


| Basic Information | |
|---|---|
| Family ID | F035192 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSTPKETLDKAYGNMPKEVGFNFDFDFPTWRGLKYYWYKLIRKVTR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.18 % |
| % of genes near scaffold ends (potentially truncated) | 23.84 % |
| % of genes from short scaffolds (< 2000 bps) | 50.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.279 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (27.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (93.023 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.14% β-sheet: 0.00% Coil/Unstructured: 64.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 6.98 |
| PF04055 | Radical_SAM | 3.49 |
| PF00639 | Rotamase | 3.49 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.91 |
| PF05292 | MCD | 2.91 |
| PF11443 | DUF2828 | 2.33 |
| PF13616 | Rotamase_3 | 2.33 |
| PF13186 | SPASM | 2.33 |
| PF02311 | AraC_binding | 2.33 |
| PF13671 | AAA_33 | 2.33 |
| PF01192 | RNA_pol_Rpb6 | 2.33 |
| PF04308 | RNaseH_like | 2.33 |
| PF01025 | GrpE | 1.74 |
| PF00782 | DSPc | 1.74 |
| PF05118 | Asp_Arg_Hydrox | 1.74 |
| PF00583 | Acetyltransf_1 | 1.16 |
| PF02668 | TauD | 1.16 |
| PF01258 | zf-dskA_traR | 1.16 |
| PF12850 | Metallophos_2 | 1.16 |
| PF03401 | TctC | 0.58 |
| PF02562 | PhoH | 0.58 |
| PF00294 | PfkB | 0.58 |
| PF00472 | RF-1 | 0.58 |
| PF00149 | Metallophos | 0.58 |
| PF01177 | Asp_Glu_race | 0.58 |
| PF06508 | QueC | 0.58 |
| PF05226 | CHASE2 | 0.58 |
| PF04820 | Trp_halogenase | 0.58 |
| PF00596 | Aldolase_II | 0.58 |
| PF07460 | NUMOD3 | 0.58 |
| PF03819 | MazG | 0.58 |
| PF06347 | SH3_4 | 0.58 |
| PF13394 | Fer4_14 | 0.58 |
| PF00166 | Cpn10 | 0.58 |
| PF01068 | DNA_ligase_A_M | 0.58 |
| PF01592 | NifU_N | 0.58 |
| PF01844 | HNH | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 3.49 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 2.33 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.16 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.16 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.58 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.58 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.58 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.58 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.58 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.58 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.58 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.58 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.72 % |
| Unclassified | root | N/A | 41.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000203|TB18AUG2009E_c016037 | Not Available | 860 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1000189 | Not Available | 47397 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1004370 | Not Available | 9036 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1009210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5529 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1039918 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300000756|JGI12421J11937_10111201 | Not Available | 730 | Open in IMG/M |
| 3300003277|JGI25908J49247_10026812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1664 | Open in IMG/M |
| 3300003277|JGI25908J49247_10052946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1056 | Open in IMG/M |
| 3300003375|JGI26470J50227_1001238 | Not Available | 9211 | Open in IMG/M |
| 3300003375|JGI26470J50227_1002332 | Not Available | 6155 | Open in IMG/M |
| 3300003375|JGI26470J50227_1002706 | Not Available | 5588 | Open in IMG/M |
| 3300003804|Ga0007817_1014913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300003815|Ga0007856_1013181 | Not Available | 543 | Open in IMG/M |
| 3300003823|Ga0007875_1000144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10446 | Open in IMG/M |
| 3300004095|Ga0007829_10102375 | Not Available | 582 | Open in IMG/M |
| 3300004686|Ga0065173_1047992 | Not Available | 775 | Open in IMG/M |
| 3300004691|Ga0065176_1007224 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300004692|Ga0065171_1052036 | Not Available | 654 | Open in IMG/M |
| 3300004777|Ga0007827_10043737 | Not Available | 1051 | Open in IMG/M |
| 3300004807|Ga0007809_10003625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6099 | Open in IMG/M |
| 3300004807|Ga0007809_10023022 | Not Available | 2172 | Open in IMG/M |
| 3300005662|Ga0078894_10517714 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1069 | Open in IMG/M |
