


| Basic Information | |
|---|---|
| Family ID | F035092 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKALCVPAFVILALVSAVVPLSAHHSWPVNNERLVTVKGTV |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.41 % |
| % of genes near scaffold ends (potentially truncated) | 96.53 % |
| % of genes from short scaffolds (< 2000 bps) | 93.64 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.503 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (6.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.994 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 3.47 |
| PF08811 | DUF1800 | 2.89 |
| PF03069 | FmdA_AmdA | 2.89 |
| PF12796 | Ank_2 | 1.73 |
| PF02604 | PhdYeFM_antitox | 1.16 |
| PF06983 | 3-dmu-9_3-mt | 1.16 |
| PF07995 | GSDH | 1.16 |
| PF12543 | DUF3738 | 1.16 |
| PF12836 | HHH_3 | 1.16 |
| PF13442 | Cytochrome_CBB3 | 1.16 |
| PF00296 | Bac_luciferase | 0.58 |
| PF01764 | Lipase_3 | 0.58 |
| PF09619 | YscW | 0.58 |
| PF07676 | PD40 | 0.58 |
| PF13683 | rve_3 | 0.58 |
| PF13531 | SBP_bac_11 | 0.58 |
| PF14026 | DUF4242 | 0.58 |
| PF14532 | Sigma54_activ_2 | 0.58 |
| PF02401 | LYTB | 0.58 |
| PF01855 | POR_N | 0.58 |
| PF02627 | CMD | 0.58 |
| PF00501 | AMP-binding | 0.58 |
| PF01979 | Amidohydro_1 | 0.58 |
| PF00034 | Cytochrom_C | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| PF12695 | Abhydrolase_5 | 0.58 |
| PF14542 | Acetyltransf_CG | 0.58 |
| PF11860 | Muramidase | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF01041 | DegT_DnrJ_EryC1 | 0.58 |
| PF03576 | Peptidase_S58 | 0.58 |
| PF01546 | Peptidase_M20 | 0.58 |
| PF01738 | DLH | 0.58 |
| PF13472 | Lipase_GDSL_2 | 0.58 |
| PF03054 | tRNA_Me_trans | 0.58 |
| PF02900 | LigB | 0.58 |
| PF13620 | CarboxypepD_reg | 0.58 |
| PF01494 | FAD_binding_3 | 0.58 |
| PF08450 | SGL | 0.58 |
| PF05163 | DinB | 0.58 |
| PF01048 | PNP_UDP_1 | 0.58 |
| PF04389 | Peptidase_M28 | 0.58 |
| PF03448 | MgtE_N | 0.58 |
| PF01850 | PIN | 0.58 |
| PF07969 | Amidohydro_3 | 0.58 |
| PF03372 | Exo_endo_phos | 0.58 |
| PF01933 | CofD | 0.58 |
| PF07332 | Phage_holin_3_6 | 0.58 |
| PF01161 | PBP | 0.58 |
| PF00154 | RecA | 0.58 |
| PF02225 | PA | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.47 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.47 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.47 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 2.89 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 2.89 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.16 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.16 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.16 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.16 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.16 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.16 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.16 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.16 |
| COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.58 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.58 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.58 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.58 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.58 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.58 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.58 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.58 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.58 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.58 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.58 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.58 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.58 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.58 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.58 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.58 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.58 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.50 % |
| Unclassified | root | N/A | 18.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG01BCMSE | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300003319|soilL2_10264622 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300004092|Ga0062389_102991569 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300004092|Ga0062389_103182357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300004157|Ga0062590_102833583 | Not Available | 518 | Open in IMG/M |
| 3300004633|Ga0066395_10404449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300005169|Ga0066810_10085983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 675 | Open in IMG/M |
