


| Basic Information | |
|---|---|
| Family ID | F035233 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSASSSR |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.19 % |
| % of genes near scaffold ends (potentially truncated) | 16.28 % |
| % of genes from short scaffolds (< 2000 bps) | 69.77 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.535 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.674 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.581 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.163 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF06414 | Zeta_toxin | 7.60 |
| PF13561 | adh_short_C2 | 6.43 |
| PF13671 | AAA_33 | 4.09 |
| PF09720 | Unstab_antitox | 2.34 |
| PF00202 | Aminotran_3 | 2.34 |
| PF01964 | ThiC_Rad_SAM | 1.75 |
| PF08281 | Sigma70_r4_2 | 1.75 |
| PF11645 | PDDEXK_5 | 1.75 |
| PF03544 | TonB_C | 1.75 |
| PF05697 | Trigger_N | 1.75 |
| PF07521 | RMMBL | 1.75 |
| PF02667 | SCFA_trans | 1.75 |
| PF00291 | PALP | 1.75 |
| PF00106 | adh_short | 1.17 |
| PF01980 | TrmO | 1.17 |
| PF13744 | HTH_37 | 1.17 |
| PF09848 | DUF2075 | 1.17 |
| PF02452 | PemK_toxin | 1.17 |
| PF00593 | TonB_dep_Rec | 1.17 |
| PF14329 | DUF4386 | 1.17 |
| PF01797 | Y1_Tnp | 1.17 |
| PF12867 | DinB_2 | 1.17 |
| PF05402 | PqqD | 0.58 |
| PF11008 | DUF2846 | 0.58 |
| PF01121 | CoaE | 0.58 |
| PF05593 | RHS_repeat | 0.58 |
| PF00491 | Arginase | 0.58 |
| PF13525 | YfiO | 0.58 |
| PF03054 | tRNA_Me_trans | 0.58 |
| PF01435 | Peptidase_M48 | 0.58 |
| PF14559 | TPR_19 | 0.58 |
| PF08450 | SGL | 0.58 |
| PF02195 | ParBc | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF14300 | DUF4375 | 0.58 |
| PF02803 | Thiolase_C | 0.58 |
| PF01833 | TIG | 0.58 |
| PF13175 | AAA_15 | 0.58 |
| PF14534 | DUF4440 | 0.58 |
| PF05036 | SPOR | 0.58 |
| PF13683 | rve_3 | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF02684 | LpxB | 0.58 |
| PF12697 | Abhydrolase_6 | 0.58 |
| PF08240 | ADH_N | 0.58 |
| PF05973 | Gp49 | 0.58 |
| PF05063 | MT-A70 | 0.58 |
| PF02769 | AIRS_C | 0.58 |
| PF01425 | Amidase | 0.58 |
| PF13365 | Trypsin_2 | 0.58 |
| PF00814 | TsaD | 0.58 |
| PF00312 | Ribosomal_S15 | 0.58 |
| PF04892 | VanZ | 0.58 |
| PF02604 | PhdYeFM_antitox | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.34 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 1.75 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 1.75 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.75 |
| COG2031 | Short chain fatty acids transporter | Lipid transport and metabolism [I] | 1.75 |
| COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 1.75 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.17 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.17 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.17 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.17 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.58 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.58 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.58 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.58 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.58 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.58 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.58 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.53 % |
| Unclassified | root | N/A | 10.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10032591 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300000567|JGI12270J11330_10052922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2157 | Open in IMG/M |
| 3300001137|JGI12637J13337_1007651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300001593|JGI12635J15846_10692337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101436034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300002558|JGI25385J37094_10116256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300002907|JGI25613J43889_10131677 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300003324|soilH2_10323187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300003324|soilH2_10399644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300004092|Ga0062389_100158103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2150 | Open in IMG/M |
| 3300005166|Ga0066674_10132067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1172 | Open in IMG/M |
| 3300005167|Ga0066672_10007930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4902 | Open in IMG/M |
| 3300005445|Ga0070708_100006487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9310 | Open in IMG/M |