| 3300005662|Ga0078894_10807427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 820 | Open in IMG/M |
| 3300005941|Ga0070743_10073863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1153 | Open in IMG/M |
| 3300005941|Ga0070743_10222273 | Not Available | 617 | Open in IMG/M |
| 3300006071|Ga0007876_1000028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 64082 | Open in IMG/M |
| 3300006071|Ga0007876_1003645 | Not Available | 4769 | Open in IMG/M |
| 3300006100|Ga0007806_1022047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300006100|Ga0007806_1036641 | Not Available | 968 | Open in IMG/M |
| 3300006103|Ga0007813_1023659 | Not Available | 1419 | Open in IMG/M |
| 3300006105|Ga0007819_1010194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2413 | Open in IMG/M |
| 3300006112|Ga0007857_1015799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1656 | Open in IMG/M |
| 3300006114|Ga0007815_1002693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4980 | Open in IMG/M |
| 3300006114|Ga0007815_1070237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300006118|Ga0007859_1004623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3375 | Open in IMG/M |
| 3300006118|Ga0007859_1028511 | Not Available | 1204 | Open in IMG/M |
| 3300006128|Ga0007828_1006122 | Not Available | 2594 | Open in IMG/M |
| 3300006128|Ga0007828_1127491 | Not Available | 524 | Open in IMG/M |
| 3300007545|Ga0102873_1234902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300007549|Ga0102879_1140432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300007559|Ga0102828_1003107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3086 | Open in IMG/M |
| 3300009151|Ga0114962_10006993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8614 | Open in IMG/M |
| 3300009151|Ga0114962_10015459 | All Organisms → cellular organisms → Bacteria | 5486 | Open in IMG/M |
| 3300009151|Ga0114962_10022192 | All Organisms → cellular organisms → Bacteria | 4466 | Open in IMG/M |
| 3300009151|Ga0114962_10039472 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300009151|Ga0114962_10076417 | Not Available | 2133 | Open in IMG/M |
| 3300009151|Ga0114962_10105738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1746 | Open in IMG/M |
| 3300009151|Ga0114962_10124599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
| 3300009151|Ga0114962_10401152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300009155|Ga0114968_10000035 | Not Available | 122003 | Open in IMG/M |
| 3300009155|Ga0114968_10573834 | Not Available | 599 | Open in IMG/M |
| 3300009158|Ga0114977_10109220 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300009158|Ga0114977_10369562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300009161|Ga0114966_10184611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1332 | Open in IMG/M |
| 3300009164|Ga0114975_10003812 | Not Available | 9966 | Open in IMG/M |
| 3300009164|Ga0114975_10035797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2959 | Open in IMG/M |
| 3300009164|Ga0114975_10100506 | Not Available | 1672 | Open in IMG/M |
| 3300009164|Ga0114975_10192817 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300009182|Ga0114959_10000042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105871 | Open in IMG/M |
| 3300009182|Ga0114959_10047193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2520 | Open in IMG/M |
| 3300009183|Ga0114974_10000402 | Not Available | 36755 | Open in IMG/M |
| 3300009183|Ga0114974_10000881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24152 | Open in IMG/M |
| 3300009502|Ga0114951_10286953 | Not Available | 850 | Open in IMG/M |
| 3300010157|Ga0114964_10005202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8452 | Open in IMG/M |
| 3300010157|Ga0114964_10007545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6827 | Open in IMG/M |
| 3300010158|Ga0114960_10051744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2434 | Open in IMG/M |
| 3300010158|Ga0114960_10171587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1151 | Open in IMG/M |
| 3300010158|Ga0114960_10398624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii → Acinetobacter baumannii NCGM 237 | 673 | Open in IMG/M |
| 3300010158|Ga0114960_10406478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis | 665 | Open in IMG/M |
| 3300010354|Ga0129333_11650969 | Not Available | 522 | Open in IMG/M |
| 3300010885|Ga0133913_10094342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8019 | Open in IMG/M |
| 3300010885|Ga0133913_11445893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1745 | Open in IMG/M |
