


| Basic Information | |
|---|---|
| Family ID | F034999 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RSAHQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.05 % |
| % of genes near scaffold ends (potentially truncated) | 94.80 % |
| % of genes from short scaffolds (< 2000 bps) | 89.60 % |
| Associated GOLD sequencing projects | 151 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.607 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.809 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.775 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF12900 | Pyridox_ox_2 | 20.23 |
| PF02852 | Pyr_redox_dim | 5.20 |
| PF00440 | TetR_N | 2.89 |
| PF07992 | Pyr_redox_2 | 2.31 |
| PF02274 | ADI | 1.73 |
| PF12680 | SnoaL_2 | 1.16 |
| PF13545 | HTH_Crp_2 | 1.16 |
| PF06253 | MTTB | 1.16 |
| PF00483 | NTP_transferase | 1.16 |
| PF13185 | GAF_2 | 1.16 |
| PF00072 | Response_reg | 0.58 |
| PF00294 | PfkB | 0.58 |
| PF04255 | DUF433 | 0.58 |
| PF00190 | Cupin_1 | 0.58 |
| PF01541 | GIY-YIG | 0.58 |
| PF00196 | GerE | 0.58 |
| PF00149 | Metallophos | 0.58 |
| PF13847 | Methyltransf_31 | 0.58 |
| PF03308 | MeaB | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF04075 | F420H2_quin_red | 0.58 |
| PF00107 | ADH_zinc_N | 0.58 |
| PF12732 | YtxH | 0.58 |
| PF01546 | Peptidase_M20 | 0.58 |
| PF05721 | PhyH | 0.58 |
| PF04966 | OprB | 0.58 |
| PF13180 | PDZ_2 | 0.58 |
| PF13620 | CarboxypepD_reg | 0.58 |
| PF09346 | SMI1_KNR4 | 0.58 |
| PF01435 | Peptidase_M48 | 0.58 |
| PF14559 | TPR_19 | 0.58 |
| PF09825 | BPL_N | 0.58 |
| PF08327 | AHSA1 | 0.58 |
| PF02661 | Fic | 0.58 |
| PF00722 | Glyco_hydro_16 | 0.58 |
| PF16640 | Big_3_5 | 0.58 |
| PF13546 | DDE_5 | 0.58 |
| PF01479 | S4 | 0.58 |
| PF01894 | UPF0047 | 0.58 |
| PF07589 | PEP-CTERM | 0.58 |
| PF13649 | Methyltransf_25 | 0.58 |
| PF12704 | MacB_PCD | 0.58 |
| PF02687 | FtsX | 0.58 |
| PF00905 | Transpeptidase | 0.58 |
| PF02146 | SIR2 | 0.58 |
| PF07311 | Dodecin | 0.58 |
| PF00009 | GTP_EFTU | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF00561 | Abhydrolase_1 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 1.73 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 1.73 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 1.73 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 1.16 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.58 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.58 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.58 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.58 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.88 % |
| Unclassified | root | N/A | 23.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001166|JGI12694J13545_1017392 | Not Available | 693 | Open in IMG/M |
| 3300001174|JGI12679J13547_1002410 | Not Available | 1021 | Open in IMG/M |
| 3300001593|JGI12635J15846_10436256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300004082|Ga0062384_100623210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300004092|Ga0062389_100007254 | All Organisms → cellular organisms → Bacteria | 6901 | Open in IMG/M |
| 3300004152|Ga0062386_101182047 | Not Available | 635 | Open in IMG/M |
| 3300005439|Ga0070711_100785754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300005541|Ga0070733_10905187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005559|Ga0066700_10551047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300005602|Ga0070762_11322464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005764|Ga0066903_100781286 | Not Available | 1703 | Open in IMG/M |
| 3300006046|Ga0066652_101943443 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006052|Ga0075029_100482759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300006059|Ga0075017_101649611 | Not Available | 506 | Open in IMG/M |
| 3300006176|Ga0070765_101253899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300006354|Ga0075021_10048399 | All Organisms → cellular organisms → Bacteria | 2454 | Open in IMG/M |
| 3300006354|Ga0075021_10113436 | Not Available | 1617 | Open in IMG/M |