| 3300005445|Ga0070708_100743206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300005451|Ga0066681_10535680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 723 | Open in IMG/M |
| 3300005468|Ga0070707_100720429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300005534|Ga0070735_10282666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300005537|Ga0070730_10401046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300005542|Ga0070732_10364209 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005554|Ga0066661_10144258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1453 | Open in IMG/M |
| 3300005554|Ga0066661_10355458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 897 | Open in IMG/M |
| 3300005556|Ga0066707_10071267 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300005556|Ga0066707_10917544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300005712|Ga0070764_10133364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1353 | Open in IMG/M |
| 3300005712|Ga0070764_10886441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300005895|Ga0075277_1050651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300005993|Ga0080027_10014439 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300005995|Ga0066790_10053574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300005995|Ga0066790_10209080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300006028|Ga0070717_10001847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14775 | Open in IMG/M |
| 3300006028|Ga0070717_10065654 | Not Available | 3017 | Open in IMG/M |
| 3300006028|Ga0070717_10745827 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300006052|Ga0075029_100710870 | Not Available | 678 | Open in IMG/M |
| 3300006059|Ga0075017_100241167 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300006797|Ga0066659_10108370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1904 | Open in IMG/M |
| 3300006854|Ga0075425_101270844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 835 | Open in IMG/M |
| 3300006893|Ga0073928_10112671 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300006893|Ga0073928_10192528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1604 | Open in IMG/M |
| 3300007255|Ga0099791_10325236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300009038|Ga0099829_10656216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300009088|Ga0099830_10122058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1973 | Open in IMG/M |
| 3300009090|Ga0099827_10004015 | All Organisms → cellular organisms → Bacteria | 8549 | Open in IMG/M |
| 3300009090|Ga0099827_11063154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300009143|Ga0099792_10345046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300009523|Ga0116221_1488904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009638|Ga0116113_1034851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300009644|Ga0116121_1115382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300009698|Ga0116216_10701648 | Not Available | 608 | Open in IMG/M |
| 3300009700|Ga0116217_10521477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300009760|Ga0116131_1020007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2443 | Open in IMG/M |
| 3300009824|Ga0116219_10276678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300009839|Ga0116223_10366849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 851 | Open in IMG/M |
| 3300010371|Ga0134125_10113713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3012 | Open in IMG/M |
| 3300010379|Ga0136449_100050108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9412 | Open in IMG/M |
| 3300010379|Ga0136449_100236351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3414 | Open in IMG/M |
| 3300010379|Ga0136449_100549756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1986 | Open in IMG/M |
| 3300010379|Ga0136449_100668335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300010379|Ga0136449_100926061 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300010379|Ga0136449_103615632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300011270|Ga0137391_11032159 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300011271|Ga0137393_10095839 | Not Available | 2413 | Open in IMG/M |
| 3300011271|Ga0137393_11143259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300012096|Ga0137389_11506615 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012189|Ga0137388_10541804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1082 | Open in IMG/M |
