


| Basic Information | |
|---|---|
| Family ID | F035252 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLT |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.74 % |
| % of genes near scaffold ends (potentially truncated) | 84.88 % |
| % of genes from short scaffolds (< 2000 bps) | 86.05 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.558 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.116 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.070 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.814 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 28.17% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 4.07 |
| PF02669 | KdpC | 2.33 |
| PF01436 | NHL | 1.74 |
| PF00226 | DnaJ | 1.74 |
| PF09084 | NMT1 | 1.16 |
| PF02371 | Transposase_20 | 1.16 |
| PF07883 | Cupin_2 | 1.16 |
| PF00072 | Response_reg | 0.58 |
| PF04255 | DUF433 | 0.58 |
| PF13662 | Toprim_4 | 0.58 |
| PF13564 | DoxX_2 | 0.58 |
| PF03524 | CagX | 0.58 |
| PF08239 | SH3_3 | 0.58 |
| PF13592 | HTH_33 | 0.58 |
| PF04055 | Radical_SAM | 0.58 |
| PF12695 | Abhydrolase_5 | 0.58 |
| PF07228 | SpoIIE | 0.58 |
| PF05977 | MFS_3 | 0.58 |
| PF13578 | Methyltransf_24 | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF04542 | Sigma70_r2 | 0.58 |
| PF01226 | Form_Nir_trans | 0.58 |
| PF00011 | HSP20 | 0.58 |
| PF00854 | PTR2 | 0.58 |
| PF13302 | Acetyltransf_3 | 0.58 |
| PF07715 | Plug | 0.58 |
| PF02586 | SRAP | 0.58 |
| PF07238 | PilZ | 0.58 |
| PF13518 | HTH_28 | 0.58 |
| PF01740 | STAS | 0.58 |
| PF01909 | NTP_transf_2 | 0.58 |
| PF01807 | zf-CHC2 | 0.58 |
| PF01135 | PCMT | 0.58 |
| PF13229 | Beta_helix | 0.58 |
| PF02517 | Rce1-like | 0.58 |
| PF10012 | DUF2255 | 0.58 |
| PF12704 | MacB_PCD | 0.58 |
| PF04465 | DUF499 | 0.58 |
| PF13676 | TIR_2 | 0.58 |
| PF01391 | Collagen | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF01464 | SLT | 0.58 |
| PF11695 | DUF3291 | 0.58 |
| PF13335 | Mg_chelatase_C | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 4.07 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 4.07 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 2.33 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.16 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.16 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.16 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.58 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.58 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.58 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.58 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.58 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 0.58 |
| COG3504 | Type IV secretory pathway, VirB9 components | Intracellular trafficking, secretion, and vesicular transport [U] | 0.58 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.58 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.14 % |
| Unclassified | root | N/A | 16.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02HYIO8 | Not Available | 506 | Open in IMG/M |
| 3300000559|F14TC_100162230 | Not Available | 3394 | Open in IMG/M |
| 3300000559|F14TC_100720643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10101291 | Not Available | 710 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1018297 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300000956|JGI10216J12902_105254133 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 594 | Open in IMG/M |
| 3300000956|JGI10216J12902_112677326 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300000956|JGI10216J12902_119493987 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300004082|Ga0062384_100094910 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300004091|Ga0062387_101519089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300004139|Ga0058897_11085027 | Not Available | 736 | Open in IMG/M |
| 3300005162|Ga0066814_10063500 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005175|Ga0066673_10783727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005176|Ga0066679_10390255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300005176|Ga0066679_10403388 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005177|Ga0066690_10159854 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005181|Ga0066678_10793564 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005186|Ga0066676_10177381 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300005289|Ga0065704_10426325 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005332|Ga0066388_100287978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2286 | Open in IMG/M |