| 3300005328|Ga0070676_11293369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005332|Ga0066388_101874172 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005334|Ga0068869_102073184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 511 | Open in IMG/M |
| 3300005335|Ga0070666_10736389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300005338|Ga0068868_102092927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005339|Ga0070660_101624607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 550 | Open in IMG/M |
| 3300005340|Ga0070689_100047156 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300005340|Ga0070689_101001457 | Not Available | 743 | Open in IMG/M |
| 3300005356|Ga0070674_101850360 | Not Available | 548 | Open in IMG/M |
| 3300005366|Ga0070659_102004120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005459|Ga0068867_100140978 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300005467|Ga0070706_101846137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 549 | Open in IMG/M |
| 3300005526|Ga0073909_10160810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300005538|Ga0070731_10499396 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005539|Ga0068853_100238582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
| 3300005540|Ga0066697_10364091 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005558|Ga0066698_11017505 | Not Available | 526 | Open in IMG/M |
| 3300005564|Ga0070664_102372461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300005578|Ga0068854_100170270 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300005614|Ga0068856_100983570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300005615|Ga0070702_101503261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300005616|Ga0068852_100399462 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005617|Ga0068859_101185815 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005764|Ga0066903_102569391 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005764|Ga0066903_103767360 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005842|Ga0068858_102266748 | Not Available | 537 | Open in IMG/M |
| 3300005842|Ga0068858_102309632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300006034|Ga0066656_10559093 | Not Available | 743 | Open in IMG/M |
| 3300006041|Ga0075023_100141135 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300006052|Ga0075029_101108015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300006163|Ga0070715_10701195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300006174|Ga0075014_100868140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300006237|Ga0097621_101063261 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006237|Ga0097621_102084492 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006358|Ga0068871_102074446 | Not Available | 541 | Open in IMG/M |
| 3300006797|Ga0066659_11281002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300006804|Ga0079221_10676997 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006804|Ga0079221_10930083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006844|Ga0075428_100950857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 910 | Open in IMG/M |
| 3300006846|Ga0075430_100327691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1266 | Open in IMG/M |
| 3300006846|Ga0075430_100708516 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006847|Ga0075431_100110270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2840 | Open in IMG/M |
| 3300006853|Ga0075420_100689905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 880 | Open in IMG/M |
| 3300006871|Ga0075434_100271646 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300006871|Ga0075434_102485978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300006876|Ga0079217_10913569 | Not Available | 628 | Open in IMG/M |
| 3300006880|Ga0075429_100389022 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300006903|Ga0075426_11454101 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006969|Ga0075419_10114369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300007076|Ga0075435_100298568 | Not Available | 1377 | Open in IMG/M |
| 3300009012|Ga0066710_103710362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300009092|Ga0105250_10470757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300009093|Ga0105240_11853330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 628 | Open in IMG/M |