| 3300012199|Ga0137383_10602190 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012201|Ga0137365_10073120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2586 | Open in IMG/M |
| 3300012209|Ga0137379_11692664 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012210|Ga0137378_11419580 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012211|Ga0137377_11751151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300012356|Ga0137371_11065045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300012359|Ga0137385_11412904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300012361|Ga0137360_11343225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012683|Ga0137398_10251583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300012685|Ga0137397_10863876 | Not Available | 671 | Open in IMG/M |
| 3300012925|Ga0137419_10213503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1435 | Open in IMG/M |
| 3300012925|Ga0137419_10822712 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012929|Ga0137404_10143999 | Not Available | 1975 | Open in IMG/M |
| 3300012929|Ga0137404_10316868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1357 | Open in IMG/M |
| 3300012929|Ga0137404_10772723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300012929|Ga0137404_11079305 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012944|Ga0137410_10068986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2559 | Open in IMG/M |
| 3300012944|Ga0137410_10536339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 960 | Open in IMG/M |
| 3300015241|Ga0137418_10173452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1883 | Open in IMG/M |
| 3300015241|Ga0137418_10450963 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300015242|Ga0137412_10975257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300015264|Ga0137403_10677160 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300017823|Ga0187818_10390844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300017948|Ga0187847_10383770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300018006|Ga0187804_10208144 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300018042|Ga0187871_10021450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4166 | Open in IMG/M |
| 3300018046|Ga0187851_10073644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2166 | Open in IMG/M |
| 3300018433|Ga0066667_10073551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2172 | Open in IMG/M |
| 3300018433|Ga0066667_10097510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1946 | Open in IMG/M |
| 3300018433|Ga0066667_11145637 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300018468|Ga0066662_10105365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2011 | Open in IMG/M |
| 3300018468|Ga0066662_10172105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1671 | Open in IMG/M |
| 3300020006|Ga0193735_1157599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300020018|Ga0193721_1049289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300020579|Ga0210407_10406809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300020580|Ga0210403_10086775 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300020580|Ga0210403_10548349 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300020581|Ga0210399_10152181 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300020582|Ga0210395_10105656 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300021170|Ga0210400_10486993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300021171|Ga0210405_10242517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300021178|Ga0210408_10027148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4540 | Open in IMG/M |
| 3300021180|Ga0210396_10029234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5099 | Open in IMG/M |
| 3300021401|Ga0210393_11479862 | Not Available | 541 | Open in IMG/M |
| 3300021407|Ga0210383_10002587 | All Organisms → cellular organisms → Bacteria | 16325 | Open in IMG/M |
| 3300021420|Ga0210394_10000201 | All Organisms → cellular organisms → Bacteria | 143732 | Open in IMG/M |
| 3300021420|Ga0210394_10279579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300021479|Ga0210410_10000046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 207129 | Open in IMG/M |
| 3300021479|Ga0210410_10030577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4667 | Open in IMG/M |
| 3300021479|Ga0210410_10030577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4667 | Open in IMG/M |