| 3300006893|Ga0073928_10016824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7813 | Open in IMG/M |
| 3300006893|Ga0073928_10961711 | Not Available | 583 | Open in IMG/M |
| 3300007258|Ga0099793_10662779 | Not Available | 525 | Open in IMG/M |
| 3300007788|Ga0099795_10635895 | Not Available | 510 | Open in IMG/M |
| 3300009038|Ga0099829_10463974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300009038|Ga0099829_11349374 | Not Available | 589 | Open in IMG/M |
| 3300009519|Ga0116108_1260453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009524|Ga0116225_1058234 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300009545|Ga0105237_10456829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300009548|Ga0116107_1093573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300009616|Ga0116111_1132702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009616|Ga0116111_1136375 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009616|Ga0116111_1150771 | Not Available | 552 | Open in IMG/M |
| 3300009628|Ga0116125_1177769 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009629|Ga0116119_1059419 | Not Available | 981 | Open in IMG/M |
| 3300009632|Ga0116102_1080074 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300009643|Ga0116110_1230292 | Not Available | 596 | Open in IMG/M |
| 3300009683|Ga0116224_10385127 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009700|Ga0116217_10601959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300009824|Ga0116219_10703737 | Not Available | 552 | Open in IMG/M |
| 3300010048|Ga0126373_11789541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300010343|Ga0074044_10312004 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300010358|Ga0126370_11744783 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010362|Ga0126377_10141815 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300010379|Ga0136449_100175502 | All Organisms → cellular organisms → Bacteria | 4137 | Open in IMG/M |
| 3300011120|Ga0150983_15178414 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300011269|Ga0137392_10992091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012096|Ga0137389_10792886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300012198|Ga0137364_10834142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300012199|Ga0137383_10191407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300012201|Ga0137365_11320110 | Not Available | 511 | Open in IMG/M |
| 3300012202|Ga0137363_11167829 | Not Available | 655 | Open in IMG/M |
| 3300012203|Ga0137399_10629390 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012205|Ga0137362_10376877 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012207|Ga0137381_10432318 | Not Available | 1149 | Open in IMG/M |
| 3300012207|Ga0137381_11733953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012209|Ga0137379_11522304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012354|Ga0137366_10970660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012356|Ga0137371_10558254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300012362|Ga0137361_11184700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300012363|Ga0137390_11524457 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012918|Ga0137396_10431697 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012918|Ga0137396_10540056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300012923|Ga0137359_10014578 | All Organisms → cellular organisms → Bacteria | 6612 | Open in IMG/M |
| 3300012925|Ga0137419_10957601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300012927|Ga0137416_10501338 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012951|Ga0164300_10682924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012971|Ga0126369_10533903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300012989|Ga0164305_11536878 | Not Available | 592 | Open in IMG/M |
| 3300014162|Ga0181538_10196289 | Not Available | 1135 | Open in IMG/M |