| 3300009093|Ga0105240_12153117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300009093|Ga0105240_12326837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300009137|Ga0066709_101778244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300009137|Ga0066709_103541790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300009148|Ga0105243_10569527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300009148|Ga0105243_12140561 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300009176|Ga0105242_11516359 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009176|Ga0105242_11788768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300009521|Ga0116222_1052667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1773 | Open in IMG/M |
| 3300009610|Ga0105340_1177909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300009683|Ga0116224_10108306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300009819|Ga0105087_1120698 | Not Available | 508 | Open in IMG/M |
| 3300009839|Ga0116223_10376862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300010036|Ga0126305_10952019 | Not Available | 587 | Open in IMG/M |
| 3300010047|Ga0126382_11074519 | Not Available | 711 | Open in IMG/M |
| 3300010329|Ga0134111_10273103 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010336|Ga0134071_10153299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300010336|Ga0134071_10167865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300010359|Ga0126376_10288729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300010359|Ga0126376_12944232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300010360|Ga0126372_11308542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300010362|Ga0126377_12271292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010366|Ga0126379_13130639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300010366|Ga0126379_13857853 | Not Available | 502 | Open in IMG/M |
| 3300010379|Ga0136449_103729679 | Not Available | 575 | Open in IMG/M |
| 3300010400|Ga0134122_10179030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300011440|Ga0137433_1255338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012038|Ga0137431_1107240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 786 | Open in IMG/M |
| 3300012199|Ga0137383_10641192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300012202|Ga0137363_11175747 | Not Available | 653 | Open in IMG/M |
| 3300012349|Ga0137387_10483507 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300012351|Ga0137386_10008351 | All Organisms → cellular organisms → Bacteria | 6900 | Open in IMG/M |
| 3300012356|Ga0137371_11452429 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012511|Ga0157332_1004398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300012901|Ga0157288_10010480 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300012922|Ga0137394_11457356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012972|Ga0134077_10102667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300013105|Ga0157369_11867081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300013297|Ga0157378_11165652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300013297|Ga0157378_11948043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300013297|Ga0157378_12730580 | Not Available | 546 | Open in IMG/M |
| 3300013306|Ga0163162_11827216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300013308|Ga0157375_13046688 | Not Available | 559 | Open in IMG/M |
| 3300014326|Ga0157380_10781968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300014493|Ga0182016_10785285 | Not Available | 530 | Open in IMG/M |
| 3300014868|Ga0180088_1071329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300014968|Ga0157379_11602089 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300014969|Ga0157376_12518301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300015359|Ga0134085_10172160 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300015374|Ga0132255_101450937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300016357|Ga0182032_11751128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300016404|Ga0182037_10816688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 805 | Open in IMG/M |
| 3300016422|Ga0182039_11684592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 580 | Open in IMG/M |
| 3300017656|Ga0134112_10182350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300018006|Ga0187804_10506753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300018085|Ga0187772_11282009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300018466|Ga0190268_10574823 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300018466|Ga0190268_10579396 | Not Available | 788 | Open in IMG/M |