| 3300012663|Ga0157203_1004884 | Not Available | 2614 | Open in IMG/M |
| 3300012665|Ga0157210_1046363 | Not Available | 667 | Open in IMG/M |
| 3300012665|Ga0157210_1065855 | Not Available | 547 | Open in IMG/M |
| 3300012667|Ga0157208_10065252 | Not Available | 500 | Open in IMG/M |
| 3300012779|Ga0138284_1141151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
| 3300013093|Ga0164296_1010650 | Not Available | 6927 | Open in IMG/M |
| 3300013093|Ga0164296_1053619 | Not Available | 1915 | Open in IMG/M |
| 3300013093|Ga0164296_1090323 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300013093|Ga0164296_1200480 | Not Available | 771 | Open in IMG/M |
| 3300013094|Ga0164297_10227096 | Not Available | 720 | Open in IMG/M |
| 3300013094|Ga0164297_10393002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300013285|Ga0136642_1001094 | Not Available | 12118 | Open in IMG/M |
| 3300013285|Ga0136642_1002839 | Not Available | 6626 | Open in IMG/M |
| 3300013285|Ga0136642_1015807 | All Organisms → Viruses → Predicted Viral | 2259 | Open in IMG/M |
| 3300013285|Ga0136642_1058514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
| 3300013285|Ga0136642_1147825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300013285|Ga0136642_1153766 | Not Available | 571 | Open in IMG/M |
| 3300013286|Ga0136641_1000965 | Not Available | 12073 | Open in IMG/M |
| 3300013286|Ga0136641_1001968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8413 | Open in IMG/M |
| 3300013286|Ga0136641_1002637 | Not Available | 7153 | Open in IMG/M |
| 3300013286|Ga0136641_1003017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6621 | Open in IMG/M |
| 3300013286|Ga0136641_1008829 | Not Available | 3422 | Open in IMG/M |
| 3300013286|Ga0136641_1057252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1124 | Open in IMG/M |
| 3300020160|Ga0211733_10340908 | Not Available | 515 | Open in IMG/M |
| 3300020716|Ga0214207_1024812 | Not Available | 704 | Open in IMG/M |
| 3300020716|Ga0214207_1035765 | Not Available | 560 | Open in IMG/M |
| 3300020731|Ga0214170_1000103 | Not Available | 35961 | Open in IMG/M |
| 3300020731|Ga0214170_1002977 | Not Available | 4202 | Open in IMG/M |
| 3300020731|Ga0214170_1006141 | All Organisms → Viruses → Predicted Viral | 2644 | Open in IMG/M |
| 3300020731|Ga0214170_1009199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2006 | Open in IMG/M |
| 3300020731|Ga0214170_1064510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300020733|Ga0214172_1003220 | Not Available | 4204 | Open in IMG/M |
| 3300020733|Ga0214172_1003398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4035 | Open in IMG/M |
| 3300020735|Ga0214219_1063654 | Not Available | 522 | Open in IMG/M |
| 3300021121|Ga0214173_112157 | Not Available | 896 | Open in IMG/M |
| 3300021131|Ga0214206_1005933 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300021138|Ga0214164_1015151 | All Organisms → Viruses → Predicted Viral | 2403 | Open in IMG/M |
| 3300021139|Ga0214166_1006533 | Not Available | 3648 | Open in IMG/M |
| 3300021139|Ga0214166_1013400 | Not Available | 2235 | Open in IMG/M |
| 3300021142|Ga0214192_1021715 | All Organisms → Viruses → Predicted Viral | 2292 | Open in IMG/M |
| 3300021349|Ga0194052_1012698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3859 | Open in IMG/M |
| 3300022591|Ga0236341_1000047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 64597 | Open in IMG/M |
| 3300022591|Ga0236341_1000410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26875 | Open in IMG/M |
| 3300022591|Ga0236341_1001015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16335 | Open in IMG/M |
| 3300022591|Ga0236341_1005176 | All Organisms → cellular organisms → Bacteria | 5570 | Open in IMG/M |
| 3300022591|Ga0236341_1016306 | All Organisms → Viruses → Predicted Viral | 2402 | Open in IMG/M |
| 3300022591|Ga0236341_1026612 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300022591|Ga0236341_1034025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
| 3300022602|Ga0248169_115344 | Not Available | 5198 | Open in IMG/M |
| 3300022602|Ga0248169_124857 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
| 3300023311|Ga0256681_10171989 | All Organisms → Viruses → Predicted Viral | 4267 | Open in IMG/M |
| 3300023311|Ga0256681_11289885 | Not Available | 605 | Open in IMG/M |
| 3300024343|Ga0244777_10784781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300025336|Ga0208619_108049 | Not Available | 770 | Open in IMG/M |