| 3300014164|Ga0181532_10688627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300014169|Ga0181531_10193238 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300014200|Ga0181526_10397660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300014489|Ga0182018_10016358 | All Organisms → cellular organisms → Bacteria | 5036 | Open in IMG/M |
| 3300014495|Ga0182015_10157057 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300014498|Ga0182019_11296927 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014502|Ga0182021_12089339 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300014502|Ga0182021_13139738 | Not Available | 552 | Open in IMG/M |
| 3300014839|Ga0182027_11964072 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300015245|Ga0137409_11361645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 554 | Open in IMG/M |
| 3300015262|Ga0182007_10115052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300015373|Ga0132257_103306017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300017822|Ga0187802_10198830 | Not Available | 770 | Open in IMG/M |
| 3300017822|Ga0187802_10367373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017935|Ga0187848_10388091 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300017943|Ga0187819_10184557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300017943|Ga0187819_10377675 | Not Available | 816 | Open in IMG/M |
| 3300018012|Ga0187810_10403804 | Not Available | 575 | Open in IMG/M |
| 3300018014|Ga0187860_1065457 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300018017|Ga0187872_10070886 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300018022|Ga0187864_10145686 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300018025|Ga0187885_10138970 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018038|Ga0187855_10586838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300018047|Ga0187859_10477776 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300018482|Ga0066669_11186054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300019888|Ga0193751_1151118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300020010|Ga0193749_1056848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300020579|Ga0210407_10076631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2516 | Open in IMG/M |
| 3300020581|Ga0210399_10932787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300020583|Ga0210401_10048482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4014 | Open in IMG/M |
| 3300021088|Ga0210404_10748339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300021180|Ga0210396_10057275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3562 | Open in IMG/M |
| 3300021403|Ga0210397_10941184 | Not Available | 669 | Open in IMG/M |
| 3300021407|Ga0210383_10727202 | Not Available | 852 | Open in IMG/M |
| 3300021432|Ga0210384_10793470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300021432|Ga0210384_10863075 | Not Available | 804 | Open in IMG/M |
| 3300021433|Ga0210391_10755400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300021560|Ga0126371_10102375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2855 | Open in IMG/M |
| 3300022515|Ga0224546_1003559 | Not Available | 965 | Open in IMG/M |
| 3300022557|Ga0212123_10009176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14642 | Open in IMG/M |
| 3300022557|Ga0212123_10169024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1662 | Open in IMG/M |
| 3300022721|Ga0242666_1072734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300023056|Ga0233357_1026898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300023250|Ga0224544_1005563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300024225|Ga0224572_1007417 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300025500|Ga0208686_1069263 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025509|Ga0208848_1057866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300025619|Ga0207926_1120721 | Not Available | 617 | Open in IMG/M |
| 3300025914|Ga0207671_10491734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300025922|Ga0207646_10239969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1637 | Open in IMG/M |