| 3300005332|Ga0066388_102788806 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005332|Ga0066388_105013318 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005332|Ga0066388_105676383 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005332|Ga0066388_106718769 | Not Available | 579 | Open in IMG/M |
| 3300005353|Ga0070669_101494486 | Not Available | 587 | Open in IMG/M |
| 3300005435|Ga0070714_101044782 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005445|Ga0070708_100245384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1682 | Open in IMG/M |
| 3300005468|Ga0070707_100760127 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005518|Ga0070699_100995195 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005541|Ga0070733_10007361 | All Organisms → cellular organisms → Bacteria | 7126 | Open in IMG/M |
| 3300005557|Ga0066704_10587911 | Not Available | 718 | Open in IMG/M |
| 3300005559|Ga0066700_10502447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300005561|Ga0066699_10197814 | Not Available | 1398 | Open in IMG/M |
| 3300005586|Ga0066691_10774735 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005764|Ga0066903_100361865 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
| 3300005764|Ga0066903_104743383 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005842|Ga0068858_101543427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300006050|Ga0075028_100891949 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006794|Ga0066658_10695566 | Not Available | 561 | Open in IMG/M |
| 3300006800|Ga0066660_11068831 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006845|Ga0075421_100631200 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300006852|Ga0075433_10141112 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300006852|Ga0075433_10500571 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300006871|Ga0075434_101430643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 701 | Open in IMG/M |
| 3300006871|Ga0075434_101987096 | Not Available | 587 | Open in IMG/M |
| 3300006969|Ga0075419_10400256 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300007076|Ga0075435_100134288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 2072 | Open in IMG/M |
| 3300009081|Ga0105098_10298886 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300009089|Ga0099828_10306750 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300009147|Ga0114129_10168074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2992 | Open in IMG/M |
| 3300009147|Ga0114129_10226965 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300009147|Ga0114129_10864577 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300009156|Ga0111538_11978046 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300009156|Ga0111538_13431597 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009524|Ga0116225_1338848 | Not Available | 670 | Open in IMG/M |
| 3300009610|Ga0105340_1358769 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009700|Ga0116217_10351948 | Not Available | 940 | Open in IMG/M |
| 3300009792|Ga0126374_10681396 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009792|Ga0126374_10713766 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009798|Ga0105060_102796 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300009818|Ga0105072_1058498 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010043|Ga0126380_10852477 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300010043|Ga0126380_11950272 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010046|Ga0126384_11062469 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010047|Ga0126382_10130014 | Not Available | 1688 | Open in IMG/M |
| 3300010047|Ga0126382_10585964 | Not Available | 915 | Open in IMG/M |
| 3300010047|Ga0126382_10592403 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300010047|Ga0126382_12288756 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010048|Ga0126373_10031862 | All Organisms → cellular organisms → Bacteria | 4566 | Open in IMG/M |
| 3300010322|Ga0134084_10261365 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010336|Ga0134071_10481576 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010358|Ga0126370_10669144 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010360|Ga0126372_10507735 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010361|Ga0126378_10487369 | Not Available | 1348 | Open in IMG/M |