| 3300018482|Ga0066669_11185079 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300019787|Ga0182031_1397757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1516 | Open in IMG/M |
| 3300020693|Ga0214226_1018020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300021082|Ga0210380_10558055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RBG_16_68_9 | 525 | Open in IMG/M |
| 3300021178|Ga0210408_11176690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021181|Ga0210388_10067966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2997 | Open in IMG/M |
| 3300021402|Ga0210385_10428713 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300021405|Ga0210387_10221701 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300021432|Ga0210384_11407551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300022722|Ga0242657_1134308 | Not Available | 640 | Open in IMG/M |
| 3300023270|Ga0247784_1191475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. Fw109-5 | 536 | Open in IMG/M |
| 3300025619|Ga0207926_1097992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300025916|Ga0207663_10075245 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300025919|Ga0207657_11318815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia thailandensis | 545 | Open in IMG/M |
| 3300025934|Ga0207686_10596415 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300025934|Ga0207686_10632930 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300025935|Ga0207709_11216009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300025936|Ga0207670_11153208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300025937|Ga0207669_11352332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300025942|Ga0207689_10813526 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300025942|Ga0207689_11386977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300025961|Ga0207712_11698748 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026088|Ga0207641_12316238 | Not Available | 537 | Open in IMG/M |
| 3300026089|Ga0207648_10376001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300026142|Ga0207698_11745702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300027645|Ga0209117_1113063 | Not Available | 732 | Open in IMG/M |
| 3300027678|Ga0209011_1075577 | Not Available | 1000 | Open in IMG/M |
| 3300027867|Ga0209167_10500689 | Not Available | 665 | Open in IMG/M |
| 3300027873|Ga0209814_10011527 | All Organisms → cellular organisms → Bacteria | 3484 | Open in IMG/M |
| 3300027911|Ga0209698_10586892 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300028792|Ga0307504_10459143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031236|Ga0302324_101410919 | Not Available | 911 | Open in IMG/M |
| 3300031474|Ga0170818_112084498 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031524|Ga0302320_10069891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5964 | Open in IMG/M |
| 3300031547|Ga0310887_11143757 | Not Available | 501 | Open in IMG/M |
| 3300031562|Ga0310886_10661988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031708|Ga0310686_118085043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031715|Ga0307476_10159796 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300031736|Ga0318501_10729187 | Not Available | 547 | Open in IMG/M |
| 3300031740|Ga0307468_102510365 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031796|Ga0318576_10567551 | Not Available | 535 | Open in IMG/M |
| 3300031890|Ga0306925_11219207 | Not Available | 753 | Open in IMG/M |
| 3300031890|Ga0306925_12050151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
| 3300031893|Ga0318536_10398890 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031902|Ga0302322_101597624 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031938|Ga0308175_101131253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 869 | Open in IMG/M |
| 3300032000|Ga0310903_10028040 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300032000|Ga0310903_10090116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300032122|Ga0310895_10752151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032180|Ga0307471_100228171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1894 | Open in IMG/M |
| 3300032770|Ga0335085_10008236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 15945 | Open in IMG/M |