| 3300026322|Ga0209687_1107038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300026355|Ga0257149_1053351 | Not Available | 585 | Open in IMG/M |
| 3300026474|Ga0247846_1039777 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Tuwongella → Tuwongella immobilis | 841 | Open in IMG/M |
| 3300026557|Ga0179587_10100556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1750 | Open in IMG/M |
| 3300027604|Ga0208324_1055032 | Not Available | 1153 | Open in IMG/M |
| 3300027610|Ga0209528_1017864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300027629|Ga0209422_1069961 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027645|Ga0209117_1032550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 1619 | Open in IMG/M |
| 3300027678|Ga0209011_1087511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300027846|Ga0209180_10522675 | Not Available | 663 | Open in IMG/M |
| 3300027894|Ga0209068_10087802 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300027894|Ga0209068_10088481 | Not Available | 1620 | Open in IMG/M |
| 3300027915|Ga0209069_10550794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300028017|Ga0265356_1019400 | Not Available | 735 | Open in IMG/M |
| 3300028021|Ga0265352_1010092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300028678|Ga0302165_10035711 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300028736|Ga0302214_1003871 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
| 3300028765|Ga0302198_10217679 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300028780|Ga0302225_10445283 | Not Available | 607 | Open in IMG/M |
| 3300028859|Ga0302265_1125952 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300028909|Ga0302200_10121548 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300029882|Ga0311368_10610157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum | 767 | Open in IMG/M |
| 3300029910|Ga0311369_10064285 | All Organisms → cellular organisms → Bacteria | 3894 | Open in IMG/M |
| 3300029939|Ga0311328_10588879 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300029944|Ga0311352_10923450 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300029952|Ga0311346_10776701 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300030058|Ga0302179_10020141 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300030114|Ga0311333_10474859 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300030230|Ga0302207_1084787 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300030399|Ga0311353_10195118 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300030760|Ga0265762_1024664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300030862|Ga0265753_1062627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031090|Ga0265760_10068006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300031233|Ga0302307_10247160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300031234|Ga0302325_10673022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum | 1500 | Open in IMG/M |
| 3300031236|Ga0302324_100634143 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300031249|Ga0265339_10609267 | Not Available | 500 | Open in IMG/M |
| 3300031258|Ga0302318_10596218 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031259|Ga0302187_10306255 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031261|Ga0302140_10397255 | Not Available | 1114 | Open in IMG/M |
| 3300031474|Ga0170818_108835518 | Not Available | 827 | Open in IMG/M |
| 3300031525|Ga0302326_10206325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3271 | Open in IMG/M |
| 3300031711|Ga0265314_10061802 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300031711|Ga0265314_10709047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031715|Ga0307476_10125824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1828 | Open in IMG/M |
| 3300031718|Ga0307474_10820899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300031740|Ga0307468_102146081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031753|Ga0307477_10712965 | Not Available | 670 | Open in IMG/M |
| 3300031754|Ga0307475_10736890 | Not Available | 784 | Open in IMG/M |
