | Corn Rhizosphere | AWILVLAFTTGPAEVLAYMPAIAWRSGTGMVAWSQFAA |
| Ga0210102_10574161 | 3300025971 | Natural And Restored Wetlands | ELLAWILALAFTSGPAEVLAYMPAIAWRSGTGMVVWPGVQN |
| Ga0208775_10141352 | 3300025992 | Rice Paddy Soil | WMVAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVKN |
| Ga0207639_111724491 | 3300026041 | Corn Rhizosphere | LVMAFTRGPAEVLAYMPAIAWRSGTGMAIWNELAS |
| Ga0209234_10884561 | 3300026295 | Grasslands Soil | TAELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED |
| Ga0209686_10151995 | 3300026315 | Soil | LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA |
| Ga0209375_12431162 | 3300026329 | Soil | ELLAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWTELAA |
| Ga0209158_13368682 | 3300026333 | Soil | TAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA |
| Ga0209804_11379251 | 3300026335 | Soil | GGTAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA |
| Ga0209804_12412172 | 3300026335 | Soil | VLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNGLAR |
| Ga0257180_10213582 | 3300026354 | Soil | WVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR |
| Ga0257165_10507521 | 3300026507 | Soil | GGTAELLAWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN |
| Ga0209378_11921672 | 3300026528 | Soil | ELLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA |
| Ga0209378_12947062 | 3300026528 | Soil | IVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA |
| Ga0209058_10406525 | 3300026536 | Soil | LAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA |
| Ga0209058_10754951 | 3300026536 | Soil | ELLAWIVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA |
| Ga0209376_12234421 | 3300026540 | Soil | LLAWIVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA |
| Ga0209967_10122901 | 3300027364 | Arabidopsis Thaliana Rhizosphere | GGTAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA |
| Ga0209982_10141402 | 3300027552 | Arabidopsis Thaliana Rhizosphere | GTAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA |
| Ga0209011_10324921 | 3300027678 | Forest Soil | TAELLAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWNELAA |
| Ga0209073_104544881 | 3300027765 | Agricultural Soil | AELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR |
| Ga0209074_103727331 | 3300027787 | Agricultural Soil | TAELLAWMVALAFTSGPAEVLAYMPAIAWRSGTGMVVWPDVKN |
| Ga0209814_103151042 | 3300027873 | Populus Rhizosphere | LLAWIAVLPFTTGPADVLAYMPALAWRSGTGMVVWNELAA |
| Ga0209283_102172283 | 3300027875 | Vadose Zone Soil | AMTRGPADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMH |
| Ga0209590_102749102 | 3300027882 | Vadose Zone Soil | LLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPSLI |
| Ga0207428_108844531 | 3300027907 | Populus Rhizosphere | LLAWIAVLPFTTGPADVVGYAPTLAWRTGTGMVAWPCSS |
| Ga0209382_111759501 | 3300027909 | Populus Rhizosphere | AWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR |
| Ga0209583_107181272 | 3300027910 | Watersheds | GGTAELLAWIMALAFTSGPAEVLAYMPAVAWRSGTGMVVWPEVRT |
| Ga0209868_10063392 | 3300027947 | Groundwater Sand | TAELLAWVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR |
| Ga0137415_105636402 | 3300028536 | Vadose Zone Soil | LLAWIVALAFTRGPADVLAYMPALAWRSGTGMVVWNEMT |
| Ga0247828_107698422 | 3300028587 | Soil | RHVREHLGGTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVAN |
| Ga0247818_103953403 | 3300028589 | Soil | LLAWVAVLPFTAGPADVLAYMPAVAWRSGTGMVVWTEMA |
| Ga0247821_105273761 | 3300028596 | Soil | VGIGGTAELLAWVAVLPFTAGPADVLAYMPAVAWRSGTGMVVWTEMA |
| Ga0247824_105204581 | 3300028809 | Soil | VLVLAMTRGPADVLAYMPAIAWRSGTGMVVWNEVA |
| Ga0307302_101497512 | 3300028814 | Soil | ILALAFTTGPAEVLAYMPAFAWRSGTGMVVWNNLAA |
| Ga0307278_102106702 | 3300028878 | Soil | ELLAWVLVLPFTHGPADVLTYMPAVAWRSGTGMVVWNELAR |
| Ga0310888_106600142 | 3300031538 | Soil | AELLAWVLVLACTRGPADVLAYMPAVAWRSGTGMVVWNEMA |
| Ga0307408_1002646803 | 3300031548 | Rhizosphere | LAWIVVLAFTRGPADVLAYMPAIAWRSGTGMVVWNEVT |
| Ga0318561_102713421 | 3300031679 | Soil | VLVMAFTKGPADVLAYMPAVAWRSGTGMVVWNEFAA |
| Ga0318496_100555234 | 3300031713 | Soil | TAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR |
| Ga0307469_101008511 | 3300031720 | Hardwood Forest Soil | GGTAELNAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVAWNELA |
| Ga0307469_104412651 | 3300031720 | Hardwood Forest Soil | GTAELLAWILVLAFTAGPADVLAYMPAVAWRTGTGMVSWNEFA |
| Ga0307469_108963531 | 3300031720 | Hardwood Forest Soil | LLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPSLIP |
| Ga0318535_100724131 | 3300031764 | Soil | ELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAS |
| Ga0318554_100620641 | 3300031765 | Soil | GGTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNAMAR |
| Ga0318548_100686081 | 3300031793 | Soil | ELIAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA |
| Ga0318536_101517153 | 3300031893 | Soil | WVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA |
| Ga0310900_107915322 | 3300031908 | Soil | ELLAWVLALAFTRGPADVLAYMPAVAWRSGTGMVVWPGLQS |
| Ga0310909_101344271 | 3300031947 | Soil | VLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR |
| Ga0307471_1006008821 | 3300032180 | Hardwood Forest Soil | ELLSLIIAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPTLA |
| Ga0307471_1021714271 | 3300032180 | Hardwood Forest Soil | TAELLAWILVLAFTVGPADVLAYMPAIDWRSGTGMVAWNGLAG |
| Ga0307471_1035844522 | 3300032180 | Hardwood Forest Soil | LAWILVLAFTAGPAEVLAYMPAIAWRSGTGMVAWNHFAS |
| Ga0335085_102582011 | 3300032770 | Soil | GTAELLAWILVLAFTEGPADVLAYMPAIDWRTGTGMVIWNQLAGR |
| Ga0314781_149323_378_503 | 3300034660 | Soil | ELLAWIAVLPFTTGPADVLAYMPAIAWRSGTGMVVWNELAA |
| Ga0364936_134343_388_504 | 3300034773 | Sediment | AWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN |
| ⦗Top⦘ |