| 3300033004|Ga0335084_11705564 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.31% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.16% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.58% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.58% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.58% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020693 | Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_00418880 | 2170459009 | Grass Soil | MKALLAPVAVILALASPAVPLFAHHSWPVNTSKLVTVKGTVVEF |
| soilL2_102646221 | 3300003319 | Sugarcane Root And Bulk Soil | VRNKLFVSAFVIVALVSGAVSVSAHHSWPVNNTQLVTVKGKVTEFVWENPH |
| Ga0062389_1029915692 | 3300004092 | Bog Forest Soil | MKTCSIPAFALFTLVFAVTPLAAHHSWPVSFGKLVTVKGTVIELVWAN |
| Ga0062389_1031823571 | 3300004092 | Bog Forest Soil | MKALCVPAIVVLVLVSAVLPLSAHHSWPVGNDHLVTVKGKVIEFMWANPHPMI |
| Ga0062590_1028335831 | 3300004157 | Soil | VAKTLFVSAIVILALVSVAVPLSAHHSWPVGNQLVTVKGTV |
| Ga0066395_104044491 | 3300004633 | Tropical Forest Soil | MKALCVRSIAVLALVSAVTPLSAHHSWPVSYERLVTVKGT |
| Ga0066810_100859832 | 3300005169 | Soil | MKSLLVPVFVVLALVPGAVPLSAHHSWPVSFSQLVTVTGT |
| Ga0070676_112933691 | 3300005328 | Miscanthus Rhizosphere | MKTLCVLVILTLVSAVMPLSAHHSWPISSDRLVTVKGKVLEFT |
| Ga0066388_1018741721 | 3300005332 | Tropical Forest Soil | VAKNLFVPAIVILALVSAAVPVSAHHSWPVSYSQLVTVKGTV |
| Ga0068869_1020731842 | 3300005334 | Miscanthus Rhizosphere | MKALSVPAFVILALVSAAVPLSAHHSWPVNMDRLVTVKGTVIDFTW |
| Ga0070666_107363892 | 3300005335 | Switchgrass Rhizosphere | MKALSVSASIVLALVFAVVPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTLEVQASDG |
| Ga0068868_1020929271 | 3300005338 | Miscanthus Rhizosphere | MKALRFPATLVLALVCAVAPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTVE |
| Ga0070660_1016246072 | 3300005339 | Corn Rhizosphere | MKIVYVPALVILMLVSAGMPLAAHHSWPVTYDRLVTVKGKVVDFKWANPHPMMTLEVQ |
| Ga0070689_1000471564 | 3300005340 | Switchgrass Rhizosphere | MKSTFLVSAIVLALVAFSVPMSAHHSWPVDMSKLVTVKGTV |
| Ga0070689_1010014571 | 3300005340 | Switchgrass Rhizosphere | VKNMSFVSAIIILVLVVAAVPLFAHHSWPVNMSKLVTVKGTVTKVV |
| Ga0070674_1018503601 | 3300005356 | Miscanthus Rhizosphere | MKATQVTACLMLLLMSAARPVSAHHSWPVNMSQLVTVKGTVTDFTWA |
| Ga0070659_1020041202 | 3300005366 | Corn Rhizosphere | MKALSVPASIVLALVFAVVPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTLEVQ |
| Ga0068867_1001409781 | 3300005459 | Miscanthus Rhizosphere | MKALRFPATLVLALVCAVAPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTVEVQ |
| Ga0070706_1018461371 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALCVPAVVVFALVSAVVPLSAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMT |
| Ga0073909_101608101 | 3300005526 | Surface Soil | MKALLVAVATLALVSGAVPLSAHHAWPVSYAQLVTVK |
| Ga0070731_104993962 | 3300005538 | Surface Soil | MKALCVPAIAALVLISAVMPLSAHHSWPVNNDRLVTVKGKVIEFMWANPHPMIT |
| Ga0068853_1002385823 | 3300005539 | Corn Rhizosphere | MKALSVSASIVLALVFAVVPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTLEVQ |
| Ga0066697_103640912 | 3300005540 | Soil | MKALCVSAFVILALVSAVVPLSAHHSWPLSYDQLVTVKG |
| Ga0066698_110175051 | 3300005558 | Soil | VKNTLFVPAIVILALVSAAVPMSAHHSWPLSFSQLVTVKGTVTEF |
| Ga0070664_1023724611 | 3300005564 | Corn Rhizosphere | MKALLASSCVMLALVTAAVPLSAHHSWPVNFSQLVTVKG |
| Ga0068854_1001702701 | 3300005578 | Corn Rhizosphere | MKAFCAPVFVILTLVSAGTPLAAHHSWPINHDRLVTVKG |
| Ga0068856_1009835702 | 3300005614 | Corn Rhizosphere | MKTLCVPVFVILTLVSAVMPLSAHHSWPVNFDRLV |
| Ga0070702_1015032611 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNTLFVPAIVILALVSTVAPLSAHHSWPVNMSQLVTVKG |
| Ga0068852_1003994621 | 3300005616 | Corn Rhizosphere | MKTLCIPALVILTLISVAVPLSAHHSWPVSFDRLVTVKGT |
| Ga0068859_1011858151 | 3300005617 | Switchgrass Rhizosphere | MKGLLMPAVVILALVSGAVSLSAHHSWPVNFDKLVTVKGTVM |
| Ga0066903_1025693912 | 3300005764 | Tropical Forest Soil | MKAIYVPAFFILALISAAVPLSAHHSWPVSMDRLVTVKGT |
| Ga0066903_1037673601 | 3300005764 | Tropical Forest Soil | MRALLAPVCVTLVLVFGAVQLSAHHSWPVDQSRLVTVKGTVMEFA |
| Ga0068858_1022667481 | 3300005842 | Switchgrass Rhizosphere | MKAIQVTACVMLTLMSAVRPLSAHHSWPVNQSQLVTVKGTVTDFTW |
| Ga0068858_1023096321 | 3300005842 | Switchgrass Rhizosphere | MKALSVSASIVLALVFAVVPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTLEVQA |
| Ga0066656_105590932 | 3300006034 | Soil | MRTLFVPVSVVLALVSGAVPLSAHHSWPVNLSRLVTVKGTVMEFAW |
| Ga0075023_1001411353 | 3300006041 | Watersheds | MKTLCVPAFVILSLVSAVMPLSAHHSWPITYERLVTVKGTV |
| Ga0075029_1011080152 | 3300006052 | Watersheds | MKSLGISALVILTLVFAVMPLSAHHSWPVSFDRLVTVKGTV |
| Ga0070715_107011952 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALCDPAFLVIALVSAAIPLSAHHSWPVSNDRLVTVKGKVIEFMWANPHPMITLEVQTN |
| Ga0075014_1008681402 | 3300006174 | Watersheds | MKTLCVPVFIILLLVSAVTPLAAHHSWPITYDRLVTVKGKVVEFKWANPH |