| 3300025339|Ga0208502_1014919 | Not Available | 663 | Open in IMG/M |
| 3300025357|Ga0208383_1001397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3853 | Open in IMG/M |
| 3300025372|Ga0207957_1002829 | Not Available | 3161 | Open in IMG/M |
| 3300025379|Ga0208738_1010787 | Not Available | 1569 | Open in IMG/M |
| 3300025379|Ga0208738_1019112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → Aurantimonas manganoxydans → Aurantimonas manganoxydans SI85-9A1 | 1103 | Open in IMG/M |
| 3300025381|Ga0208871_1008355 | Not Available | 1783 | Open in IMG/M |
| 3300025382|Ga0208256_1000271 | Not Available | 12206 | Open in IMG/M |
| 3300025392|Ga0208380_1000447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10939 | Open in IMG/M |
| 3300025392|Ga0208380_1000769 | Not Available | 7964 | Open in IMG/M |
| 3300025392|Ga0208380_1033944 | Not Available | 788 | Open in IMG/M |
| 3300025401|Ga0207955_1043846 | Not Available | 740 | Open in IMG/M |
| 3300025411|Ga0208865_1064854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300025413|Ga0208614_1022180 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300025417|Ga0208616_1023781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 947 | Open in IMG/M |
| 3300025423|Ga0208746_1054502 | Not Available | 627 | Open in IMG/M |
| 3300025426|Ga0208739_1044456 | Not Available | 731 | Open in IMG/M |
| 3300025426|Ga0208739_1056005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → Aurantimonas manganoxydans → Aurantimonas manganoxydans SI85-9A1 | 634 | Open in IMG/M |
| 3300025430|Ga0208622_1068593 | Not Available | 605 | Open in IMG/M |
| 3300025430|Ga0208622_1089335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300027186|Ga0208797_1026137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300027294|Ga0208441_1117934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300027320|Ga0208923_1001426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4605 | Open in IMG/M |
| 3300027708|Ga0209188_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 168414 | Open in IMG/M |
| 3300027708|Ga0209188_1000094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 102340 | Open in IMG/M |
| 3300027708|Ga0209188_1006614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7174 | Open in IMG/M |
| 3300027708|Ga0209188_1008364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6091 | Open in IMG/M |
| 3300027708|Ga0209188_1041342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2111 | Open in IMG/M |
| 3300027720|Ga0209617_10352659 | Not Available | 543 | Open in IMG/M |
| 3300027734|Ga0209087_1053192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
| 3300027746|Ga0209597_1019613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3724 | Open in IMG/M |
| 3300027747|Ga0209189_1134033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1074 | Open in IMG/M |
| 3300027749|Ga0209084_1026322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3051 | Open in IMG/M |
| 3300027749|Ga0209084_1034493 | Not Available | 2566 | Open in IMG/M |
| 3300027749|Ga0209084_1063062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1735 | Open in IMG/M |
| 3300027759|Ga0209296_1000473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34868 | Open in IMG/M |
| 3300027759|Ga0209296_1002525 | Not Available | 13099 | Open in IMG/M |
| 3300027759|Ga0209296_1029673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 3025 | Open in IMG/M |
| 3300027759|Ga0209296_1046453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2291 | Open in IMG/M |
| 3300027892|Ga0209550_10210076 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300027963|Ga0209400_1000145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 62162 | Open in IMG/M |
| 3300027969|Ga0209191_1017607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3610 | Open in IMG/M |
| 3300028393|Ga0304728_1141251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300032117|Ga0316218_1000731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 42021 | Open in IMG/M |
| 3300032676|Ga0316229_1041297 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 27.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 27.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 11.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.16% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.58% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.58% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.58% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021349 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6m | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB18AUG2009E_0160374 | 3300000203 | Freshwater | MSTPKETLDKAYGNMPKEVGFNFDFDFPTWRGLKYYWYKLIRKVTR* |