| 3300010361|Ga0126378_10595281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
| 3300010361|Ga0126378_11398250 | Not Available | 792 | Open in IMG/M |
| 3300010362|Ga0126377_11279147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300010362|Ga0126377_11515543 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010366|Ga0126379_10037958 | All Organisms → cellular organisms → Bacteria | 3845 | Open in IMG/M |
| 3300010366|Ga0126379_10762639 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300010366|Ga0126379_11992742 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010376|Ga0126381_101740674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 900 | Open in IMG/M |
| 3300010376|Ga0126381_101860715 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010398|Ga0126383_11332922 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010399|Ga0134127_10159847 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300010401|Ga0134121_12616731 | Not Available | 548 | Open in IMG/M |
| 3300010403|Ga0134123_12670189 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010931|Ga0137937_1034727 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300011003|Ga0138514_100036144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300011120|Ga0150983_10266818 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300011269|Ga0137392_11266961 | Not Available | 596 | Open in IMG/M |
| 3300012200|Ga0137382_11355351 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012201|Ga0137365_10821124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300012205|Ga0137362_10788301 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300012206|Ga0137380_10130363 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300012210|Ga0137378_10727790 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012494|Ga0157341_1046459 | Not Available | 518 | Open in IMG/M |
| 3300012509|Ga0157334_1019286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300012514|Ga0157330_1013030 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012685|Ga0137397_10388513 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012918|Ga0137396_10864936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300012922|Ga0137394_10175928 | Not Available | 1825 | Open in IMG/M |
| 3300012927|Ga0137416_10382195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300012929|Ga0137404_10618313 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300012929|Ga0137404_12117881 | Not Available | 525 | Open in IMG/M |
| 3300012948|Ga0126375_11821439 | Not Available | 532 | Open in IMG/M |
| 3300012971|Ga0126369_12221083 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012988|Ga0164306_11773350 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300013297|Ga0157378_12992651 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300015053|Ga0137405_1333303 | All Organisms → cellular organisms → Bacteria | 7783 | Open in IMG/M |
| 3300015264|Ga0137403_10046919 | All Organisms → cellular organisms → Bacteria | 4473 | Open in IMG/M |
| 3300015357|Ga0134072_10050760 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300015373|Ga0132257_101569334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300015374|Ga0132255_104279754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300016341|Ga0182035_11551139 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300016341|Ga0182035_11898157 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300016371|Ga0182034_10830913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300016445|Ga0182038_12039209 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018013|Ga0187873_1350531 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300018051|Ga0184620_10067354 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018053|Ga0184626_10017745 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300018057|Ga0187858_10203573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
| 3300018064|Ga0187773_10082766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1547 | Open in IMG/M |
| 3300018072|Ga0184635_10067540 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300020580|Ga0210403_10302817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300021073|Ga0210378_10357863 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300021407|Ga0210383_10388066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1204 | Open in IMG/M |