| Ga0097621_1010632612 | 3300006237 | Miscanthus Rhizosphere | MKTLCVPALVVLALVSALMPLSAHHSWPVSNDRLVTVKGKVIDFKWGNPHPMITLEVQTNDGRTEKWQIGGPAIN |
| Ga0097621_1020844921 | 3300006237 | Miscanthus Rhizosphere | MKSLLVPVFAVLALVPGAAPLSAHHSWPVSFNQLVTV |
| Ga0068871_1020744461 | 3300006358 | Miscanthus Rhizosphere | MKSFLLPIFVVLALVPGAVPLSAHHSWPVNFSQLVT |
| Ga0066659_112810021 | 3300006797 | Soil | VANKLFVPVIVILALVSAAVPVSAHHSWPISYSQLV |
| Ga0079221_106769971 | 3300006804 | Agricultural Soil | MKNVFVPASIVLALVFAVMPIAAHHSWPVSNDKLVTVKGKVIEFEWANPHPM |
| Ga0079221_109300831 | 3300006804 | Agricultural Soil | MKTLLAPVAALALGSAVPLSAHHSWPVNTSRLVTVKGTVTEFA |
| Ga0075428_1009508571 | 3300006844 | Populus Rhizosphere | MKTLLIPVCVIVALAVGAVSLSAHHSWPVSREKLVTV |
| Ga0075430_1003276911 | 3300006846 | Populus Rhizosphere | MANKLFVPAIVILALVSATVQVSAHHAWPVNNSQLVTVKGKVTEFIWEN |
| Ga0075430_1007085161 | 3300006846 | Populus Rhizosphere | MKTLFVPVFLVLALVSGAIPLSAHHSWPVSREKLVTVKGTVL |
| Ga0075431_1001102706 | 3300006847 | Populus Rhizosphere | MKALLVPIFVILALLSGAAPLSAHHSWPVSRSQLVTVKGKVTKF |
| Ga0075420_1006899052 | 3300006853 | Populus Rhizosphere | MKTLLIPVCVIVALAVGAVSLSAHHSWPVSREKLV |
| Ga0075434_1002716464 | 3300006871 | Populus Rhizosphere | VANTLFVSAIVILALVFAAVPVSAHHSWPVSYSQL |
| Ga0075434_1024859782 | 3300006871 | Populus Rhizosphere | VAKTSFVPVIVILALVSVALPVFAHHSWPVSYSQLVTVKGTVTEFTWTN |
| Ga0079217_109135692 | 3300006876 | Agricultural Soil | MKTLLGLVSVVLGLVSVPLSAHHSWPVSRAQLVTVKGTVTDF |
| Ga0075429_1003890223 | 3300006880 | Populus Rhizosphere | MMKASRVPVFVIFALVSAAVSLSAHHSWPVSYGQLVTVKGTVMEFA |
| Ga0075426_114541011 | 3300006903 | Populus Rhizosphere | MKPLYVPVFVILALVSVVVPLSAHHSWPVSYDRLVTVKGTVLEFTW |
| Ga0075419_101143692 | 3300006969 | Populus Rhizosphere | MKTLLVPVVVIVALAVGAVSLSAHHSWPVSREKLV |
| Ga0075435_1002985683 | 3300007076 | Populus Rhizosphere | MKAMLTPVLVVLALVFAATPLSAHHSWPVNTSRLVTVKGTVMEI |
| Ga0066710_1037103622 | 3300009012 | Grasslands Soil | MEVLCVPAFVILVLVSAVVPLSAHHSWPVSYDRLVTV |
| Ga0105250_104707571 | 3300009092 | Switchgrass Rhizosphere | MKALCVPAFVILALVSAVGPLSAHHSWPVSNDRLVTVKGKVIEFVWGNPHPMITLEVQTNDGRTEKWQV |
| Ga0105240_118533302 | 3300009093 | Corn Rhizosphere | MKVFCAPVFVILTLVSAVRPLAAHHSWPINHDRLVTVKGTVTEVNWAN |
| Ga0105240_121531171 | 3300009093 | Corn Rhizosphere | MKTLCIPALVILTLISVAVPLSAHHSWPVSFDRLVTVKGTVTE |
| Ga0105240_123268372 | 3300009093 | Corn Rhizosphere | MKIVYVPALVILMLVSAGMPLAAHHSWPITYDRLVTVKGKV |
| Ga0066709_1017782441 | 3300009137 | Grasslands Soil | MKTLCVPAFVILTLVSAVMPLSAHHSWPISYDRLVTVKGTVIDFR |
| Ga0066709_1035417902 | 3300009137 | Grasslands Soil | MKNTLFVPAIVILALVSVAAPLSAHHSWPVNMTQLVTVKGTVTEGMGG |
| Ga0105243_105695272 | 3300009148 | Miscanthus Rhizosphere | MKALSVPASIVLALVCAVLPLAAHHSWPVSNDHLVTVKGKVIEFVWAN |
| Ga0105243_121405611 | 3300009148 | Miscanthus Rhizosphere | MRTWFVTASVVLALVSGTVTLSAHHSWPVNLSRLVTVKGTVME |
| Ga0105242_115163592 | 3300009176 | Miscanthus Rhizosphere | MKALRFPATLVLALVCAVAPLAAHHSWPVSNDHLVTVKGKEIDFKWGNPHPMITLEVQTNDGRTERWQ |
| Ga0105242_117887681 | 3300009176 | Miscanthus Rhizosphere | MAAGGPTMKALSVPASIFLALALALVCAVMPLAAHHSWPVSNDRLVTVKGKVIEFMWANP |
| Ga0116222_10526671 | 3300009521 | Peatlands Soil | MKATCVPAIAVLVLVSAVMPLSAHHSWPVNNDRLVTVKGKVIEFMWANPHPMIT |
| Ga0105340_11779091 | 3300009610 | Soil | MTMKTLLGVVAVVLALVSVPLAAHHSWPISRAQLVTVKGTVT |
| Ga0116224_101083062 | 3300009683 | Peatlands Soil | MKATCVPAIAVLVLVSAVMPLSAHHSWPVNNDRLVTVKGKVIEFMWGNPHPMIT |
| Ga0105087_11206982 | 3300009819 | Groundwater Sand | MANTLFVSAVILALVFAAVPLSAHHSWPVSYSQLVTVKGTVTE |
| Ga0116223_103768621 | 3300009839 | Peatlands Soil | MKALYVPAIAVLVLVSAVFPLSAHHSWPVNNDRLVTVKGKV |
| Ga0126305_109520192 | 3300010036 | Serpentine Soil | MMRFLFAPAVVILAFVATVAPLSAHHSWPVDMGKLVT |
| Ga0126382_110745191 | 3300010047 | Tropical Forest Soil | VANTLFVSAIVILVVVSAAVPLSAHHSWPVSYSQLVTVKGTVTEF |
| Ga0134111_102731031 | 3300010329 | Grasslands Soil | MKSLLLPVFVILALVHGAVPLSAHHSWPVSLSQLVTVRGTVKEF |
| Ga0134071_101532991 | 3300010336 | Grasslands Soil | VKKTLLVPSIVILALVSAAVPLSAHHSWPVSNSQLV |
| Ga0134071_101678651 | 3300010336 | Grasslands Soil | MKSLLLPVFVILALVRGAVLLSAHHSWPVSLSQLVT |
| Ga0126376_102887292 | 3300010359 | Tropical Forest Soil | MKALCVPAFVVLMLISAIAPLSAHHSWPVSNDRLVTVKGKVIEFMW |
| Ga0126376_129442322 | 3300010359 | Tropical Forest Soil | MKALFVPVVVALALVSGAVALSAHHSWPVSRDQLVTVKGTVMEFAW |
| Ga0126372_113085421 | 3300010360 | Tropical Forest Soil | MKAFSVPAFVILALVSAVVPLSAHHSWPLSYDQLVTVKGTVIE |
| Ga0126377_122712921 | 3300010362 | Tropical Forest Soil | MKGLLVPALVILVLVSAVVPLTAHHSWPVSYERLVTVKGTV |