| TBL_comb48_EPIDRAFT_100018912 | 3300000439 | Freshwater | MSTPKETLDKAYGNMPKEVGYSFDFDFVPGWRGIKYYWYKLIRKVTR* |
| TBL_comb48_EPIDRAFT_100437024 | 3300000439 | Freshwater | KQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKATR* |
| TBL_comb48_EPIDRAFT_100921017 | 3300000439 | Freshwater | MTKQQDTIDRAYGNMPKEVGITFDFDLPTWRGVKYYWHKLIRKVTR* |
| TBL_comb48_EPIDRAFT_10399189 | 3300000439 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIR |
| JGI12421J11937_101112015 | 3300000756 | Freshwater And Sediment | MTPKEVIDQAYRNIPNEVGFAWNWDIIPTWRGVRYYWHKLIRKATR* |
| JGI25908J49247_100268122 | 3300003277 | Freshwater Lake | MSSEDTINRAYGNMPREVGFTHNWDFIPTWRGMKYYWHKLIRKITR* |
| JGI25908J49247_100529464 | 3300003277 | Freshwater Lake | MTPKEVIDKAYRNVPNEVGFAWNWDTAPTWRGVRYYWHKLIRAITR* |
| JGI26470J50227_10012381 | 3300003375 | Freshwater | MSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYYWYKLIRKITR* |
| JGI26470J50227_100233220 | 3300003375 | Freshwater | MSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYXWYKLIRKITR* |
| JGI26470J50227_10027067 | 3300003375 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKATR* |
| Ga0007817_10149132 | 3300003804 | Freshwater | MSKQDDTLNKAYGSIPKEVASDFDFFSWLPSFRGIKFYWYKLIRKVTR* |
| Ga0007856_10131811 | 3300003815 | Freshwater | FRPVAPTTKESCMSTPKETLDKAYGNMPKEVGYSFDFDFVPGWRGIKYYWYKLIRKVTR* |
| Ga0007875_100014416 | 3300003823 | Freshwater | MTKQQDTIDRAYGNMPKEVGITFDFDLPGWRGVKYYWYKLIRKVTR* |
| Ga0007829_101023751 | 3300004095 | Freshwater | MSKQKDTLDKAYGNVPKEVGFAVDFGLPSWRGLKYYWYKLIRKVTR* |
| Ga0065173_10479923 | 3300004686 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKVTR* |
| Ga0065176_10072241 | 3300004691 | Freshwater | IYYRRSCMSKQEDTLNKAYGNVPKEVGFSMSLDFIPTLRGIKYYWHKLIRKVTR* |
| Ga0065171_10520361 | 3300004692 | Freshwater | NLYIKESCMTKQQDTIDRAYGNMPKEVGITFDFDLPGWRGVKYYWYKLIRKVTR* |
| Ga0007827_100437371 | 3300004777 | Freshwater | MSKQEDTLNKAYGNVPKEIGFYIDLDVVPGWRGVKYYWYKLIRKVTR* |
| Ga0007809_100036258 | 3300004807 | Freshwater | MSTPKETLDKAYGSVPKEVGFNFDMTWMPTWRGVKYYWHKLIRKITR* |
| Ga0007809_100230225 | 3300004807 | Freshwater | MSTPKETLDKAYGNVPKEVGYFYDWTIVPTWRGLRYYWHKLIRKITR* |
| Ga0078894_105177141 | 3300005662 | Freshwater Lake | MSNSKEILDKAYGSMSKEVGFNVDLFYWMPTFRGIKYHWYKLVRSVTR* |
| Ga0078894_108074273 | 3300005662 | Freshwater Lake | MSRDEIINQAYGNMPKEVGFAGNWDFIPTWRGVKYYWHKLVRRVTR* |
| Ga0070743_100738634 | 3300005941 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGVRYYWHKLIRAITR* |
| Ga0070743_102222731 | 3300005941 | Estuarine | MTPKEVIDKAYRNIPNEVGFAVNWDFTPTWRGVRYYWYKLIRKATR* |
| Ga0007876_10000285 | 3300006071 | Freshwater | MSTKETLDRAYGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR* |
| Ga0007876_10036458 | 3300006071 | Freshwater | MSKQKDTLDKAYGNVPKEVGFAVDFGLPSWRGLKYYWYKLIRKATR* |
| Ga0007806_10220475 | 3300006100 | Freshwater | MSKQDDTLNKAYGSIPKEIASDFDFFSWLPSFRGIKFYWYKLIRKVTR* |
| Ga0007806_10366413 | 3300006100 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKITR* |
| Ga0007813_10236591 | 3300006103 | Freshwater | CMSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYYWYKLIRKITR* |
| Ga0007819_101019410 | 3300006105 | Freshwater | MSKQEDVLKKAYGNMPKDVGFYIDMDILPGWRGIKYYWYKLIRKVTR* |
| Ga0007857_10157993 | 3300006112 | Freshwater | FKKGVGMSTKETLDRAYGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR* |
| Ga0007815_10026931 | 3300006114 | Freshwater | SCMTKQQDTIDRAYGNMPKEVGITFDFDLPGWRGVKYYWYKLIRKVTR* |
| Ga0007815_10702373 | 3300006114 | Freshwater | QGVRVQVSLGAPKFKKGVGMSTKETLDRAYGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR* |
| Ga0007816_10397033 | 3300006115 | Freshwater | YGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR* |
| Ga0007859_100462312 | 3300006118 | Freshwater | MSKQEDTLNKAYGNVPKEVGFSMSLDFIPTLRGIKYYWHKLIRKVTR* |
| Ga0007859_10285111 | 3300006118 | Freshwater | MSKQEDTLKKAYGNMPKEVGYSFDFDFVPGWRGIKYYWYKLIRKVTR* |
| Ga0007828_10061221 | 3300006128 | Freshwater | LDKAYGSVPKEVGFNFDMTWMPTWRGVKYYWHKLIRKITR* |
| Ga0007828_11274912 | 3300006128 | Freshwater | MSTPKETIDKAYGNMPKEVGFSGNWDFIPTWRGIKYYWHKLIRKVTR* |
| Ga0102873_12349025 | 3300007545 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGVRYYWHKLIR |
| Ga0102879_11404322 | 3300007549 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGAKYYWHKLIRAITR* |
| Ga0102828_10031079 | 3300007559 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGIKYYWHKLIRAITR* |
| Ga0114962_100069935 | 3300009151 | Freshwater Lake | MSSKETLDKAYGNMPREVGFSTNWDFIPTWRGVKYYWHKLIRKVTR* |
| Ga0114962_1001545913 | 3300009151 | Freshwater Lake | MSKQEDTLQKAYGNMPKEVGFTNSWDFIPSWRGIKYYWHKLIRKATR* |
| Ga0114962_1002219216 | 3300009151 | Freshwater Lake | MSKQEDVLNKAYGNVPKEIGYWYDWNLLPTWRGIRYYWHKLIRKVTR* |
| Ga0114962_100394724 | 3300009151 | Freshwater Lake | MSKQEDVINKAYGNMPREVGFSVDWEFIPGWRGLKYYWYKLVRKVTR* |
| Ga0114962_100764179 | 3300009151 | Freshwater Lake | MSKQEDVINRAYCNVPKEVGYAIDWNFFPTWRGIKYYWYKLVRKVTR* |
| Ga0114962_101057388 | 3300009151 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFSHSWDFIPTWRGVKYYWHKLIRKATR* |
| Ga0114962_101245993 | 3300009151 | Freshwater Lake | MSKQEETLNKAYGNMPREVGFNVDWEFIPGWRGIKYYWYKLIRKITR* |
| Ga0114962_104011522 | 3300009151 | Freshwater Lake | MSKREDTLNRAYGNVPREVGYAYDWNFVPSWRGVKYYWHKLIRKVTR* |
| Ga0114968_10000035112 | 3300009155 | Freshwater Lake | MSKQEDTLHKAYGNMPKEVGYSGNWDFIPTWRGVKYYWYKLIRKVTR* |
| Ga0114968_105738341 | 3300009155 | Freshwater Lake | RSCMSKQEDTLNRAYGNVPNEVGYEFDLDFLPGWRGIKYYWYKLIRKVTR* |
| Ga0114977_101092204 | 3300009158 | Freshwater Lake | MSSKDIINRAYGNMPREVGFNVDWQFIPGWRGVKYYWYKLIRKVTR* |
| Ga0114977_103695621 | 3300009158 | Freshwater Lake | QEDTLNKAYGNMPREVGFSTNWDFIPTWRGLKYYWYKLIRKVTR* |
| Ga0114966_101846111 | 3300009161 | Freshwater Lake | PCVKENSMTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGVRYYWHKLIRAITR* |
| Ga0114975_1000381211 | 3300009164 | Freshwater Lake | MSKQQDVLNKAYGNMPKEVGYAMDWDFIPTWRGVKYYWYKLIRKITR* |
| Ga0114975_100357977 | 3300009164 | Freshwater Lake | MSKQEEILNKAYGNMPKEVGFSVDWEFIPGWRGLKYYWYKLVRKVTR* |
| Ga0114975_101005068 | 3300009164 | Freshwater Lake | MTSKETLNKAYGNMPREVGFAGSLFDWLPTWRGVKYYWYKLSRKVTR* |
| Ga0114975_101928175 | 3300009164 | Freshwater Lake | MSKQEDTLNKAYGNMPKEVGYTFDLDFVPGWRGFKYYWYKLIRKVTR* |
| Ga0114959_1000004244 | 3300009182 | Freshwater Lake | MKSDETLQKAYGNVPKEVGFFWDMNFLPTWRGFKYYWYKLLRKVTR* |
| Ga0114959_1004719310 | 3300009182 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFAHSWDFIPTWRGVKYYWHKLIRKATR* |
| Ga0114974_1000040265 | 3300009183 | Freshwater Lake | MSSKETLDKAYGNMPKEVGFNVDWGFIPSWRGVKYYWYTLVRKVTR* |
| Ga0114974_1000088146 | 3300009183 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFSTNWDFIPTWRGLKYYWYKLIRKVTR* |
| Ga0114951_102869534 | 3300009502 | Freshwater | MSKQEDILNKAYGNVPKEIGYNADWSILPGWRGVRYYWYKLIRKITR* |
| Ga0114964_1000520227 | 3300010157 | Freshwater Lake | MSNKTIEKAYGHVPKEVGYTGSWVDFIPTRRGIKYYWYRLLRKITR* |
| Ga0114964_100075451 | 3300010157 | Freshwater Lake | MSKQEEIIQKAYGNVPKEIGYSIDWDFIPTLRGIKYYWHKLIRK |
| Ga0114960_100517447 | 3300010158 | Freshwater Lake | MSKQEDTLNKAYGNMPKEVGFNDLFFDWLPTFRGIKYYWYKLLRKVTR* |
| Ga0114960_101715871 | 3300010158 | Freshwater Lake | MSTPKETLDKAYGNVPREVGFNTSWDFIPTWRGVKYYWYKLIRKVTR* |
| Ga0114960_103986243 | 3300010158 | Freshwater Lake | MSKNEDTLNKAYGNMPKDVGFIVDLDWLPTWRGFKYYYYKLIRKATR* |
| Ga0114960_104064784 | 3300010158 | Freshwater Lake | MSKQEDTLQKAYGNMPKEVGFNQNWDFIPTWRGIKYYWHKLIRKITR* |
| Ga0129333_116509693 | 3300010354 | Freshwater To Marine Saline Gradient | MSVKDTLNKAYGNVPKEPQLSLDLTWVPTWRGLKYYWYKLIRKVTR* |
| Ga0133913_100943423 | 3300010885 | Freshwater Lake | MSNKTIEKAYGHVPKEVGYTGSWVDFIPTPRGIKYYWYRLLRKITR* |
| Ga0133913_114458937 | 3300010885 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFSTNWDFIPTWRGVKYYWYKLIRKVTR* |
| Ga0157203_100488411 | 3300012663 | Freshwater | MSSKETLDRAYGNMPKEVGYSFNLEFLPAWRGIKYYWYMLIRKVTR* |
| Ga0157210_10463633 | 3300012665 | Freshwater | MSKQEDILNKAYGSMPKEVGFSGNWDFIPTWRGVKYYWHKLVRKITR* |
| Ga0157210_10658553 | 3300012665 | Freshwater | TLQRAYGNMPKEVGYTFDLNMFPTWRGIKYYWYVLVRKVTR* |
| Ga0157208_100652521 | 3300012667 | Freshwater | NYRRSYMSSKETLDKAYGSMPKEVGINLELDWLPSWRGLKYYWHKLVRKVTR* |
| Ga0138284_11411516 | 3300012779 | Freshwater Lake | RINCMSKQEDTLNKAYGNMPREVGFSTNWDFIPTWRGLKYYWYKLIRKVTR* |
| Ga0164296_101065014 | 3300013093 | Freshwater | MNKQDETIAKAYGNIPKEVGYTIDFSFIPTWRGIKYYWYKVVRKVTR* |
| Ga0164296_10536195 | 3300013093 | Freshwater | MSTPKETIDKAYGNMPREVGVNLDWDIVPGWRGFKYYWYKLIRKVTR* |
| Ga0164296_10903233 | 3300013093 | Freshwater | QEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKVTR* |
| Ga0164296_12004802 | 3300013093 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDINFVPTWRGIKYYWHKLIRKITR* |
| Ga0164297_102270961 | 3300013094 | Freshwater | IAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKVTR* |
| Ga0164297_103930025 | 3300013094 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKVTR* |