| 3300021479|Ga0210410_10386609 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300021560|Ga0126371_13739059 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300022756|Ga0222622_11452003 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300024271|Ga0224564_1134503 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300025324|Ga0209640_10196309 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300025910|Ga0207684_11256144 | Not Available | 611 | Open in IMG/M |
| 3300026298|Ga0209236_1165815 | Not Available | 906 | Open in IMG/M |
| 3300026306|Ga0209468_1079434 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300026330|Ga0209473_1230684 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026547|Ga0209156_10057240 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300026551|Ga0209648_10828552 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027527|Ga0209684_1033364 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300027654|Ga0209799_1000251 | All Organisms → cellular organisms → Bacteria | 9744 | Open in IMG/M |
| 3300027654|Ga0209799_1000520 | All Organisms → cellular organisms → Bacteria | 7109 | Open in IMG/M |
| 3300027867|Ga0209167_10008566 | All Organisms → cellular organisms → Bacteria | 4905 | Open in IMG/M |
| 3300027889|Ga0209380_10875653 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027894|Ga0209068_10837058 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027909|Ga0209382_10514804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1316 | Open in IMG/M |
| 3300027956|Ga0209820_1175712 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028906|Ga0308309_11339640 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300030659|Ga0316363_10185646 | Not Available | 874 | Open in IMG/M |
| 3300030973|Ga0075395_11213831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031122|Ga0170822_16004448 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031708|Ga0310686_107005524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300031740|Ga0307468_100570273 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300031754|Ga0307475_10791804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300031910|Ga0306923_10740652 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300031945|Ga0310913_10685018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300031946|Ga0310910_10639287 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300031954|Ga0306926_11405102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300031962|Ga0307479_10112156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2654 | Open in IMG/M |
| 3300031962|Ga0307479_10953539 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300031965|Ga0326597_10016125 | All Organisms → cellular organisms → Bacteria | 9748 | Open in IMG/M |
| 3300032012|Ga0310902_10753629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300032075|Ga0310890_11080788 | Not Available | 649 | Open in IMG/M |
| 3300032076|Ga0306924_11772240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300032076|Ga0306924_12160621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300032180|Ga0307471_103468802 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032515|Ga0348332_10257955 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300032892|Ga0335081_11690916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → Desulfovibrio desulfuricans | 690 | Open in IMG/M |
| 3300033412|Ga0310810_10374976 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300034417|Ga0364941_135257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.16% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.58% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009798 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010931 | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_U1383E_lower_OATZ | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_636250 | 2032320005 | Soil | MTPELEHAVKRYNQWFGSYKKSGXLVKIQVWLTVNNGSIEFLTLDDSYKVKRIRRNPRV |
| GPINP_00520290 | 2065487018 | Soil | MTPELERAVKRYRQWFGSYKKSVELVKVQVWLTINNGQIEFLTSEDSYKVK |
| F14TC_1001622304 | 3300000559 | Soil | MTPELERAVKRYRQWFGTYKKSGELVKIQVWLTVNNGSIEFLTPLKG* |
| F14TC_1007206431 | 3300000559 | Soil | MTPDLQRAVKRYNQWFGSYKKSGELIKVQVWLTVNNGCIEFLT |
| AF_2010_repII_A1DRAFT_101012911 | 3300000597 | Forest Soil | MTPELERAVKRYKQWFGSYRKSGELVKVKVWLTVNNGC |
| KanNP_Total_F14TBDRAFT_10182972 | 3300000709 | Soil | MTPELECAVKRYRQWFGSYKKSGELIEVQVWLTVNSGCIEFLTLDDSYKVKRIRRN |