| Ga0126379_131306392 | 3300010366 | Tropical Forest Soil | MKALSVSAFAILVLISAVVPLSAHHSWPVSYDRLVTVKGTVV |
| Ga0126379_138578531 | 3300010366 | Tropical Forest Soil | MKALWVPVLVVLALVFAAVPLSAHHSWPVSMDRLVTVKGT |
| Ga0136449_1037296791 | 3300010379 | Peatlands Soil | MKAFRVPAFAALALVAAVMPLSAHHSWPVALDRLVTVKGTVIGFLW |
| Ga0134122_101790304 | 3300010400 | Terrestrial Soil | MKTLCVPAFVILTLVTAVMPLSAHHSWPVNFDRLVTVKCKVIEF |
| Ga0137433_12553381 | 3300011440 | Soil | MKALLVLVFVILGLVSAAIPLSAHHSWPVSYSQEVTVKGTVMEF |
| Ga0137431_11072402 | 3300012038 | Soil | VKNTLFVQVIAIALLVAVAPLSAHHSWPVDMSRLVT |
| Ga0137383_106411921 | 3300012199 | Vadose Zone Soil | MKTLGVPAFVILMLVSAVMPLSAHHSWPISHDRLV |
| Ga0137363_111757472 | 3300012202 | Vadose Zone Soil | VASNLFVSGIVIFALVSAAVPWSAHHSWPVSYYQLVTVKGTVTEFMW |
| Ga0137387_104835071 | 3300012349 | Vadose Zone Soil | MKPLLLPVFVILALIRGAVPLSAHHSWPVNLSHLVTVRGT |
| Ga0137386_100083511 | 3300012351 | Vadose Zone Soil | MARRRRATMKALYVPAFVILALVSVVVPLSAHHSWPVSYERL |
| Ga0137371_114524292 | 3300012356 | Vadose Zone Soil | MKSLCVSAFVILALVSAVVPLSAHHSWPLSYDQLVTVKGTVIEFMWAN |
| Ga0157332_10043983 | 3300012511 | Soil | MKALLVPATIALALVLGTVPLLAHHSWPVNMERLVTVKGTVMEFAW |
| Ga0157288_100104803 | 3300012901 | Soil | MNKTMFSSAIVIAVLAAALPISAHHSWPVDMSKLVTVKGTVTEVM |
| Ga0137394_114573561 | 3300012922 | Vadose Zone Soil | VAKTLFVSAISILALVSLTVPVSAHHSWPVNLSQLVTVKGTVTEF |
| Ga0134077_101026671 | 3300012972 | Grasslands Soil | MKSLLLPVFVILALVRGAVPLSAHHSWPVSLSQLVTVRGTVKEFVWGNPHP |
| Ga0157369_118670811 | 3300013105 | Corn Rhizosphere | MKALWVPTFVVLMLVSAVMPLAAHHSWPITYDRLVTVKGT |
| Ga0157378_111656522 | 3300013297 | Miscanthus Rhizosphere | MKALSVSASIVLALVFAVVPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMT |
| Ga0157378_119480432 | 3300013297 | Miscanthus Rhizosphere | MKTLCVPAFVILTLVTAVMPLSAHHSWPVNFDRLVTV |
| Ga0157378_127305802 | 3300013297 | Miscanthus Rhizosphere | MKIVYVPALVILMLVSAGMPLAAHHSWPITYDRLVTVKGKVVDFKWANPHPMMTLEV* |
| Ga0163162_118272161 | 3300013306 | Switchgrass Rhizosphere | MAAGGPTMKALSVPASIFLALACAVMPLAAHHSWPVSNDRLVTVKGKVIEFM |
| Ga0157375_130466882 | 3300013308 | Miscanthus Rhizosphere | MKTTFVQVVAILAVLIASVPLAAHHSWPVSMDRLVTVKGTV |
| Ga0157380_107819681 | 3300014326 | Switchgrass Rhizosphere | MKALLVPVFIILGLVSAAIPLSAHHSWPVSYSQLVTVKGTVMEFAW |
| Ga0182016_107852851 | 3300014493 | Bog | MKVLSVPAWIVFALVAAALPLSAHHSWPVRSDRLVTVKGT |
| Ga0180088_10713291 | 3300014868 | Soil | MKAMFVPALLAIALISGAVPLTAHHSWPVSRAQLVTVKGTVIE |
| Ga0157379_116020891 | 3300014968 | Switchgrass Rhizosphere | MKALCVPAVVVFALVSAVVPLSAHHSWPVSNDRLVTVKGKVIEFMWANPHPM |
| Ga0157376_125183012 | 3300014969 | Miscanthus Rhizosphere | MKTLCVLVILTLVSAVMPLSAHHSWPISSDRLVTVK |
| Ga0134085_101721602 | 3300015359 | Grasslands Soil | MKALCVSAFVILALVSAVVPLSAHHSWPVRYDRLVTVK |
| Ga0132255_1014509371 | 3300015374 | Arabidopsis Rhizosphere | MKALCVPAFVILALVSAVVPLSAHHSWPVNMDRLV |
| Ga0182032_117511282 | 3300016357 | Soil | VAKTLFVSTLVILALVSVSAPLSAHHSWPVGNQLVTVKGTVTEFMWA |
| Ga0182037_108166881 | 3300016404 | Soil | MKSICVSAIVVLAIVSVAVPLSAHHSWPVSYDRLVTVKGT |
| Ga0182039_116845921 | 3300016422 | Soil | MKAIYVPAFVILTLISAAVPLSAHHSWPVSMDRLVTVKGT |
| Ga0134112_101823502 | 3300017656 | Grasslands Soil | MKSLYVPAFVILALVSAVVPLSAHHSWPVINDRLVTVKGTVIEFLWAN |
| Ga0187804_105067531 | 3300018006 | Freshwater Sediment | MKAAWIPALVVVALVSAVVPLSAHHSWPVSYEKLVTVKGKVVDFNWANPHPMM |
| Ga0187772_112820092 | 3300018085 | Tropical Peatland | MKALCVPAFVILALVSAVAPLSAHHSWPVSFDRLV |
| Ga0190268_105748232 | 3300018466 | Soil | MKALLVPVFVILALVSGPVSLSAHHSWPVSYGQLVTVKGTV |
| Ga0190268_105793961 | 3300018466 | Soil | MKTVLVPVLVTLAVVAGAASLSAHHSWPVNMSQLVTVKGTVM |
| Ga0066669_111850791 | 3300018482 | Grasslands Soil | MKALCVPAFVILALVSAVVPLSAHHSWPLSYDQLVTVKGT |
| Ga0066669_119442022 | 3300018482 | Grasslands Soil | MKAIQVTACVMLMLMSAAHSLSAHHSWPVNMSQLVTVQGTVTDFTWAN |
| Ga0182031_13977572 | 3300019787 | Bog | MKAFCVPGFLVLALVSAAVPLSAHHSWPVNMDRLVTVKGKVIQFAWENPHQ |
| Ga0214226_10180202 | 3300020693 | Freshwater | MKKLFLPACLALLLAFAAAPLSAHHSWPVSYDRLVTVKGTVTEVQWA |
| Ga0210380_105580551 | 3300021082 | Groundwater Sediment | MKSLLVFVILALISAAVPLSAHHSWPVNMSQLVTVTGTVKEF |
| Ga0210408_111766901 | 3300021178 | Soil | MKTLCVPAFVMLALVSAVMPLSAHHSWPISYDRLVTVKGTVVEFKWAN |
| Ga0210388_100679663 | 3300021181 | Soil | MKALYLPGIAVLVLVSAVIPLSAHHSWPVNNDRLVTVKGKVIEFMWANPHPMITIEGSSQ |
| Ga0210385_104287131 | 3300021402 | Soil | MKALFVPVSIVVALVAAASPLSAHHSWPVKSDRLVT |
| Ga0210387_102217014 | 3300021405 | Soil | MKVLVVPTFTLLVLVAAAIPLSAHHSWPVKSDRLVTVKGTVIE |