| 3300031962|Ga0307479_10296305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1599 | Open in IMG/M |
| 3300031962|Ga0307479_11959637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300032160|Ga0311301_12024182 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300032163|Ga0315281_11082835 | Not Available | 807 | Open in IMG/M |
| 3300033134|Ga0335073_11480780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300033405|Ga0326727_10934056 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300033755|Ga0371489_0242686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.05% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.31% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.31% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.73% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.73% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.16% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.16% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.16% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030230 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12694J13545_10173922 | 3300001166 | Forest Soil | LQEKIGEHPEISAAITKLEMALNDLPIQTAARTSTS |
| JGI12679J13547_10024101 | 3300001174 | Forest Soil | EAHIAAAHQILKALQEKIGEHPEIGAAITKLEMALNVLAIKTGGLL* |
| JGI12635J15846_104362561 | 3300001593 | Forest Soil | IKSAHQMLKTLQQKIGDHPEIGAAITKLEMALNVLAVQTGGLL* |
| Ga0062384_1006232102 | 3300004082 | Bog Forest Soil | NPATEHVAGAHKILKELQQKVGEHPELGEAITKLEMALNSLALQTGGFL* |
| Ga0062389_1000072546 | 3300004092 | Bog Forest Soil | VASAHKILKELQKKVGAHPELGEAITKLEAALNILAIKTGGLL* |
| Ga0062386_1011820472 | 3300004152 | Bog Forest Soil | QAAEHVASAHRILKELQQKVGDHPELGEAITKLEMALNFLAIKTGGFL* |
| Ga0070711_1007857541 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SAQQILKALQEKIGEHPEIGEAITKLEMALNVLAIKTGGLL* |
| Ga0070733_109051871 | 3300005541 | Surface Soil | AHQILKALQEKIGEHPEIGAAITKLEMALNDLAVQTGGIW* |
| Ga0066700_105510472 | 3300005559 | Soil | VASAHQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0070762_113224642 | 3300005602 | Soil | AEKHIKSAHQMLKTLQQKIGDHPEIGAAITKLEMALNVLAVQTGGLL* |
| Ga0066903_1007812862 | 3300005764 | Tropical Forest Soil | AHVAAAHQILKGLQEKIGQHPEIGAAITKLEMALNVIAIKTGGLL* |
| Ga0066652_1019434432 | 3300006046 | Soil | LKALQEKIGEHPEIGAAITKLEMALNVLAIQTGGLL* |
| Ga0075029_1004827592 | 3300006052 | Watersheds | SAHQILKALQEKIGEHPEIGAAITKLEMALNVLAVQTNCLL* |
| Ga0075017_1016496111 | 3300006059 | Watersheds | PNEAAEHVASAQKILKELQQKAGSHPEIGEAITKLEMALNILAVQTGGLL* |
| Ga0070765_1012538992 | 3300006176 | Soil | LKTLQQKIGDHPEIGAAITKLEMALNVLAVQTGGLL* |
| Ga0075021_100483991 | 3300006354 | Watersheds | AQAAEHVASARKLLQELQQRVGTHPELGEAITKLEMALNSLAIRTGGLL* |
| Ga0075021_101134361 | 3300006354 | Watersheds | LKALQEKIGEHPELGAAITKLEMALNILAVKTAGML* |
| Ga0073928_1001682412 | 3300006893 | Iron-Sulfur Acid Spring | VAVDFGPDARQILNALQEKIGEHPEIGAAIAKLEMALNDLAMQTGGLL* |
| Ga0073928_109617112 | 3300006893 | Iron-Sulfur Acid Spring | LLKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0099793_106627791 | 3300007258 | Vadose Zone Soil | KDLQKKVGDHPELREAITKLEMALNNLAIQTGGLL* |
| Ga0099795_106358952 | 3300007788 | Vadose Zone Soil | HQILKDLQKKVGDHPELGEAITKLEMALNNLAVQTGGLL* |
| Ga0099829_104639741 | 3300009038 | Vadose Zone Soil | ILNALQEKIGKHPEIGAAITKLEMALNVLEVKTGGLL* |
| Ga0099829_113493741 | 3300009038 | Vadose Zone Soil | HQILKDLQKKVGDHPELGEAITKLEMALNSLAIQTGGLL* |
| Ga0116108_12604531 | 3300009519 | Peatland | ILEALQEKIGEHPELGAAITKLEMALNILAVKTGGLL* |
| Ga0116225_10582341 | 3300009524 | Peatlands Soil | ELQQKVGNHPELGEAITKLEMALNTLAVKTGGLL* |
| Ga0105237_104568291 | 3300009545 | Corn Rhizosphere | AQEILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0116107_10935731 | 3300009548 | Peatland | QILKALQEKIGKHPELGAAITKLEMALNVLAVKTGGML* |
| Ga0116111_11327021 | 3300009616 | Peatland | HQILKALQEKIGKHPELGAAITKLEMALNVLAVKTGGML* |
| Ga0116111_11363752 | 3300009616 | Peatland | EHVASAHKILKDLQQKVGDHPELREDITKLEMALNILAIKTGGLL* |
| Ga0116111_11507711 | 3300009616 | Peatland | KDLQQKLGNHPELGEAITKLEMALSTLAVRTGGLL* |