| 3300022557|Ga0212123_10098202 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300022722|Ga0242657_1196087 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300022873|Ga0224550_1053682 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300026281|Ga0209863_10013631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2546 | Open in IMG/M |
| 3300026306|Ga0209468_1006935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4321 | Open in IMG/M |
| 3300026307|Ga0209469_1016956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2611 | Open in IMG/M |
| 3300026314|Ga0209268_1013259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3231 | Open in IMG/M |
| 3300026317|Ga0209154_1011856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4253 | Open in IMG/M |
| 3300026334|Ga0209377_1020377 | All Organisms → cellular organisms → Bacteria | 3387 | Open in IMG/M |
| 3300026335|Ga0209804_1295182 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026528|Ga0209378_1203789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300026551|Ga0209648_10532569 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300026557|Ga0179587_10038913 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300026557|Ga0179587_10400925 | Not Available | 894 | Open in IMG/M |
| 3300026557|Ga0179587_10676414 | Not Available | 680 | Open in IMG/M |
| 3300027604|Ga0208324_1005384 | All Organisms → cellular organisms → Bacteria | 4459 | Open in IMG/M |
| 3300027609|Ga0209221_1164032 | Not Available | 548 | Open in IMG/M |
| 3300027629|Ga0209422_1035880 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300027655|Ga0209388_1218801 | Not Available | 523 | Open in IMG/M |
| 3300027660|Ga0209736_1021007 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300027824|Ga0209040_10312672 | Not Available | 760 | Open in IMG/M |
| 3300027846|Ga0209180_10023241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3295 | Open in IMG/M |
| 3300027854|Ga0209517_10019474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6413 | Open in IMG/M |
| 3300027854|Ga0209517_10189099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1281 | Open in IMG/M |
| 3300027869|Ga0209579_10550913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027903|Ga0209488_10163891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300028017|Ga0265356_1003899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1848 | Open in IMG/M |
| 3300029917|Ga0311326_10215459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300029943|Ga0311340_11409957 | Not Available | 550 | Open in IMG/M |
| 3300029951|Ga0311371_11527874 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300029955|Ga0311342_11051840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300030053|Ga0302177_10456976 | Not Available | 663 | Open in IMG/M |
| 3300030494|Ga0310037_10362439 | Not Available | 607 | Open in IMG/M |
| 3300030688|Ga0311345_11252808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300030706|Ga0310039_10004689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8338 | Open in IMG/M |
| 3300030813|Ga0265750_1003944 | Not Available | 1515 | Open in IMG/M |
| 3300031057|Ga0170834_100205996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031236|Ga0302324_100099937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4921 | Open in IMG/M |
| 3300031708|Ga0310686_112873373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1168 | Open in IMG/M |
| 3300031715|Ga0307476_10001296 | All Organisms → cellular organisms → Bacteria | 15328 | Open in IMG/M |
| 3300031715|Ga0307476_10110006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1953 | Open in IMG/M |
| 3300031715|Ga0307476_10919384 | Not Available | 645 | Open in IMG/M |
| 3300031715|Ga0307476_11372598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031720|Ga0307469_10607121 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300031720|Ga0307469_11358769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300031753|Ga0307477_10303564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1102 | Open in IMG/M |
| 3300031754|Ga0307475_11326793 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031820|Ga0307473_11385167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300032160|Ga0311301_10040946 | All Organisms → cellular organisms → Bacteria | 11172 | Open in IMG/M |
| 3300032160|Ga0311301_10202777 | All Organisms → cellular organisms → Bacteria | 3394 | Open in IMG/M |
| 3300032160|Ga0311301_10651020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1499 | Open in IMG/M |