| Ga0210384_114075511 | 3300021432 | Soil | MKTLCVPVFVILTLVSAVMPLSAHHSWPISNDRLVTVKGTIIEFKWA |
| Ga0242657_11343082 | 3300022722 | Soil | VANTLFVSKIVILALVSAAVPLSAHHSWPVSNAQLV |
| Ga0247784_11914752 | 3300023270 | Plant Litter | MKLKYVSAFVVLALVCAAVPVSAHHSWPVSYERLVTVKGKIIEFAWENPHPM |
| Ga0207926_10979922 | 3300025619 | Arctic Peat Soil | MKTLCVPAFVILTLVSAVMPLSAHHSWPVSFDRLVTVKGTVIDFRWAN |
| Ga0207663_100752452 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKASFVPAVVFAIVSAVSPLSAHHSWPVNNNRLVTVK |
| Ga0207657_113188152 | 3300025919 | Corn Rhizosphere | MKALWVPTFVVLMLVSAVMPLAAHHSWPITYDRLVTVKGTVVE |
| Ga0207686_105964152 | 3300025934 | Miscanthus Rhizosphere | MKALLISASVVLALVSAVMPLSAHHSWPVSNDRLVTVK |
| Ga0207686_106329301 | 3300025934 | Miscanthus Rhizosphere | MKALRFPATLVLALVCAVAPLAAHHSWPVSNDRLVT |
| Ga0207709_112160092 | 3300025935 | Miscanthus Rhizosphere | MKALSVPASIVLALVCAVMPLAAHHSWPVSNDRLVTVKGK |
| Ga0207670_111532082 | 3300025936 | Switchgrass Rhizosphere | MKAVDVPVILVLALVAAVIPLSAHHSWPVSNDKLVTVKGKVIEFTWANPH |
| Ga0207669_113523322 | 3300025937 | Miscanthus Rhizosphere | MKSLLVPVFAVLALVPGAAPLSAHHSWPVSFNQLV |
| Ga0207689_108135261 | 3300025942 | Miscanthus Rhizosphere | MKALSVPASIFLALALALVCAVMPLAAHHSWPVSNDRLVTVKGKVIEFMWAN |
| Ga0207689_113869772 | 3300025942 | Miscanthus Rhizosphere | MKTLCVPAFVILTLVSAVMPLAAHHSWPVSFDRLVTVKGTVTEFR |
| Ga0207712_116987482 | 3300025961 | Switchgrass Rhizosphere | MKTLCVPAFVILTLVSAVMPLSAHHSWPVSFDRLVTVKGTVVEFRW |
| Ga0207641_123162381 | 3300026088 | Switchgrass Rhizosphere | MKSLFAPAFVVITLIAAIAPLSAHHAWPVSNDKLVTVKGTVVDF |
| Ga0207648_103760011 | 3300026089 | Miscanthus Rhizosphere | MKALRFPATLVLALVCAVAPLAAHHSWPVSNDRLVTVKGKVIEFMWANPHPMMTVEVQT |
| Ga0207698_117457022 | 3300026142 | Corn Rhizosphere | MKTLCIPALVILTLISVAVPLSAHHSWPVSFDRLVTVKGTVTEFRW |
| Ga0209117_11130632 | 3300027645 | Forest Soil | MKALLAPVFVVLGLVSAAVPLSAHHSWSVNTSRLVTVKGT |
| Ga0209011_10755771 | 3300027678 | Forest Soil | VKALCVPAFVILSLVSAAVPLSAHHSWPVSFDRLVTVKGTV |
| Ga0209167_105006892 | 3300027867 | Surface Soil | MKALRVRAFAVLALVAAVMPLSAHHSWPVALDRLVTVKGTVIGFVWAN |
| Ga0209814_100115273 | 3300027873 | Populus Rhizosphere | MKALLAPAFVILALFSSAVALSAHHSWPISREQLVTVKGTVMEFA |
| Ga0209698_105868921 | 3300027911 | Watersheds | MKAFCVPALVILTLASAAVPLSAHHSWPVSMDRLVTVKGTVIE |
| Ga0268264_119309392 | 3300028381 | Switchgrass Rhizosphere | MMKATLATASVMLMLISAARPLSAHHSWPVNTSQLVTVKGMVTDFTW |
| Ga0268264_122077862 | 3300028381 | Switchgrass Rhizosphere | MKSLLAFVILALTAVAVPLSAHHSWPVNMSQLVTVTGTVKEFAWGNPH |
| Ga0307504_104591431 | 3300028792 | Soil | MKALCVPAFVILALVSAVVPLSAHHSWPVNNERLVTVKGTV |
| Ga0302324_1014109191 | 3300031236 | Palsa | MKALCARAIPALVLVFAVMPLSAHHSWPVSNDHLVT |
| Ga0170818_1120844981 | 3300031474 | Forest Soil | MKVLCVPAFVIFALVSAVLPLSAHHSWPVSYDRLVTVK |
| Ga0302320_100698911 | 3300031524 | Bog | MKAFCVRGFLVLALVSAAVPLSAHHSWPVNMDRLVTVK |
| Ga0310887_111437572 | 3300031547 | Soil | MKCLLVPLVMLALVSGAVPLSAHHAWPVSYAKLVTVKGTV |
| Ga0310886_106619881 | 3300031562 | Soil | MKTLLGVVAVVLALVSVPLAAHHSWPISRAQLVTVKGTVT |
| Ga0310686_1180850431 | 3300031708 | Soil | MKALCIPAIAVLVLVSAVIPLSAHHSWPVNNDRLVTVKGKVIEFMWGN |
| Ga0307476_101597961 | 3300031715 | Hardwood Forest Soil | MKALFVPVSIVVALVAAASPLSAHHSWPVKSDRLVTVKGTV |
| Ga0318501_107291872 | 3300031736 | Soil | MKALFVPAAIVLAFVSAVMPLSAHHSWPVSNSRLVTVKGK |
| Ga0307468_1025103652 | 3300031740 | Hardwood Forest Soil | VAKNLFVSGIVILALVCAAVPVSAHHSWPVSYTQLVTVKGTVTEF |
| Ga0318576_105675512 | 3300031796 | Soil | MKALSVSAFVILALVSAAVPLSAHHSWPVSYDRLMTVKGSVIEFVWANPHPMMTIE |
| Ga0306925_112192071 | 3300031890 | Soil | VKKGAYVPVFVMLTMWSAVVSLSAHHRWPVSYSKLVTVKGTVT |
| Ga0306925_120501511 | 3300031890 | Soil | MKSICVSAIVVLAIVSVAVPLSAHHSWPVSYDRLVT |
| Ga0318536_103988901 | 3300031893 | Soil | MRVLLASVLVILAVVSGAVPLSAHHSWPVSTSRLVTVKGTV |
| Ga0302322_1015976241 | 3300031902 | Fen | MKTLCVPAFVILTLVSAVNPLSAHHSWPINSDRLVTVKGT |
| Ga0308175_1011312531 | 3300031938 | Soil | MKTLFSPVVAILTLVAASASLSAHHSWPVNMDRLVTVKG |
| Ga0310903_100280401 | 3300032000 | Soil | MKALLVPATIALALVLGTVPLLAHHSWPVNMERLV |
| Ga0310903_100901161 | 3300032000 | Soil | MKDLFVSVLVLLALISGAVPLSAHHSWPVNQSQLVTVKGTVVE |
| Ga0310895_107521512 | 3300032122 | Soil | MKCLRVLVVVLTLVTGAVPLSAHHAWPVSYAQLVTVKGT |
| Ga0307471_1002281711 | 3300032180 | Hardwood Forest Soil | MKALCVPAFVILALVSAVVPLSAHHSWPLSYDQLVTVKGTVIE |
| Ga0335085_1000823618 | 3300032770 | Soil | MNALRFAAFVLLGLAAAVTPLSAHHSWPVAYDHLVTVKGRVVDFVWANPHPMITL |
| Ga0335084_117055642 | 3300033004 | Soil | MMKTLCVPAFVILALVSVVMPLSAHHSWPVSFDRLV |
| ⦗Top⦘ |