| Ga0116125_11777692 | 3300009628 | Peatland | SAHKILKELQKKVGNHPELGEAITKLEMALSTLAIKTGGLL* |
| Ga0116119_10594192 | 3300009629 | Peatland | ASAHKILKDLQQKVGDHPELREAITKLEMALNILAIKTGGLL* |
| Ga0116102_10800741 | 3300009632 | Peatland | KELQQKVGDHPELREAITKLEMALNILAIKTGGLL* |
| Ga0116110_12302921 | 3300009643 | Peatland | TEAAEHVASAHKILKDLQQKLGNHPELGEAITKLEMALSTLAVRTGGLL* |
| Ga0116224_103851271 | 3300009683 | Peatlands Soil | VQAAEHVASAHKILKELQKKVGNHPELGEAITKLEMALSTLAIKTGGML* |
| Ga0116217_106019591 | 3300009700 | Peatlands Soil | ALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0116219_107037372 | 3300009824 | Peatlands Soil | ELQQKLGNHPELGEAITKLEMALNTLAVKTGGLL* |
| Ga0126373_117895411 | 3300010048 | Tropical Forest Soil | HEILNDLQAKIGEHPELATAINKLEMALSILAVQTGGLL* |
| Ga0074044_103120041 | 3300010343 | Bog Forest Soil | EEAAVHIASARQILNTLQEKIGQHPELGVAITKLEIALNILAVKTGGLL* |
| Ga0126370_117447832 | 3300010358 | Tropical Forest Soil | RSAHEILKALQKKIGEHPEIGAAITKLEMALNDLAIQTGGVL* |
| Ga0126377_101418153 | 3300010362 | Tropical Forest Soil | LKALQDRIGQHPELGEAITKLEMALNSLTIKTGGML* |
| Ga0136449_1001755025 | 3300010379 | Peatlands Soil | ILKELQQKVGNHPELGEAITKLEMALNSLAIRTGGLL* |
| Ga0150983_151784142 | 3300011120 | Forest Soil | LKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0137392_109920913 | 3300011269 | Vadose Zone Soil | QAAAHVASAHEILKTLQGKIGEHPELGAAITKLEMALNDLAIQTGGML* |
| Ga0137389_107928861 | 3300012096 | Vadose Zone Soil | AHIAGAQQILKALQEKIGEHPEIGAAITKLEMALNALAIQTGGLL* |
| Ga0137364_108341421 | 3300012198 | Vadose Zone Soil | KAAEHVASAREILKTLQEKLGEHPELGAAITRLEMALNDLAIQTGGML* |
| Ga0137383_101914072 | 3300012199 | Vadose Zone Soil | ASAHEILNALQEKIGKHPEIAAAITKLEMALNVLTIKTGALL* |
| Ga0137365_113201101 | 3300012201 | Vadose Zone Soil | IASAHEILNALQEKIGKHPEIGAAITKLEIALNILTIKTGALL* |
| Ga0137363_111678291 | 3300012202 | Vadose Zone Soil | ILNALQEKIGKHPEIGAAITKLEMALNVLTIKTGALL* |
| Ga0137399_106293903 | 3300012203 | Vadose Zone Soil | LKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0137362_103768773 | 3300012205 | Vadose Zone Soil | HQILKDLQQKVGNHPELGEAITKLEMALNILAVQTGGLL* |
| Ga0137381_104323181 | 3300012207 | Vadose Zone Soil | EILNALQEKIGKHPEIGAAITKLEMALNVLTIKTGALL* |
| Ga0137381_117339531 | 3300012207 | Vadose Zone Soil | ALQEKIGKHPEIGAAITKLEMALNVLTIKTGALL* |
| Ga0137379_115223041 | 3300012209 | Vadose Zone Soil | HIASAQQLLKTLQKKIGEHPEIGAAITKLEMALNVLGIETGGLL* |
| Ga0137366_109706601 | 3300012354 | Vadose Zone Soil | RSAHQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0137371_105582541 | 3300012356 | Vadose Zone Soil | ALQEKIGEHPELGAAITKLEMALNDLAIQTGGML* |
| Ga0137361_111847002 | 3300012362 | Vadose Zone Soil | HQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0137390_115244571 | 3300012363 | Vadose Zone Soil | AQAKTHIASAQQILNALQEKIGKHPEIGAAITKLEMALNVLEIKTGGLL* |
| Ga0137396_104316973 | 3300012918 | Vadose Zone Soil | KHVASAHQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0137396_105400561 | 3300012918 | Vadose Zone Soil | AGAAEHIASARQILTALQEKIGQHPELGAAITKLEMALNDLAIQTGGML* |
| Ga0137359_100145783 | 3300012923 | Vadose Zone Soil | VTGAADHIASAHQILKALEEKMGEHPEIGAAITKLEMALNDLAIQTGGML* |
| Ga0137419_109576011 | 3300012925 | Vadose Zone Soil | IASARQILTALQEKIGQHPELGAAITKLEMALNDLAIQTGGML* |
| Ga0137416_105013383 | 3300012927 | Vadose Zone Soil | SAHQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL* |
| Ga0164300_106829242 | 3300012951 | Soil | AQAAAHIASAHKILKALQEKIGEHPELGAAITKLEMALNDLAVQTGGML* |
| Ga0126369_105339032 | 3300012971 | Tropical Forest Soil | ASAHQILKAMQGKIGEHPEIGAAITKLEMALNDLAVQTGGLW* |
| Ga0164305_115368782 | 3300012989 | Soil | LKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGIL* |
| Ga0181538_101962891 | 3300014162 | Bog | AHKILKDLQQKVGNHPELGEAITKLETALNILAIKTGGLL* |
| Ga0181532_106886271 | 3300014164 | Bog | KILRALQEKIGEHPEIGAAITRLELALNDLAIQTGGLL* |
| Ga0181531_101932381 | 3300014169 | Bog | ALVRSAHQILVALRERIELHPEIGAAITKLEMALNVLAVETGGIL* |
| Ga0181526_103976601 | 3300014200 | Bog | IRSAQQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0182018_100163581 | 3300014489 | Palsa | ELQQRVGSHPELGEAITKLEMALNILAVQTGGLL* |