| JGI10216J12902_1052541331 | 3300000956 | Soil | MTPDLQRAVKRYNQWFGSYKKSGELIKVQVWLTVNNGCIEFLTSDDSYKVK |
| JGI10216J12902_1126773261 | 3300000956 | Soil | MTPELERAVKRYRQWFGSYRKSGELIKVQVWLTVNNGCIEFLTSDDSYKVK |
| JGI10216J12902_1194939871 | 3300000956 | Soil | MTPELERAAKRYKQWFGSYKKSGELVKVQVWLTVNNG |
| Ga0062384_1000949103 | 3300004082 | Bog Forest Soil | MTPELQLALKRHTQWFGSYKASGELKKIQVWLVVKAGQIEFLTPGSSYK |
| Ga0062387_1015190891 | 3300004091 | Bog Forest Soil | MTPELQRALKRHQQWFASYKASGELKKIQVWLVVNGGQIEFLTPGS |
| Ga0058897_110850271 | 3300004139 | Forest Soil | MTPELQRALKPHTQWFGSYKASGELKKIQVWLIVNGGQIEFLTPGNSYKV |
| Ga0066814_100635001 | 3300005162 | Soil | MTPELEHAVKRYTQWFGSYKKSGELVKIQVWLTVNNGAIEFLTLDDSYKVKRI |
| Ga0066673_107837272 | 3300005175 | Soil | MTPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLTPGN |
| Ga0066679_103902552 | 3300005176 | Soil | MNPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLT |
| Ga0066679_104033882 | 3300005176 | Soil | MTPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLTPGNSYKVKRARKNPR |
| Ga0066690_101598541 | 3300005177 | Soil | MTPELQSALRRHMQWFGSYKKSGELAKVQVWLIINNGRT* |
| Ga0066678_107935642 | 3300005181 | Soil | MTPELDRGVKRYKQWFGSYKKSGELVKVQIWLTVNNGCIEFLT |
| Ga0066676_101773813 | 3300005186 | Soil | MTPELEGAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLT |
| Ga0065704_104263251 | 3300005289 | Switchgrass Rhizosphere | VFKMTPELERAVKRYRQWFGTYKKSGELVKIQVWLTVNNGS |
| Ga0066388_1002879786 | 3300005332 | Tropical Forest Soil | MTPELERAVKRYRQWFGSYKKSGELVKVQVWLTVNNGCIEFLTLDEFVQS* |
| Ga0066388_1027888062 | 3300005332 | Tropical Forest Soil | MIPELERALKSHNQWFGSYKRSGELVKVQVWLTVNNGDIEFLTRTK* |
| Ga0066388_1050133181 | 3300005332 | Tropical Forest Soil | MTPELERAVKRYKQWFGSYRKSGELVKVKVWLTVNNGCIEFLTLDDSYKV* |
| Ga0066388_1056763831 | 3300005332 | Tropical Forest Soil | MTPKLGRAVKRYSQWFGSYKKSGELVKTQVWLTVNNGCIEFLTLDDSYKVKRIR |
| Ga0066388_1067187691 | 3300005332 | Tropical Forest Soil | MFKMTPELDSAVKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFL |
| Ga0070669_1014944861 | 3300005353 | Switchgrass Rhizosphere | MTPELERAVERYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLDD |
| Ga0070714_1010447822 | 3300005435 | Agricultural Soil | MTPELQSALKRHMQWFGSYKKSGELVKVQVWLIVSKGRVEFLTNK |
| Ga0070708_1002453841 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKLERAVKRYKQWFGSYKKSGELIKVQVWLTVSDGCIEFLTLD |
| Ga0070707_1007601271 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPELERAVKRYKQWFGSYKKSGELIKVQVWLTVSDGCIEFLTLDDSNKVKRIRKN |
| Ga0070699_1009951951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPDLQRTVKRYKQWFGSYKKSGELIKVQVWLTVNNGCIEFLTADDSYKVKRIRSN |
| Ga0070733_100073613 | 3300005541 | Surface Soil | MTPELQLALKRHTQWFGSYKKSGELKKIQVWLVVKSGQIEFLTPDSSFK* |
| Ga0066704_105879111 | 3300005557 | Soil | MTPELELAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTPDDS |
| Ga0066700_105024471 | 3300005559 | Soil | MTPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLTPGNSY |
| Ga0066699_101978141 | 3300005561 | Soil | MTPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLTPGNSYKVKRA |
| Ga0066691_107747351 | 3300005586 | Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLD |
| Ga0066903_1003618652 | 3300005764 | Tropical Forest Soil | MIPELESVLKNHNQWFGSYKRSGELVKVQVWLTVNNGDIEFLTRTK* |
| Ga0066903_1047433832 | 3300005764 | Tropical Forest Soil | MTPELQSALKRHIQWFGSYKKSGELVKVQVWLIVSKGRVEFLTNKNSYKVRRLSRNP |
| Ga0068858_1015434272 | 3300005842 | Switchgrass Rhizosphere | MTPELERAVKRYRQWFGSYKKSVELVKVQVWLTINNG |
| Ga0075028_1008919492 | 3300006050 | Watersheds | MTPELQSALKRHMQWFGSYKKSGELAKVQVWLIVHQGQIEFLTGKDSYKVRR |
| Ga0066658_106955662 | 3300006794 | Soil | MTPKLERAVKRYRQWFGSCKKSAELVKVQVWLTINNGQIEFLTSEDSYKVKRV |
| Ga0066660_110688312 | 3300006800 | Soil | MTPELQSALRRHMQWFGSYKKSGEVAKVQVWLIINKGRT* |
| Ga0075421_1006312002 | 3300006845 | Populus Rhizosphere | MTPELERAVKRYRQWFGSYKKSGELIKVQVWVAVNNGCIEFLTVNFKLT* |
| Ga0075433_101411124 | 3300006852 | Populus Rhizosphere | MTPELKRAVKRYRQWFGAYKKSGELIKVQVWLTINNGCIEFLTLDDS |
| Ga0075433_105005713 | 3300006852 | Populus Rhizosphere | MTPELERAVKRYKQWFGSYRKSGELIKVQVWLTVNNG |
| Ga0075434_1014306432 | 3300006871 | Populus Rhizosphere | MTPELESEIKRHTQLFGSYTKSGELKKVRVWLTLNEGKIEFLTS |
| Ga0075434_1019870961 | 3300006871 | Populus Rhizosphere | MTPELERAVERYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLDDSYKV |
| Ga0075419_104002563 | 3300006969 | Populus Rhizosphere | MTPELKRAVKRYRQWFGAYKKSGELIKVQVWLTINNGCIEFLTLDDSYKVKRIRRD |
| Ga0075435_1001342881 | 3300007076 | Populus Rhizosphere | MTPELKAALKRHTQLFGSYTKAGELKKIRVWLTLNNGKIEFLTL |
| Ga0105098_102988861 | 3300009081 | Freshwater Sediment | MTPELERAVKRYRQWFGSYQKSGELIKVQVWLIVNNGCIEFLTPDDSYKVKRI |
| Ga0099828_103067505 | 3300009089 | Vadose Zone Soil | MTPELQRALKRHTQWFGSYKASGELKKIQVWLIVNGGQIE |
| Ga0114129_101680744 | 3300009147 | Populus Rhizosphere | MTPELERAVKRYRQWFGSYKKSGELIKVQGRFRVV* |
| Ga0114129_102269651 | 3300009147 | Populus Rhizosphere | MTPDLQRAVKRYNQWFGSYKKSGELIKVQVWLTVNNGCIEFLTADDSYKVKRIRRN |
| Ga0114129_108645771 | 3300009147 | Populus Rhizosphere | MTGELERAVKRYNQWFGSHKRSGELVKVQVWLTVNNGCIEFLT |
| Ga0111538_119780462 | 3300009156 | Populus Rhizosphere | MTPELERAVERYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLDDS |
| Ga0111538_134315972 | 3300009156 | Populus Rhizosphere | MTPELKRAVKRYRQWFGSYKNSGELIKVQVWLTVNNGCIEFLKLANRFSFAST |
| Ga0116225_13388482 | 3300009524 | Peatlands Soil | MNLKPELERAVRRHRQWFGSYKKSGEMNKTQVWLTVKDGCIEFLTPNDSYKAK |
| Ga0105340_13587691 | 3300009610 | Soil | MTPELERGVKRYRQWFGSYKKSGELIKVQVWLTVNNG |
| Ga0116217_103519481 | 3300009700 | Peatlands Soil | MNLKPELERAVRRHRQWFGSYKKSGEMNKTQVWLTVKDGCIE |
| Ga0126374_106813962 | 3300009792 | Tropical Forest Soil | MTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLTL |
| Ga0126374_107137661 | 3300009792 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLT |
| Ga0105060_1027961 | 3300009798 | Groundwater Sand | MTPELERAVKRYKQWFGSYKKSGELIKVQVWLTVNDGCIEFLTLDDSFECVYSA* |
| Ga0105072_10584982 | 3300009818 | Groundwater Sand | MTPDLERAVKRYKQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSFECVYSA* |
| Ga0105085_10308842 | 3300009820 | Groundwater Sand | MTPELERAVKRYRQWFGSDKKSGELIKVQVWLTVNNGCIEFLTLDDSYKVKRIRRDPR |
| Ga0126380_108524771 | 3300010043 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLTLADSYK |
| Ga0126380_119502722 | 3300010043 | Tropical Forest Soil | MFKMTPELERAVKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLTLADS |
| Ga0126384_110624691 | 3300010046 | Tropical Forest Soil | MFTMIPELERATKRYIQWFGSYKKSGELIKVQVWLSVNNGYIEFLTLADSYKVKRIRRDP |
| Ga0126382_101300141 | 3300010047 | Tropical Forest Soil | MTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEF |
| Ga0126382_105859641 | 3300010047 | Tropical Forest Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLSVNNG |
| Ga0126382_105924032 | 3300010047 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLTL |
| Ga0126382_122887561 | 3300010047 | Tropical Forest Soil | MTPELERAVKRCKQWFGSYKKSGELIKPQVWLTVNNGCIEFLTLD |
| Ga0126373_100318624 | 3300010048 | Tropical Forest Soil | LTEESCTGINIAMTPELQSALKRHMQWFGSYRSSGDLVKVQVWLIVNKGRIEFLTGKDSY |
| Ga0134084_102613651 | 3300010322 | Grasslands Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTPDDSYKVKR |
| Ga0134071_104815761 | 3300010336 | Grasslands Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGRIEFLTA |
| Ga0126370_106691442 | 3300010358 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFL |
| Ga0126372_105077352 | 3300010360 | Tropical Forest Soil | MTPELQRALKRHMQWFGSYKKSGELVKVQVWLIVSKGQIEFLTGKNSYKVR |
| Ga0126378_104873691 | 3300010361 | Tropical Forest Soil | SALKRHMQWFGSYKKSGELVKVQVWLIVSKGRVEFLTNKNSYKVRRLLINS* |
| Ga0126378_105952813 | 3300010361 | Tropical Forest Soil | MTPELQRALRKHTQWFGSYKASGELKKLQVWLVVAD |
| Ga0126378_113982501 | 3300010361 | Tropical Forest Soil | MTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYI |
| Ga0126377_112791471 | 3300010362 | Tropical Forest Soil | MTPELQNALKNHVQWFGSYKKSGELVKVQVWLIVNTGRIEFLTSKD |
| Ga0126377_115155431 | 3300010362 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNNGYIEFLTLADS |
| Ga0126379_100379585 | 3300010366 | Tropical Forest Soil | MTPEMERAVKRHKQWFGSYKKSGDIVKVQVWLTVNNGCIEFLTLDDSYKVKRV |
| Ga0126379_107626391 | 3300010366 | Tropical Forest Soil | MTLELERAVKRYRQWFGSYKKSGELVKVQVWLTVNNGCIEFLTLDEFVQS* |
| Ga0126379_119927422 | 3300010366 | Tropical Forest Soil | MTPELERGVKRHKQWFGSYRKSGELVKVQVWLTVNSGYIEFLTLDDSYKVKRIRRD |
| Ga0126381_1017406741 | 3300010376 | Tropical Forest Soil | MIPELERALKSDNQWLGSYKKSGELIKVRVWLTVNNGDIEFSDTR* |
| Ga0126381_1018607152 | 3300010376 | Tropical Forest Soil | MTPELQRALKRHVQWFGSYKKSCALVKVQVWLIVN |
| Ga0126383_113329221 | 3300010398 | Tropical Forest Soil | MTPELKRALNKHVQWFGSYKKSGELAKVQVWLVVNSGRIEF |
| Ga0134127_101598473 | 3300010399 | Terrestrial Soil | MMPELERAVKAHNQWFGSYKKSGALVKIQVWLTINNGCIEFLTSENSL |