| Ga0136642_10010942 | 3300013285 | Freshwater | MSKQEDVLNKAYGNVPKEVGFSIFWDFLPTWRGVKYYWHKLIRKITR* |
| Ga0136642_100283921 | 3300013285 | Freshwater | MSKQEDVLNKAYGNMPREVGFTSSWDFIPTWRGMKYYWHKLVRKITR* |
| Ga0136642_10158074 | 3300013285 | Freshwater | MSKQEDTLNKAYGNMPREVGYNSNWDLLPGWRGIKYYWYKLIRKVTR* |
| Ga0136642_10585143 | 3300013285 | Freshwater | MSKQEDTLNKAYGNMPKEVGYFYDWNFIPTFRGVKYYWHKLIRKATR* |
| Ga0136642_11478251 | 3300013285 | Freshwater | MTKQQDTINRAYGNVPKEVGFSVDWEFIPGWRGLKYYWYKLVRKITR |
| Ga0136642_11537662 | 3300013285 | Freshwater | MSKQEDTLNKAYGNVPREIGFSVVWDFLPTWRGIRYYWHKLIRKITR* |
| Ga0136641_10009654 | 3300013286 | Freshwater | MSKQEDTLNKAYGNVPKEVGFNLDLDWLPAWRGVKYYWYKLIRKITR* |
| Ga0136641_100196814 | 3300013286 | Freshwater | MSKQEDTLNKAYGNMPREVCYNSNWDLLPGWRGIKYYWYKLIRKVTR* |
| Ga0136641_100263715 | 3300013286 | Freshwater | MSKQDDILNKAYGNMPKEVGFYIDMDIVPGWRGIRYYWYKLIRKITR* |
| Ga0136641_10030173 | 3300013286 | Freshwater | MSKQEDVLNRAYGNVPREIGYWYDWNFLPTWRGIRYYWHKLVRKVTR* |
| Ga0136641_100882915 | 3300013286 | Freshwater | MTKQQDTINRAYGNVPKEVGFNNDWNFIPTWRGIRYYWHKLIRKVTR* |
| Ga0136641_10572526 | 3300013286 | Freshwater | MSKQEEILNKAYGNMPKEVGYTFDLDFVPGWRGFKYYWYKLIRRVTR* |
| Ga0211733_103409082 | 3300020160 | Freshwater | MTPKEIIDQAYRNIPYEVGFAYNWDSIPTWRGVRYYWHKLIRKATR |
| Ga0214207_10248122 | 3300020716 | Freshwater | MSTPKETIDKAYGNMSKDIGFNIDWEILPGWRGFKYYWYKLIRKVTR |
| Ga0214207_10357653 | 3300020716 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKATR |
| Ga0214170_100010358 | 3300020731 | Freshwater | MSTPKETLDKAYGNMPKEVGYSFDFDFVPGWRGIKYYWYKLIRKVTR |
| Ga0214170_100297716 | 3300020731 | Freshwater | MSTPKETLDKAYGNMPKEVNINVDWDLPGWRGIKYYWYKLIRKVTR |
| Ga0214170_100614110 | 3300020731 | Freshwater | YIKESCMSTPKETIDKAYGNMPKEVGFNFDINFVPTWRGIKYYWHKLIRKVTR |
| Ga0214170_10091998 | 3300020731 | Freshwater | MTKQQDTIDRAYGNMPKEVGITFDFDLPTWRGVKYYWHKLIRKVTR |
| Ga0214170_10645101 | 3300020731 | Freshwater | MSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKY |
| Ga0214172_100322013 | 3300020733 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDINFVPTWRGIKYYWHKLIRKITR |
| Ga0214172_10033984 | 3300020733 | Freshwater | MSTKETLDRAYGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR |
| Ga0214219_10636541 | 3300020735 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDINFVPTWRGIKYYWHKLIRKVTR |
| Ga0214173_1121574 | 3300021121 | Freshwater | MSTPKETLDKAYGNMPKEVGYSFDFDFVPGWRGIKY |
| Ga0214206_10059336 | 3300021131 | Freshwater | MSKQEDTLNKAYGNVPKEVGFNIDWDVVPGWRGFKYYWYKLIRKVTR |
| Ga0214164_10151515 | 3300021138 | Freshwater | MSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYYWYKLIRKITR |
| Ga0214166_10065333 | 3300021139 | Freshwater | MNKQDETIAKAYGNIPKEVGYTIDFSFIPTWRGIKYYWYKVVRKVTR |
| Ga0214166_10134007 | 3300021139 | Freshwater | MSTPKETLDKAYGNMPKEVGFNFDFDFPTWRGLKYYWYKLIRKVTR |
| Ga0214192_10217153 | 3300021142 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGVKYYWYKLIRKVTR |
| Ga0194052_10126986 | 3300021349 | Anoxic Zone Freshwater | MSKQDDTLNKAYGNIPKEVGFNFDIISCLPVLRGMKYYWYKLIRKVTR |
| Ga0236341_1000047118 | 3300022591 | Freshwater | MSSKETLDKAYGNMPKEVGYTTEMFEWMPTFRGIKYYWYKLVRKVTR |
| Ga0236341_100041058 | 3300022591 | Freshwater | MSKPKEVLEKAYGSMPKEVGMSFELDFVPTWRGIKYYWLKYVVRKAFR |
| Ga0236341_100101535 | 3300022591 | Freshwater | MSKQQEVIDKAYGNMPKEVGFGADLFDWMPTLRGLKYYWYKLIRKVTR |
| Ga0236341_100517620 | 3300022591 | Freshwater | MSKPDEVLQKAYGNMPKEVGFNFDMTWVPAIRGLKYYWLRLVRKVTR |
| Ga0236341_10163067 | 3300022591 | Freshwater | MTSPRETLEKAYGSVPREVGYSVVWDFTPVRGIRYYWHRLIRKITR |
| Ga0236341_10266129 | 3300022591 | Freshwater | LGAPNIKDIAVSPKETLQKAYGSVPKEVGYAIEWNFIPTWRGIKYYWYKLTRKVTR |
| Ga0236341_10340258 | 3300022591 | Freshwater | LGAPNIKDIAVSPKETLQKAYGSVPKEVGYAIDWDMIPTWRGIKYHWHLLVRKLTR |
| Ga0248169_11534415 | 3300022602 | Freshwater | MSTPKETIDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKVTR |
| Ga0248169_1248574 | 3300022602 | Freshwater | MSKQEDTIAKAYGNVPKEVGINFDISFVPTWRGIKYYWHKLIRKVTR |
| Ga0256681_1017198915 | 3300023311 | Freshwater | VSPKETLQKAYGSVPKEVGYAIEWNFIPTWRGIKYYWYKLTRKVTR |
| Ga0256681_112898852 | 3300023311 | Freshwater | MSTPKVTLDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKVTR |
| Ga0244777_107847811 | 3300024343 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGAKYYWHKLIRAITR |
| Ga0208619_1080493 | 3300025336 | Freshwater | MSKQQETLNKAYGNMPKDVGFYIDMDVVPGWRGIKYYWYKLIRKVTR |
| Ga0208502_10149194 | 3300025339 | Freshwater | MSKQEDTLNKAYGNVPKEVGFSMSLDFIPTLRGIKYYWHKLIRKVTR |