| Ga0182015_101570571 | 3300014495 | Palsa | VASAHKLLTELQQRVGSHPELGEAITKLEMALNILAVQTGGLL* |
| Ga0182019_112969272 | 3300014498 | Fen | VASAHQILKDLQPKVGNHPELGEAITKLEMALNILAIKTGGLL* |
| Ga0182021_120893391 | 3300014502 | Fen | AHQILKDLQPKVGNHPELGEAITKLEMALNILAIKTGGLL* |
| Ga0182021_131397382 | 3300014502 | Fen | HKILKDLQPKVGNHPELGEAITKLEMALNILAIKTGGLL* |
| Ga0182027_119640722 | 3300014839 | Fen | ASAHQILKDLQQKVGDHPELREAITKLEMALNILAIKTGGLL* |
| Ga0137409_113616451 | 3300015245 | Vadose Zone Soil | LKALHDEAGRHPEIGAAITKLEMALNLLAVKTGGLL* |
| Ga0182007_101150522 | 3300015262 | Rhizosphere | VLEILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL* |
| Ga0132257_1033060172 | 3300015373 | Arabidopsis Rhizosphere | DTAKAAAHIAGAHQILKELQEKLGEHPEIGAAITKLEMALNDLAVQTGGIW* |
| Ga0187802_101988301 | 3300017822 | Freshwater Sediment | AHKILKELQQKLGHHPELGEAITKLETALNILAIKTGGLL |
| Ga0187802_103673731 | 3300017822 | Freshwater Sediment | ILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0187848_103880912 | 3300017935 | Peatland | PIQAAEHVASAHQILKELQQKVGNHPELGEAITKLEMALSSLALQTGGLL |
| Ga0187819_101845571 | 3300017943 | Freshwater Sediment | ILKALQKKIGEHPEIGAAITKLEMALNVLAVETGGML |
| Ga0187819_103776752 | 3300017943 | Freshwater Sediment | AEHVASAHQILKELQQKVGNHPELGEAITKLEMALNILALQTGGLL |
| Ga0187810_104038041 | 3300018012 | Freshwater Sediment | QAAEHVASAHKILKELQQKVGHHPELGEAITKLETALNILAIKTGGLL |
| Ga0187860_10654571 | 3300018014 | Peatland | QAAEHVASAQKILKDLQKKAGSHPELGEAITKLEMALSTLAVRTGGLL |
| Ga0187872_100708861 | 3300018017 | Peatland | AQKILKDLQKKAGSHPELGEAITKLEMALNILAVQTGGLL |
| Ga0187864_101456862 | 3300018022 | Peatland | AEHVASAHKIQKELQKKVGNHPELGEAITKLEMALSTLAVRTGGLL |
| Ga0187885_101389701 | 3300018025 | Peatland | AAEHVASAHKILKDLQQKVGDHPELREAITKLEMALNILAIKTGGLL |
| Ga0187855_105868381 | 3300018038 | Peatland | EAHINGAHQILKTLQEKIGQHPEIGAAITRLEMALNVLAVQTGGVL |
| Ga0187859_104777762 | 3300018047 | Peatland | AEHVASAHKILKELQKKVGNHPELGEAITKLEMALSTLAVRTGGLL |
| Ga0066669_111860541 | 3300018482 | Grasslands Soil | DSTKAAEHVASAREILKTLQEKLGEHPELGAAITRLEMALNDLAIQTGGML |
| Ga0193751_11511182 | 3300019888 | Soil | DHNNAAEHVASAHKLLKELQKKAGTHPELGEAITKLEMALNILAIQTGGLL |
| Ga0193749_10568481 | 3300020010 | Soil | HQILQSLQKKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0210407_100766311 | 3300020579 | Soil | PATAEEHIKSAQQILKALQEKIGKHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0210399_109327871 | 3300020581 | Soil | ILKALQEEIGEHPELGAAILKLEMALNILTIKTGGLL |
| Ga0210401_100484823 | 3300020583 | Soil | VLSRFLKALQEKIGKHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0210404_107483391 | 3300021088 | Soil | QTEVEAHIKSAHQILKALQKREKKIGEHPEIDAAITKLEMALNDLAIQTGGLL |
| Ga0210396_100572755 | 3300021180 | Soil | KALQEKIGKHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0210397_109411843 | 3300021403 | Soil | SAHQILRALQEKIGEHPEIGAAITKLEMALSDLAIQTGGLL |
| Ga0210383_107272022 | 3300021407 | Soil | EAAEHVASARTILQELQKKVGTHPELGEAITKLEMALNLLAVQTGGLL |
| Ga0210384_107934701 | 3300021432 | Soil | LKALQGKIGQHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0210384_108630752 | 3300021432 | Soil | VQAAKHVASAHQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL |
| Ga0210391_107554002 | 3300021433 | Soil | LKTLQQKIGDHPEIGAAITKLEMALNVLAVQTGGLL |
| Ga0126371_101023751 | 3300021560 | Tropical Forest Soil | KALQEKIGQHPEIGAAITRLEMALNDLAIQTGGVL |
| Ga0224546_10035593 | 3300022515 | Soil | AQAAVHISRAHQILKVLEEKIGTHPELGAAITKLEMALNILSIKTGGML |
| Ga0212123_1000917614 | 3300022557 | Iron-Sulfur Acid Spring | VAVDFGPDARQILNALQEKIGEHPEIGAAIAKLEMALNDLAMQTGGLL |
| Ga0212123_101690244 | 3300022557 | Iron-Sulfur Acid Spring | TQAEAHIKSAHQILKTLQEKMGEHPEIGAAITKLEMALNDLAVGTGGLL |
| Ga0242666_10727342 | 3300022721 | Soil | LKALQERIGKHPELGAAITKLEMALNTLAVKTGGML |
| Ga0233357_10268982 | 3300023056 | Soil | AAQIAGAHQILKALQEKIGEHPEIGAAITKLEMALNILAVKTGGLL |
| Ga0224544_10055634 | 3300023250 | Soil | RILKELQQKVGEHPELGEAITKLEMALNSLAVQTGGLL |
| Ga0224572_10074173 | 3300024225 | Rhizosphere | AHRILKALQEKIGPHPEIGAAITKLEMALNVLAIQTGGLL |