| Ga0134121_126167311 | 3300010401 | Terrestrial Soil | MTPELERAVKRYRQWFGSYKKSVELVQVQVWLTINNGQIEFLTSEDSYKVKRVR |
| Ga0134123_126701891 | 3300010403 | Terrestrial Soil | MMPELERAVKAHNQWFGSYKKSGALVKIQVWFTINNG |
| Ga0137937_10347272 | 3300010931 | Marine Sediment | VTAELERAVRRYKQWFGSYKKSGELKKIQVWLVVNKGRIEFTTQTDSYKVKRVRRNP |
| Ga0138514_1000361443 | 3300011003 | Soil | MTPELERAVKRYRQWFGSYKRSGELVKVQVWLTVNNGHIEFLSSEDSYKVKRI |
| Ga0150983_102668181 | 3300011120 | Forest Soil | MTPELQNALSRHTQWFGSYKKSGELKKIHVWLSVHQ |
| Ga0137392_112669611 | 3300011269 | Vadose Zone Soil | MTPKLERAVKRYRQWFGSCKKSAELVKVQVWLTINNGQIEFLTSEDSYKVKRVRAN |
| Ga0137392_112993491 | 3300011269 | Vadose Zone Soil | MTPELERALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEFLTPGSSYKVKRARKNPRVM |
| Ga0137382_113553512 | 3300012200 | Vadose Zone Soil | MTPELQRALKRHTQWFGSFKASGELKKIQVWLIVNGGQIEFLTPGNSYKVKRA |
| Ga0137365_108211241 | 3300012201 | Vadose Zone Soil | MTPKLERAVKRYRQWFGSCKKSAELVKVQVWLTINNGQIEFLTSEDSYKVKRVRANP |
| Ga0137362_107883012 | 3300012205 | Vadose Zone Soil | MTLELQRALKRHTQWFGSYKASGELKKIQVWLVVNGGQIEF |
| Ga0137380_101303631 | 3300012206 | Vadose Zone Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLT |
| Ga0137378_107277903 | 3300012210 | Vadose Zone Soil | MTPELERAVKRYRQWFGSYKRSDELVKVQVWLTVNNGCIEFLSSRIRTKLSVYA |
| Ga0157341_10464591 | 3300012494 | Arabidopsis Rhizosphere | MTPELERAVKCYRQWFGSYKKSVELVKVQVRLTINNGLIEFLTSEDSYKVK |
| Ga0157334_10192861 | 3300012509 | Soil | MTPELERAVKRYRQWFGSYKKSVELVKVQVWLTVNNGQI |
| Ga0157330_10130303 | 3300012514 | Soil | MTPELKRAIKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLDGFVQS* |
| Ga0137397_103885133 | 3300012685 | Vadose Zone Soil | MTPELERAVKRYRQWFGSYKKSGELLKVQVWLTVNNGC |
| Ga0137396_108649361 | 3300012918 | Vadose Zone Soil | MTPELERAVKRYRQWFGSYRKSVELVKVQVWLTINNGQIEFLTSEDSYKV |
| Ga0137394_101759283 | 3300012922 | Vadose Zone Soil | MTPELERAVKRYHLWFGSYKKSGELVKIQVWLTVNNGSIEFLTLDDS |
| Ga0137416_103821953 | 3300012927 | Vadose Zone Soil | MTPELEGAVKRYRQWFGSYKKSGELVQVQVWLTVNNGQIEFL |
| Ga0137404_106183132 | 3300012929 | Vadose Zone Soil | MTPELERAVERYTQWFGSYKKSGELIKVQVWLTINNGCIEFLSLDDSYKVKRIRR |
| Ga0137404_121178811 | 3300012929 | Vadose Zone Soil | MTPDLQRAVKRYKQWFGSYKKSGELIKVQVWLTVNNGCIEF |
| Ga0126375_118214391 | 3300012948 | Tropical Forest Soil | MTPELQHALESHRLWFGSYRKSGELVKIQVWFTVNDGCIEFLTGQDTYKVK |
| Ga0126369_122210831 | 3300012971 | Tropical Forest Soil | MTPEMERAVKRHKQWFGSYKKSGDIVKVQVWLTVNNGCIEFLTLDD |
| Ga0164306_117733501 | 3300012988 | Soil | MMPELERAVKAHNQWFGSYKKSGALVKIQVWLTINNGCIEFLTSEDSLKVKRVRTNPR |
| Ga0157378_129926511 | 3300013297 | Miscanthus Rhizosphere | MTLELHCALKRHTQWLGSYKASGELKKIQVWLILNGGRIECFTPGSSYK |
| Ga0137405_13333032 | 3300015053 | Vadose Zone Soil | MTPELERAVKRYTQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSYKV* |
| Ga0137403_100469191 | 3300015264 | Vadose Zone Soil | MTPELERAIERYRQWFGSYKKSGELIKVQVWLTINNGCIEFLSLDDSYKVKRIRR |
| Ga0134072_100507601 | 3300015357 | Grasslands Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFL |
| Ga0132257_1015693341 | 3300015373 | Arabidopsis Rhizosphere | MSPELERAVKCYRQWFGSYKKSVELVKVQVWLTINNGQIEFLTSEDSYKVK |
| Ga0132255_1042797541 | 3300015374 | Arabidopsis Rhizosphere | MSPELERAVKCYRQWFGSYKKSVELVKVQVRLTINNGQIEFLTSEDSYKVKRV |
| Ga0182035_115511391 | 3300016341 | Soil | MTPELQSALKRHMQWFGSYRKTGELVKVQVWLIVNEGRIEFLTG |
| Ga0182035_118981571 | 3300016341 | Soil | MTPELQSALNRHMQWFGSYKKSGELVKVQVWLIISKGRIEFLTNKNSYKVRRLSRNSK |
| Ga0182034_108309131 | 3300016371 | Soil | MTPELERALKRYRQWFGSYKKSGELIKVQVWLTVNNG |
| Ga0182038_120392091 | 3300016445 | Soil | MTPELERALKRHTQWFGSYKRSGELVKVQVWLIVNKGRIEFL |
| Ga0187873_13505311 | 3300018013 | Peatland | MTPELQRALKRHTQWFGSYKASGELKKLQVWLVVNGGKIEFLTP |
| Ga0184620_100673541 | 3300018051 | Groundwater Sediment | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSYKVSAYGGTRA |
| Ga0184626_100177453 | 3300018053 | Groundwater Sediment | MTPELARAVKRCNQWFGSYKKSGELIKVQVWLTVNNAASNF |
| Ga0187858_102035732 | 3300018057 | Peatland | MTPELQRALKRHTQWFGSYKASGELKKLQVWLVVN |
| Ga0187773_100827663 | 3300018064 | Tropical Peatland | MTPELQSALKRHMQWFGSYKKSGELVKVQVWLIVSQGRIEFLTNK |
| Ga0184635_100675401 | 3300018072 | Groundwater Sediment | MTPELERAVKRYRQWLGSYKKSGELIKVQVWLTVNNGCIEF |
| Ga0210403_103028171 | 3300020580 | Soil | MTPELQRALKPHTQWFGSYKASGELKKVQVWLIVNGGQIEFLTPGNSYKVKRARRN |