| 3300032160|Ga0311301_10689398 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300032205|Ga0307472_100032965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3031 | Open in IMG/M |
| 3300032770|Ga0335085_10089750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4008 | Open in IMG/M |
| 3300032770|Ga0335085_11355844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300032828|Ga0335080_10216509 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300032898|Ga0335072_10043704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6096 | Open in IMG/M |
| 3300034163|Ga0370515_0394745 | Not Available | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.74% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.16% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.16% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.16% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100325912 | 3300000567 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKQRLQKIVAERQKKSASPSR* |
| JGI12270J11330_100529223 | 3300000567 | Peatlands Soil | VNANLKEMAQKMAQAARAGVAIEKKRLKEILAARQKKSPTSR* |
| JGI12637J13337_10076512 | 3300001137 | Forest Soil | MAENLLEFAQKMAQAARAGVAVERKRLKEILAERQRKQPAQPSQQS |
| JGI12635J15846_106923372 | 3300001593 | Forest Soil | MAVDLTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSVSSSR* |
| JGIcombinedJ26739_1014360342 | 3300002245 | Forest Soil | MALNLIEMAQKMAQAARTGVAVEKKRLQEILAERQKKSASSSR* |
| JGI25385J37094_101162563 | 3300002558 | Grasslands Soil | MAVNLTEMAQKLAQAVRAGVAIEKNRLKEILAERQKKSASPSR* |
| JGI25613J43889_101316771 | 3300002907 | Grasslands Soil | MAEKLREMAEKMAQATRAGVAIERKRLQEILAERQKNSTLPSR* |
| soilH2_103231872 | 3300003324 | Sugarcane Root And Bulk Soil | MATNWREWAQKMAEAARAGVAIEKKRLQEILAERQKKSAPSSK* |
| soilH2_103996442 | 3300003324 | Sugarcane Root And Bulk Soil | MAKDITKMAQKMAQAARAVLAIEKKRLQEIIAERQKKAAPSSR* |
| Ga0062389_1001581032 | 3300004092 | Bog Forest Soil | MAVNLTEMAQMMAQAARAGVAIEKRRLKEILAERQKKSAPSSK* |
| Ga0066674_101320673 | 3300005166 | Soil | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKSASPSR* |
| Ga0066672_100079308 | 3300005167 | Soil | MAVNWTELAQKIAQAARAGVAVEKKRLQEILAERQKKSAPSSR* |
| Ga0070708_1000064874 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVNWTEMAQKMAQAARAGVAIEKKRLQEILAERQKNSEPSSK* |
| Ga0070708_1007432062 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMNWTEWAQKLAEAARAGVAIEKKRLQEILAERQRKSAPSSK* |
| Ga0066681_105356801 | 3300005451 | Soil | LPALEYPKYMAKDITKMAQKMAQAARAGVAVEKKRLQEILAERQKKS |
| Ga0070707_1007204292 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVNWTEMAQKMAQAARAGVAIEKKRLQEILAERQKKSEPSSK* |
| Ga0070735_102826663 | 3300005534 | Surface Soil | MAVNLTKMAQKMAQAARAGLAIEKKRLQEILAERQKKSVSSSR* |
| Ga0070730_104010462 | 3300005537 | Surface Soil | MAVNLKEMAQKMAQAARAGVAIERKRLQEILAERQKKSSSSSR* |
| Ga0070732_103642092 | 3300005542 | Surface Soil | MAVNLTKMAQKMAQAARAGLALEKKRLQEILAERQKKPAPSSR* |
| Ga0066661_101442582 | 3300005554 | Soil | MAMNLIELAHKMAQAARAGVAIERKRLQQILSERQNKPAPSR* |
| Ga0066661_103554583 | 3300005554 | Soil | VNLIELAQKMAQAARAGVAIERKRLQQILSERQNKPAPSR* |
| Ga0066707_100712672 | 3300005556 | Soil | MAVHLTEMAQKLAQAVRAGVAIEKNRLKEILAERQKKSASPSR* |
| Ga0066707_109175441 | 3300005556 | Soil | MAMNLIELAHKMAQAARSGVASERKRLQQILSERQNKPAPSR* |
| Ga0070764_101333643 | 3300005712 | Soil | VTANLRELAQKMAQAARAGVAIEKKRLKEILAARSKKSASPTR* |
| Ga0070764_108864412 | 3300005712 | Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSASPSR* |
| Ga0075277_10506512 | 3300005895 | Rice Paddy Soil | MATTMNWTTWAQKMAEAARAGVAIDKKRLQKILAEQQKKSAPSSK* |
| Ga0080027_100144395 | 3300005993 | Prmafrost Soil | MAVNLMEMAQKMAQAARAGVAIERKRLQEILAERQKKSVLPPR* |
| Ga0066790_100535742 | 3300005995 | Soil | MAENLVELAQKMAQAARAGVAIEKKRLQEILARQKKSEPSSK* |
| Ga0066790_102090802 | 3300005995 | Soil | MAVNWTEMAQRMAQAARAGVAIEKKRLQKILAEREKKSASSSR* |
| Ga0070717_1000184710 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAMNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKSASPSR* |
| Ga0070717_100656544 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMGVNWLELAQKMAQAARAGVVIERKRLQEILAERQRK |
| Ga0070717_107458272 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVNLTEMAQKMAAATRKGVAIEKMRLKKILAERQKKSASSSR* |
| Ga0075029_1007108702 | 3300006052 | Watersheds | MAVNWVEFAQKMAEAARAGLAIEKKRLQEIVAERQ |
| Ga0075017_1002411673 | 3300006059 | Watersheds | MAENLVELAQKMAQAARAGIAIEKKRLQEILVERQKKSAPSSK* |
| Ga0066659_101083703 | 3300006797 | Soil | MAVNLIELAQKMAQAARAGVAIERKRLQQILSERQNKPAPSR* |