| Ga0208383_10013979 | 3300025357 | Freshwater | MSTPKETLDKAYGSVPKEVGFNFDMTWMPTWRGVKYYWHKLIRKITR |
| Ga0207957_10028292 | 3300025372 | Freshwater | MTKQQDTIDRAYGNMPKEVGITFDFDLPGWRGVKYYWYKLIRKVTR |
| Ga0208738_10107871 | 3300025379 | Freshwater | PLHKGESCMTKQQDTIDRAYGNMPKEVGITFDFDLPGWRGVKYYWYKLIRKVTR |
| Ga0208738_10191124 | 3300025379 | Freshwater | MSTPKETLDKAYGNMPKEVGFNFDISFMPTWRGIKYYWHKLIRKVTR |
| Ga0208871_10083557 | 3300025381 | Freshwater | SRMSKQDDTLNKAYGSIPKEVASDFDFFSWLPSFRGIKFYWYKLIRKVTR |
| Ga0208256_100027127 | 3300025382 | Freshwater | STPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYYWYKLIRKITR |
| Ga0208380_100044732 | 3300025392 | Freshwater | MSKQEDTLNKAYGNMPKDVGFSIVWDIVPSWRGIKYYWHKLIRKVTR |
| Ga0208380_10007693 | 3300025392 | Freshwater | MSKQEDTLNKAYGNVPKEIGFYIDLDVVPGWRGVKYYWYKLIRKVTR |
| Ga0208380_10339444 | 3300025392 | Freshwater | MSKQKDTLDKAYGNVPKEVGFAVDFGLPSWRGLKYYWYKLIRKVTR |
| Ga0207955_10438463 | 3300025401 | Freshwater | RTNKESCMSTPKETIDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKVTR |
| Ga0208865_10648543 | 3300025411 | Freshwater | KETLDRAYGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR |
| Ga0208614_10221806 | 3300025413 | Freshwater | ESCMSTPKETLDKAYGNMPKEVGFNFDISFMPTWRGIKYYWHKLIRKVTR |
| Ga0208616_10237811 | 3300025417 | Freshwater | MNINPSSCAQIYYRRSCMSKQEDTLNKAYGNVPKEVGFSMSLDFIPTLRGIKYYWHKLIRKVTR |
| Ga0208746_10545023 | 3300025423 | Freshwater | MSKQEDTLKKAYGNMPKDIGFYIDMDIVPGWRGIKYYWYKLIRKVTR |
| Ga0208739_10444561 | 3300025426 | Freshwater | CMSKQKDTLDKAYGNVPKEVGFAVDFGLPSWRGLKYYWYKLIRKATR |
| Ga0208739_10485891 | 3300025426 | Freshwater | YGNMPKEVSGNFDFFDFVPTPRGIKYYWYRLIRKITR |
| Ga0208739_10560054 | 3300025426 | Freshwater | LDKAYGNMPKEVGFNFDISFMPTWRGIKYYWHKLIRKVTR |
| Ga0208622_10685931 | 3300025430 | Freshwater | KETIDKAYGNMPKEVGFNFDISFVPTWRGIKYYWHKLIRKVTR |
| Ga0208622_10893354 | 3300025430 | Freshwater | MSTPKETLDKAYGNMPKDIGFNIDWEILPGWRGFKYYWYKLIRK |
| Ga0208797_10261374 | 3300027186 | Estuarine | CVKENSMTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGIKYYWHKLIRAITR |
| Ga0208441_11179341 | 3300027294 | Estuarine | VIDKAYRNIPNEVGFAWNWDTAPTWRGAKYYWHKLIRAITR |
| Ga0208923_10014269 | 3300027320 | Estuarine | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGIKYYWHKLIRAITR |
| Ga0209188_100002344 | 3300027708 | Freshwater Lake | MKSDETLQKAYGNVPKEVGFFWDMNFLPTWRGFKYYWYKLLRKVTR |
| Ga0209188_100009444 | 3300027708 | Freshwater Lake | MSKQEDVINRAYCNVPKEVGYAIDWNFFPTWRGIKYYWYKLVRKVTR |
| Ga0209188_100661416 | 3300027708 | Freshwater Lake | MSKNEDTLNKAYGNMPKDVGFIVDLDWLPTWRGFKYYYYKLIRKATR |
| Ga0209188_10083647 | 3300027708 | Freshwater Lake | MSKQEDVINKAYGNMPREVGFSVDWEFIPGWRGLKYYWYKLVRKVTR |
| Ga0209188_10413425 | 3300027708 | Freshwater Lake | MSKQEDTLQKAYGNMPKEVGFTNSWDFIPSWRGIKYYWHKLIRKATR |
| Ga0209617_103526592 | 3300027720 | Freshwater And Sediment | MTPKEVIDQAYRNIPNEVGFAWNWDIIPTWRGVRYYWHKLIRKATR |
| Ga0209087_10531926 | 3300027734 | Freshwater Lake | MTSKETLNKAYGNMPREVGFAGSLFDWLPTWRGVKYYWYKLSRKVTR |
| Ga0209597_10196135 | 3300027746 | Freshwater Lake | MTPKEVIDKAYRNIPNEVGFAWNWDTAPTWRGVRYYWHKLIRAITR |
| Ga0209189_11340336 | 3300027747 | Freshwater Lake | MSTPKETLDKAYGNVPREVGFNTSWDFIPTWRGVKYYWYKLIRKVTR |
| Ga0209084_10263229 | 3300027749 | Freshwater Lake | MSKQEDVINKAYGNVPREVGFSISWDFIPTWRGVKYYWYKLIRKVTR |
| Ga0209084_10344934 | 3300027749 | Freshwater Lake | MSKREDTLNRAYGNVPREVGYAYDWNFVPSWRGVKYYWHKLIRKVTR |
| Ga0209084_10630623 | 3300027749 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFSHSWDFIPTWRGVKYYWHKLIRKATR |
| Ga0209296_100047361 | 3300027759 | Freshwater Lake | MSSKETLDKAYGNMPKEVGFNVDWGFIPSWRGVKYYWYTLVRKVTR |
| Ga0209296_100252521 | 3300027759 | Freshwater Lake | MSSKDIINRAYGNMPREVGFNVDWQFIPGWRGVKYYWYKLIRKVTR |
| Ga0209296_10296739 | 3300027759 | Freshwater Lake | MSKQEDTLNKAYGNMPREVGFSTNWDFIPTWRGLKYYWYKLIRKVTR |
| Ga0209296_10464535 | 3300027759 | Freshwater Lake | MSKQQDVLNKAYGNMPKEVGYAMDWDFIPTWRGVKYYWYKLIRKITR |
| Ga0209550_102100767 | 3300027892 | Freshwater Lake | MSSEDTINRAYGNMPREVGFTHNWDFIPTWRGMKYYWHKLIRKITR |
| Ga0209400_100014512 | 3300027963 | Freshwater Lake | MSKQEDTLHKAYGNMPKEVGYSGNWDFIPTWRGVKYYWYKLIRKVTR |
| Ga0209191_101760710 | 3300027969 | Freshwater Lake | MSKQEEILNKAYGNMPKEVGFSVDWEFIPGWRGLKYYWYKLVRKVTR |
| Ga0304728_11412515 | 3300028393 | Freshwater Lake | MSKQEDTLNKAYGNMPKEVGFNDLFFDWLPTFRGIKYYWYKL |
| Ga0316218_100073162 | 3300032117 | Freshwater | MSTPKEVIDKAYGNMPKEVGFIVNWDLPVWRGVKYYWYKLIRKVTR |
| Ga0316229_10412971 | 3300032676 | Freshwater | MSTPKETLDKAYGNMPKEVNINVDWDLPGWRGIKYYWYKLIRK |
| ⦗Top⦘ |