| Ga0210378_103578631 | 3300021073 | Groundwater Sediment | MTRELQCAVKRYKQWFGSYKKSGDLIKLQVWLTVNNGCIEFLTSDDSYKVK |
| Ga0210383_103880661 | 3300021407 | Soil | MTPELQNALSRHTQWFGSYKKSGELKKIHVWLSVHQGQIEFLTP |
| Ga0210410_103866093 | 3300021479 | Soil | MTPELQHALQRHTQWFGSYKKSGELKKIRVWLTVHQGQIEF |
| Ga0126371_137390591 | 3300021560 | Tropical Forest Soil | MTPELQSALKRHMQWFGSYKKSGELVKVQVWLIVN |
| Ga0222622_114520031 | 3300022756 | Groundwater Sediment | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSYKVS |
| Ga0224564_11345032 | 3300024271 | Soil | MAPELQLALKRHTQWFGSYKASGELKKIQVWLVVKGGQIEFLTPGSSYK |
| Ga0209640_101963092 | 3300025324 | Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWVAVNNGCIEFLTLNFKLT |
| Ga0207684_112561441 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTQQIREAIRTHDQWFGSYKRSGELVKVQVWLTVNRGDI |
| Ga0209236_11658152 | 3300026298 | Grasslands Soil | MTPELQRALKRHTQWFGSFKASGELKKIQVWLIVNGGQIEFLTPGN |
| Ga0209468_10794342 | 3300026306 | Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTPDDSYK |
| Ga0209473_12306841 | 3300026330 | Soil | MNPELERALKRHTQWFGSYKASGELKKIQVWLLVNDGRIEFLTPGNSYKVKRARK |
| Ga0209156_100572401 | 3300026547 | Soil | MTPELERAVKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTPDDSYKVK |
| Ga0209648_108285521 | 3300026551 | Grasslands Soil | MTPELEGALKRHTQWFGSYKASGELKKIQVWLVVNGGQI |
| Ga0209684_10333641 | 3300027527 | Tropical Forest Soil | MTPELERAVKRYRQWFGSYKKSGELVKVQVWLTVNNGCIEFLTLDEFVQS |
| Ga0209799_100025113 | 3300027654 | Tropical Forest Soil | MFTMTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNN |
| Ga0209799_10005201 | 3300027654 | Tropical Forest Soil | MTPELERAIKRYRQWFGSYKKSGELIKVQVWLSVNN |
| Ga0209167_100085663 | 3300027867 | Surface Soil | MTPELQLALKRHTQWFGSYKKSGELKKIQVWLVVKSGQIEFLTPDSSFK |
| Ga0209380_108756531 | 3300027889 | Soil | VTPELQRALERHTQWFGSYKASGELKKIEVWLLVNGGQI |
| Ga0209068_108370581 | 3300027894 | Watersheds | MTPELQRALKRHTQWFGSHKVSGELKKIQVWLIVNGGQIEFLTPGNSYKVK |
| Ga0209382_105148042 | 3300027909 | Populus Rhizosphere | MTPELERAVKRYRQWFGSYKKSGELIKVQVWVAVNNGCIEFLTVNFKLT |
| Ga0209820_11757121 | 3300027956 | Freshwater Sediment | MTPELEHAVKRYTQWFGSYKKSGELVKVQVWLTVNNGSI |
| Ga0308309_113396403 | 3300028906 | Soil | MTPELQHALRRHTQWFGSYKTSGELKKVQVWLLVNGGQIEFLTPGNSYKVRRA |
| Ga0316363_101856462 | 3300030659 | Peatlands Soil | MNLKPELERAVRRHRQWFGSYKKSGEMNKTQVWLTVKDGCI |
| Ga0075395_112138311 | 3300030973 | Soil | MTPELERGLKTHTQWFGSYKASGELKKIQVWLVVNNGQIEFLT |
| Ga0170822_160044482 | 3300031122 | Forest Soil | MTPELQRALKRHTQWFGSYKASGELKKIPVWLIVNAGQIEFLTPGNSY |
| Ga0310686_1070055241 | 3300031708 | Soil | MTPELQRALKRHTQWFGSYKASGELKKIQVWLIVN |
| Ga0307468_1005702732 | 3300031740 | Hardwood Forest Soil | MTPELEHAVKRYNQWFGSYKKSGELVKIPVWLTVNN |
| Ga0307475_107918041 | 3300031754 | Hardwood Forest Soil | MTAELRGALRRHTQWFGSYKASGELKKIHVWLLVNSGQIEFLTPGDSYKVK |
| Ga0306923_107406522 | 3300031910 | Soil | MTPELERAVKAHNQWFGSYKKSSELVKIQVWLTVNN |
| Ga0310913_106850181 | 3300031945 | Soil | MNAELQRALKRHTQWFGSYKASGELKKLQVWLVVNDGQI |
| Ga0310910_106392872 | 3300031946 | Soil | MIPELEPALKTHNQWFGSYKRSGELVKVRVWLTVNNGDIE |
| Ga0306926_114051022 | 3300031954 | Soil | MTPELERALKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSYKVKRIRRD |
| Ga0307479_101121564 | 3300031962 | Hardwood Forest Soil | MTPELQRALKRHTQWFGSYKASGELKKIQVWLIVNDGQIEFLTPGNSY |
| Ga0307479_109535392 | 3300031962 | Hardwood Forest Soil | MTPELQRALRRHTQWFGSYKASGELKKIHVWLLVNGGQIEFLTPGNSYKVRR |
| Ga0326597_100161257 | 3300031965 | Soil | MTPELERAVKRYRQWFGSYQKSGELKKVQVWVAVNNGCIEFLTVNFNLT |
| Ga0310902_107536291 | 3300032012 | Soil | MTPELERAVKRYRQWFGSYKKSVELVKVQVWLTINNGQIEFLT |
| Ga0310890_110807882 | 3300032075 | Soil | MTPELERAVERYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLSLDDSYKVK |
| Ga0306924_117722401 | 3300032076 | Soil | MNAELQRALKRHTQWFGSYKASGELKKLQVWLVVNDGQIEFLTR |
| Ga0306924_121606212 | 3300032076 | Soil | MTPELERALKRYRQWFGSYKKSGELIKVQVWLTVNNGCIEFLTLDDSY |
| Ga0307471_1034688021 | 3300032180 | Hardwood Forest Soil | MENIAKLSPQLEKAVRRHRQWFGSYKASGELKRIQVWLTLKEGCIEF |
| Ga0348332_102579552 | 3300032515 | Plant Litter | MTPELQRALKRHTQWFGSYKASGELKKIQVWLVVNAGQIEFLTPGSSYKVRRVR |
| Ga0335081_116909162 | 3300032892 | Soil | MTEEIKSALKRYNQWVGTYKKSGELKLIQVWLTLSNGAIEFLTGGDSYKVKRLK |
| Ga0310810_103749761 | 3300033412 | Soil | MIPELERALKSHNQWFGSYKRSGELVKVQVWLTVNNGDSEFLTLDNSYKVK |
| Ga0364941_135257_2_133 | 3300034417 | Sediment | MTQLERAVKRYRQWFGSYKKSVELVKVQVWLTINNGQIEFLTSE |
| ⦗Top⦘ |