| Ga0075425_1012708443 | 3300006854 | Populus Rhizosphere | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKPASPSQ* |
| Ga0073928_101126712 | 3300006893 | Iron-Sulfur Acid Spring | MAVNWIELAQKMAQAARAGVAIEKKRLQEILAERQRKQAPARSSSH* |
| Ga0073928_101925282 | 3300006893 | Iron-Sulfur Acid Spring | MAENLVELAQKMAQAARAGVAIEKRRLQEIIVERQKKSAPSSK* |
| Ga0099791_103252362 | 3300007255 | Vadose Zone Soil | MAVNWTEMAQKMAQAARAGLAIEEKRLQEILADRQKKSAPSSRSAVPH* |
| Ga0099829_106562162 | 3300009038 | Vadose Zone Soil | MAVNWTEWAQKLAEAARAGVAIEKKRLQEILAERQKKSAPSSK* |
| Ga0099830_101220582 | 3300009088 | Vadose Zone Soil | MAVNWTEMAQKMAQAARAGLVIEKKRLQEILAERQKKSVPASR* |
| Ga0099827_1000401510 | 3300009090 | Vadose Zone Soil | MAVNWTELAQKMAQAARAGVVIEKKRLQEILAERQKKSEPPSQ* |
| Ga0099827_110631542 | 3300009090 | Vadose Zone Soil | MAVNLREMAQKMAQAARAGAAIEKKRLKEILVERQKKSAPPAR* |
| Ga0099792_103450462 | 3300009143 | Vadose Zone Soil | MAENLVELARRMAQAARAGVAIEKKRLQEILVERQKKSAPSSK* |
| Ga0116221_14889042 | 3300009523 | Peatlands Soil | MAVNLKELAQKMAQAARAGVAIERKRLKEILAERQKKSASSPR* |
| Ga0116113_10348513 | 3300009638 | Peatland | MAENLVEVAQKMAQAARAGVAIEKKRLQEILVERQKKSASSSK* |
| Ga0116121_11153822 | 3300009644 | Peatland | YSMAENLVELAQKMAQAARAGVAIEKKRLQEILLERQKKSASSSSSSK* |
| Ga0116216_107016481 | 3300009698 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLKEILAERQKKSAFPPR* |
| Ga0116217_105214771 | 3300009700 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVVIEKKRLKEILAERQKKSASSPR* |
| Ga0116131_10200072 | 3300009760 | Peatland | MAQKMAQAARAGVAIEKKRLQEILAERQKKSASSSR* |
| Ga0116219_102766781 | 3300009824 | Peatlands Soil | MAQKMAQAARAGVAIEKKRLKEILAERQKKSAFPPR* |
| Ga0116223_103668492 | 3300009839 | Peatlands Soil | MAERMAQAARAGVAIEKKRLKEILAERQKKPASTPR* |
| Ga0134125_101137134 | 3300010371 | Terrestrial Soil | LTKMAQKMAQAAREGVAIERKRLQEILAERQKKTPPTSR* |
| Ga0136449_1000501085 | 3300010379 | Peatlands Soil | MAQKMAQAARAGVAIEKKRLQKILAEREKKIAPPSR* |
| Ga0136449_1002363512 | 3300010379 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSASSSR* |
| Ga0136449_1005497561 | 3300010379 | Peatlands Soil | MAVNLREMAQKMAQAARAGVAIEKKRLKEILAERQKKSAFPPR* |
| Ga0136449_1006683354 | 3300010379 | Peatlands Soil | MAVNLAKMAEKMAQAARAGLAIEKKRLQEILAERQKESVSSSR* |
| Ga0136449_1009260612 | 3300010379 | Peatlands Soil | MAENLVELAQKMAQAARAGVAIEKKRLQEILVERQKKSAPSSK* |
| Ga0136449_1036156322 | 3300010379 | Peatlands Soil | MAVNWTKVAQKMAQAARAGVAIEKKRLQEILAERQKKSVPSSR* |
| Ga0137391_110321592 | 3300011270 | Vadose Zone Soil | MNLTKMAQQMAQAARAGVAVEKERLKKLLAERDKKPKSASR* |
| Ga0137393_100958393 | 3300011271 | Vadose Zone Soil | MAVNLMEMAQKMAKAARAGVAIEKKRLKQILAERQNQKKSAPSR* |
| Ga0137393_111432591 | 3300011271 | Vadose Zone Soil | MEMAQKMAEAARKGVAIEKKRLKKILAERQKKSASPSR* |
| Ga0137389_115066152 | 3300012096 | Vadose Zone Soil | MELAQKMAEAARKGVAIEKKRLKKILAERQKKSASPSR* |
| Ga0137388_105418042 | 3300012189 | Vadose Zone Soil | MAVNWTEWAQKLAEAARAGVAIEKKRLQEILAERQKKSPPSSK* |
| Ga0137383_106021902 | 3300012199 | Vadose Zone Soil | MAVNWTKLARKMAQAARAGVIIEKKRLQEILAERQKRSAPSSQ* |
| Ga0137365_100731203 | 3300012201 | Vadose Zone Soil | MAVNLKEMAQKMAKAARAGVAIERKRLQKILAERREKSASPSR* |
| Ga0137379_116926641 | 3300012209 | Vadose Zone Soil | MAENLVELAKKMAQAARAGVAIEKKRLQEILVERQKKSAP |
| Ga0137378_114195802 | 3300012210 | Vadose Zone Soil | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKSASP |
| Ga0137377_117511512 | 3300012211 | Vadose Zone Soil | TEMAQKMAQAARAGVAIERKRLQKILAERRKKSASPSR* |
| Ga0137371_110650451 | 3300012356 | Vadose Zone Soil | MAVNLKEMAKKMAKAARAGVAIERKRLQKILAERREKSASPSR* |
| Ga0137385_114129042 | 3300012359 | Vadose Zone Soil | MMAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKS |
| Ga0137360_113432251 | 3300012361 | Vadose Zone Soil | MAVSLMEMAQKMAQAARAGVVIERKRLQEILAERQKKSALPSR* |
| Ga0137398_102515832 | 3300012683 | Vadose Zone Soil | MAENLVELAQRMAQAARAGVAIEKKRLQEILVERQKKSAPSSK* |
| Ga0137397_108638762 | 3300012685 | Vadose Zone Soil | MAVNWTEMAQKMAQAARAGLAIEGKRVQEMLADRQKKSAPSTRA |
| Ga0137419_102135032 | 3300012925 | Vadose Zone Soil | MTVSLMEMAQKMAQAARAGVAIERKRLQEILAQRQKKSALPSR* |
| Ga0137419_108227121 | 3300012925 | Vadose Zone Soil | MAVSLMEMAQKMAQAARAGVAIERKRLQEILAERQNKSALPSR* |
| Ga0137404_101439992 | 3300012929 | Vadose Zone Soil | MEMAQKMAQAARAGVAIERKRLQEILAERQKKSALPSR* |
| Ga0137404_103168683 | 3300012929 | Vadose Zone Soil | MAVNWTEWAQKMAEAARAGVAIEKQRLQEILAERQKKSAPVAK* |
| Ga0137404_107727231 | 3300012929 | Vadose Zone Soil | MAVSLMEMAQKMAQAARAGVAIERKRLQEILAERQRKSALQSR* |
| Ga0137404_110793052 | 3300012929 | Vadose Zone Soil | MAANLKEMAQKMAQAARAGVAIEKKRLQEILAERQKKSKSPQQ* |
| Ga0137410_100689863 | 3300012944 | Vadose Zone Soil | MAENLVELAQKMAQAARAGVAIEKKRLQEILAQRQEKSSPSSK* |
| Ga0137410_105363391 | 3300012944 | Vadose Zone Soil | MAEKLREMAEKMAQAARAGVAIERKRLQEILAERQKNSTLPSR* |
| Ga0137418_101734522 | 3300015241 | Vadose Zone Soil | MAVSLMEMAQKMAQAVRAGVAIERKRLQEILAERQKKSALPSR* |
| Ga0137418_104509632 | 3300015241 | Vadose Zone Soil | MDVNLTEMAQKMAQAARVGVAIEKERLKKILAERQKKLAPPSR* |
| Ga0137412_109752571 | 3300015242 | Vadose Zone Soil | MAANLKEMAQKMAQAARAGVAIEKKRLQEILAERQKKSKSSSR* |
| Ga0137403_106771602 | 3300015264 | Vadose Zone Soil | MAKDITKIAQKMVQAARAGLAIEKKRLQEIIAERQKKVAPSSR* |
| Ga0187818_103908442 | 3300017823 | Freshwater Sediment | MAANLTQMAQKMAQAARKGVAIERERLKKILAERQKKSTSPSR |
| Ga0187847_103837702 | 3300017948 | Peatland | MAENLVEVAQKMAQAARAGVAIEKKRLQEILVERQKKSASSSK |
| Ga0187804_102081442 | 3300018006 | Freshwater Sediment | MAANLKEMAEKMAQAARAGLAIEKERLKKILAERQKK |
| Ga0187871_100214505 | 3300018042 | Peatland | VSTDLKEMAQKMAQAARAGVAIEKKRLQEILAGRRKKSARPSR |
| Ga0187851_100736442 | 3300018046 | Peatland | MAENLVELAQKMAQAARAGVAIEKKRLQEILLERQKKSASSSSSSK |
| Ga0066667_100735512 | 3300018433 | Grasslands Soil | MAVNLTEMAQKLAQAVRAGVAIEKNRLKEILAERQKKSASPSR |
| Ga0066667_100975102 | 3300018433 | Grasslands Soil | MAMNLIELAHKMAQAARAGVAIERKRLQQILSERQNKPAPSR |
| Ga0066667_111456372 | 3300018433 | Grasslands Soil | MVENLMEMAQKMAEAARKGVAIEKKRLKKILAEREKKSPSPSR |
| Ga0066662_101053653 | 3300018468 | Grasslands Soil | MAVNWTELAQKIAQAARAGVAVEKKRLQEILAERQKKSAPSSR |
| Ga0066662_101721052 | 3300018468 | Grasslands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQEILAERQKKSEPSSK |
| Ga0193735_11575992 | 3300020006 | Soil | MAVNLIELAQKMAQAARAGVAIERRRLQQILSERQKKPAPSR |
| Ga0193721_10492892 | 3300020018 | Soil | MAVNLIELAQKMAQAARAGVAIERRRLQQILSDRQNKPAPSR |
| Ga0210407_104068092 | 3300020579 | Soil | MAVNWTEVAQKMAQAARAGVVIEKKRLQEILAERQKKSASPTR |
| Ga0210403_100867753 | 3300020580 | Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSASPSR |
| Ga0210403_105483491 | 3300020580 | Soil | MPVNLTKMAQKMAQAARAGLAIEKKRLREILAERQKKSVSSSR |
| Ga0210399_101521812 | 3300020581 | Soil | MAVNCAEMAQKMAQAARAGVAIERKRVQEILAERQKKSASSSR |
| Ga0210395_101056562 | 3300020582 | Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSTSPSR |
| Ga0210400_104869932 | 3300021170 | Soil | MALNLIEMAQKMAQAARTGVAVEKKRLQEILAERQKKSASSSR |
| Ga0210405_102425173 | 3300021171 | Soil | MAVNWTEMAQKMAQAARAGVAIEKKSLQKILAERQKKSASPSR |
| Ga0210408_100271483 | 3300021178 | Soil | MAVNWAEMAQKMAQAARAGVAIERKRLQKILAERQKKSASSSR |
| Ga0210396_100292341 | 3300021180 | Soil | MAVNLTKMAQKMAQAARAGLAIEKKRLQEILAERQKKSVSSSR |
| Ga0210393_114798622 | 3300021401 | Soil | MAVNLVEMAQRMAQAARAGLAIERKRLQKILAERQKQSASSSR |
| Ga0210383_100025873 | 3300021407 | Soil | MAVNLKEMAQKMARAARAGVAIEKKRLQEILAERGNKSTPSSR |
| Ga0210394_1000020179 | 3300021420 | Soil | MAQKMAQAARAGVAIERKRLQEILAGRQKKSASPSR |
| Ga0210394_102795793 | 3300021420 | Soil | MAVNLREMAQKMAQAARAGVAIEKKRLKEILAEREKKSASSSR |
| Ga0210410_10000046165 | 3300021479 | Soil | MAVNLTKMAKKMAQAARAGLVIEKKRLQEILAERQKKSVSSSR |
| Ga0210410_100305772 | 3300021479 | Soil | MAANLTEIAQKMAQAARAGVVIERKRLKEILAERQKKSASPSR |
| Ga0210410_100305776 | 3300021479 | Soil | MAVNLMQMAQKMAQAARAGVVIERKRLKEILAQRQKKSAPSSR |
| Ga0212123_100982022 | 3300022557 | Iron-Sulfur Acid Spring | MAVNWIELAQKMAQAARAGVAIEKKRLQEILAERQRKQAPARSSSH |
| Ga0242657_11960872 | 3300022722 | Soil | AEMAQKMAQAARAGVAIERKRLQKILAERQKKSASSSR |
| Ga0224550_10536822 | 3300022873 | Soil | MAVNLREMAEKMAHAARAGVAIEKERLKKILAEREKKSPSPSR |
| Ga0209863_100136315 | 3300026281 | Prmafrost Soil | MAVNLMEMAQKMAQAARAGVAIERKRLQEILAERQKKSVLPPR |
| Ga0209468_10069354 | 3300026306 | Soil | MAVNLTEMAKKMAQAARAGVAIERKRLQKILAERRKKSASPSR |
| Ga0209469_10169563 | 3300026307 | Soil | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKSASPSR |
| Ga0209268_10132595 | 3300026314 | Soil | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERR |
| Ga0209154_10118564 | 3300026317 | Soil | MAVNWTELAEKIAQAARAGVAVEKKRLQEILAERQKKSAPSSR |
| Ga0209377_10203775 | 3300026334 | Soil | MAVNWTELAQKIAQAARAGVAVEKKRLQEILAERQKK |
| Ga0209804_12951821 | 3300026335 | Soil | MAQKLAQAVRAGVAIEKNRLKEILAERQKKSASPSR |
| Ga0209378_12037891 | 3300026528 | Soil | MAVHLTEMAQKLAQAVRAGVAIEKNRLKEILAERQKKS |
| Ga0209648_105325692 | 3300026551 | Grasslands Soil | MEMAQKMAEAARKGVAIEKKRLKKILAERQKKSASPSR |
| Ga0179587_100389134 | 3300026557 | Vadose Zone Soil | MAVSLMEMAQKMAQAARAGVAIERKRLQEILAERQNKSALPS |
| Ga0179587_104009251 | 3300026557 | Vadose Zone Soil | MAVNLTEMAKKMAQAAREGVAIEKKRLKKILAERQKQTASSSR |
| Ga0179587_106764142 | 3300026557 | Vadose Zone Soil | MEMAQKMAQAARAGVAIERKRLQEILAERQKKSALPSR |
| Ga0208324_10053846 | 3300027604 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKQRLQKIVAERQKKSASPSR |
| Ga0209221_11640321 | 3300027609 | Forest Soil | MATNWLELAQKMAQAARAGVAVERERLKEILAARQRE |
| Ga0209422_10358801 | 3300027629 | Forest Soil | MAVNLTEMAQKMAEAARKGVAIEKKRLKEILAERRKKSAPPSP |
| Ga0209388_12188012 | 3300027655 | Vadose Zone Soil | MAVNWTEMAQKMAQAARAGLAIEEKRLQEILADRQKKSAPSSRSAVPH |
| Ga0209736_10210073 | 3300027660 | Forest Soil | MAVDLTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSVSSSR |
| Ga0209040_103126722 | 3300027824 | Bog Forest Soil | MAENLVELAQKMAQAARAGVAIEKKRLQEILVERQKKSAPSSSSSK |
| Ga0209180_100232411 | 3300027846 | Vadose Zone Soil | MAVNWTEWAQKLAEAARAGVAIEKKRLQEILAERQKKSAPSSK |
| Ga0209517_100194742 | 3300027854 | Peatlands Soil | MAERMAQAARAGVAIEKKRLKEILAERQKKPASTPR |
| Ga0209517_101890993 | 3300027854 | Peatlands Soil | MAVNLREMAQKMAQAARAGVAIEKKRLKEILAERQKKSAFPPR |
| Ga0209579_105509131 | 3300027869 | Surface Soil | MAVNWLELAQKMAQAARAGVAIERKRLQEILAERQRKQQSQFSSPR |
| Ga0209488_101638912 | 3300027903 | Vadose Zone Soil | MAENLVELAQRMAQAARAGVAIEKKRLQEILVERQKKSAPSSK |
| Ga0265356_10038992 | 3300028017 | Rhizosphere | MAEKMAEAARKGVAIEKERLKKILAERQKRSPSPSR |
| Ga0311326_102154592 | 3300029917 | Bog | MAENLVEVAQKMAQAARAGVAIEKKRLQEILVERQKKSASSSKLFVPD |
| Ga0311340_114099571 | 3300029943 | Palsa | LAENLVELAQKIAQAARAGVAIEKKRLQEILVERQKKYAPSSK |
| Ga0311371_115278742 | 3300029951 | Palsa | MAVNLREMAEKMAHAARAGVAIEKERLKKILAAREKKSPSPSR |
| Ga0311342_110518402 | 3300029955 | Bog | MAENLVEVAQKMAQAARAGVAIEKKRLQEILVERQKKSASTSK |
| Ga0302177_104569761 | 3300030053 | Palsa | RRMAVNLREMAEKMAHAARAGVAIEKERLKKILAEREKKSPSPSR |
| Ga0310037_103624391 | 3300030494 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLKEILAERQKKSAFPPR |
| Ga0311345_112528081 | 3300030688 | Bog | ENLVEVAQKMAQAARAGVAIEKKRLQEILVERQKKSASSSK |
| Ga0310039_100046896 | 3300030706 | Peatlands Soil | VNANLKEMAQKMAQAARAGVAIEKKRLKEILAARQKKSPTSR |
| Ga0265750_10039441 | 3300030813 | Soil | TVSLREMAEKMAEAARKGVAIEKERLKKILAERQKRSPSPSR |
| Ga0170834_1002059963 | 3300031057 | Forest Soil | MAVNWIELAQKMAQAARAGVAIERKRLQEILAERHPKQSQSSSSSR |
| Ga0302324_1000999376 | 3300031236 | Palsa | MAENLVELAQKMAQAARAGVAIEKKRLQEILVERQKKYAPSSK |
| Ga0310686_1128733732 | 3300031708 | Soil | MAVNLTKMAQKMAKAARAGLAIEKKRLQEILAERQKKPVSSLR |
| Ga0307476_100012963 | 3300031715 | Hardwood Forest Soil | MAVNWLELALKMAHAARAGVAIERKRLQEILAERQRKQQSQPSSPR |
| Ga0307476_101100062 | 3300031715 | Hardwood Forest Soil | MAVNLSEMARKMAQAARMGLAIEKKRLQELLAERQKKSAPSPQ |
| Ga0307476_109193842 | 3300031715 | Hardwood Forest Soil | MAVNLTEMAQKMAQAARKGVAIEKKRLKEILAERQKKSTPSSR |
| Ga0307476_113725982 | 3300031715 | Hardwood Forest Soil | VEVAQKIAQAARAGVAIERKRLREILARQKKSAPSSNK |
| Ga0307469_106071212 | 3300031720 | Hardwood Forest Soil | MAVNLTEMAQKMAQAARKGVAIEKKRLKKILAERQKQTASSSR |
| Ga0307469_113587692 | 3300031720 | Hardwood Forest Soil | MAENLVELAQKMAQAARVGVAIEKKRLQEILVERQKKSAPSSK |
| Ga0307477_103035642 | 3300031753 | Hardwood Forest Soil | MAVNLTKMAQKMAQAARAGLALEKKRLQEILAERQKKPAPSSR |
| Ga0307475_113267932 | 3300031754 | Hardwood Forest Soil | MAGNLTEMAQKMAQAARKGVAIEKKRLKKILAERQKKSASSSR |
| Ga0307473_113851672 | 3300031820 | Hardwood Forest Soil | MAVNVREMAQKMAYAARVGVAIERKRLQKILAERRKKSASPSR |
| Ga0311301_100409465 | 3300032160 | Peatlands Soil | MAQKMAQAARAGVAIEKKRLQKILAEREKKIAPPSR |
| Ga0311301_102027773 | 3300032160 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLQKILAERQKKSASSSR |
| Ga0311301_106510201 | 3300032160 | Peatlands Soil | MAVNWTEMAQKMAQAARAGVAIEKKRLKEILAERQKKSASSPR |
| Ga0311301_106893982 | 3300032160 | Peatlands Soil | MAENLVELAQKMAQAARAGVAIEKKRLQEILVERQKKSAPSSK |
| Ga0307472_1000329651 | 3300032205 | Hardwood Forest Soil | MAVNLTEMAQKMAQAARAGVAIERKRLQKILAERRKKPASPSR |
| Ga0335085_100897505 | 3300032770 | Soil | MAKDITKMAQKMAQAARAGVAIEKKRLQEILAERQQKSAPSSR |
| Ga0335085_113558442 | 3300032770 | Soil | MAKDIAEMAQKMAQAARAGVAIEKKRLQEIIAERQKKAAPSSR |
| Ga0335080_102165093 | 3300032828 | Soil | MTAHLIELARKMADAARAGVAVEKKRLQEILAERQKKPAPAAQ |
| Ga0335072_100437044 | 3300032898 | Soil | MAVNWLELAQKMAQAARAGVAIERKRLQEILAERRQKQQSQFSSPH |
| Ga0370515_0394745_2_118 | 3300034163 | Untreated Peat Soil | MDVSWIELAQKMARAARAGVAIEKKRLQEILAERQRKQQ |
| ⦗Top⦘ |