| Ga0208686_10692632 | 3300025500 | Peatland | VEHVASAHKILKELQQKVGDHPELREAITKLEMALNILAIKTGGLL |
| Ga0208848_10578662 | 3300025509 | Arctic Peat Soil | ILKTLQAKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0207926_11207211 | 3300025619 | Arctic Peat Soil | VASAHKILKGLQEKVGDHPELGEAITKLEMALNILAIQTGGLL |
| Ga0207671_104917342 | 3300025914 | Corn Rhizosphere | EILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0207646_102399693 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEHIASAHQILKDLQQKVGNHPELGEAITKLEMALNSLAIRTGGLL |
| Ga0209687_11070382 | 3300026322 | Soil | QILKDLQEKMGEHPELGAAITKLEMALNILAVQTGGML |
| Ga0257149_10533511 | 3300026355 | Soil | LKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL |
| Ga0247846_10397771 | 3300026474 | Soil | ILKELQKKVGDHPELGEAITRLEMALNSLAIKTGGLL |
| Ga0179587_101005561 | 3300026557 | Vadose Zone Soil | VQAAKHVASAHQILKDLQKKVGHHPELGEAITKLEMALNNLAIQTGGLL |
| Ga0208324_10550321 | 3300027604 | Peatlands Soil | PVQAAEHVASAHKILKELQQKLGNHPELGEAITKLEMALNTLAVKTGGLL |
| Ga0209528_10178641 | 3300027610 | Forest Soil | QAAKHVASAHQILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL |
| Ga0209422_10699611 | 3300027629 | Forest Soil | YKILKEIQQRAGVHPELGEAITKLEMALNILAIKTGGLL |
| Ga0209117_10325504 | 3300027645 | Forest Soil | EHVARAHQILKGLQEKVGDHPELGEAITKLEMALNILAIQTGGLL |
| Ga0209011_10875111 | 3300027678 | Forest Soil | ILKDLQKKVGDHPELGEAITKLEMALNNLAIQTGGLL |
| Ga0209180_105226751 | 3300027846 | Vadose Zone Soil | ILNALQDKIGHHPEIGAAITKLEMALNILAVKTGGLL |
| Ga0209068_100878021 | 3300027894 | Watersheds | AQAAEHVASARKLLQELQQRVGTHPELGEAITKLEMALNSLAIRTGGLL |
| Ga0209068_100884812 | 3300027894 | Watersheds | LKALQEKIGEHPELGAAITKLEMALNILAVKTAGML |
| Ga0209069_105507942 | 3300027915 | Watersheds | ILKALQEKIGAHPELGAAITKLEMALNDLAIQTGGML |
| Ga0265356_10194002 | 3300028017 | Rhizosphere | MNRGRSAHQEAQQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0265352_10100922 | 3300028021 | Soil | AEAHIKSAQQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0302165_100357113 | 3300028678 | Fen | AHVASAQQILKSLQEKIGEHPELGAAITRLEMALNILAVQTGGML |
| Ga0302214_10038714 | 3300028736 | Fen | HVASAQQILKSLQEKIGEHPELGAAITRLEMALNILAVQTGGML |
| Ga0302198_102176792 | 3300028765 | Bog | AVTHIKSAHQILKALQETMGKHPEIGAAITKLEMALNDLAVQTGGVL |
| Ga0302225_104452831 | 3300028780 | Palsa | ASAHQILKTLQEKIGQHPELGAALTKLETALNILAVKTGGML |
| Ga0302265_11259521 | 3300028859 | Bog | GAKKLLQELQQKTGSHPELGEAITKLELALNVLGINTGGLL |
| Ga0302200_101215483 | 3300028909 | Bog | ISGAKKLLQELQQKTGSHPELGEAITKLELALNVLGINTGGLL |
| Ga0311368_106101572 | 3300029882 | Palsa | ASAHKLLTELQQRVGSHPELGEAITKLEMALNILAVQTGGLL |
| Ga0311369_100642854 | 3300029910 | Palsa | HELLTELQQRVGSHPELGEAITKLEMALNILAVQTGGLL |
| Ga0311328_105888792 | 3300029939 | Bog | SAHQILQALQEQLGKHPELGAAITKLEMALNILAVKTGGVL |
| Ga0311352_109234502 | 3300029944 | Palsa | IRSAHQILKALQEKIGEHPEIGSAITKLEMALNDLAIQTGGLL |
| Ga0311346_107767012 | 3300029952 | Bog | LKALQETMGKHPEIGAAITKLEMALNDLAVQTGGVL |
| Ga0302179_100201411 | 3300030058 | Palsa | HVASAHRILKELQQKAGEHPELGEAITKLEMALNSLAVQTGGLL |
| Ga0311333_104748591 | 3300030114 | Fen | AQQILKTLQAKIGEHPELGAAITKLEMALNDLAIQTGGML |
| Ga0302207_10847872 | 3300030230 | Fen | VASAQQILKSLQEKIGEHPELGAAITRLEMALNILAVQTGGML |
| Ga0311353_101951181 | 3300030399 | Palsa | AEVHIRSAHQILKALQEKIGEHPEIGSAITKLEMALNDLAIQTGGLL |
| Ga0265762_10246642 | 3300030760 | Soil | MLKTLQQKIGDHPEIGAAITKLEMALNVLAVQTGGLL |
| Ga0265753_10626271 | 3300030862 | Soil | AQIAGAHQILKALQEKIGEHPEIGAAITKLEMALNILAVKTGGLL |
| Ga0265760_100680061 | 3300031090 | Soil | EILKALQEKLGQHPELGAAITKLEMALNLLAVKTGGIL |
| Ga0302307_102471601 | 3300031233 | Palsa | EAAKHIKSAHQILETLQQKIGKHPEIGAAITKLEMALNVLAVQTGGLL |
| Ga0302325_106730224 | 3300031234 | Palsa | HVASAHKLLTELQQRVGSHPELGEAITKLEMALNILAVQTGGLL |
| Ga0302324_1006341431 | 3300031236 | Palsa | HKLLTELQQRVGSHPELGEAITKLEMALNILAVQTGGLL |
| Ga0265339_106092671 | 3300031249 | Rhizosphere | ILKALQEKIGEHPEIGAAILKLEMALNALAIQTSGLL |
| Ga0302318_105962181 | 3300031258 | Bog | ENVASAHTLLKELQKKVGDHPELGEAITKLEMALSTLAVKTGGLL |
| Ga0302187_103062551 | 3300031259 | Bog | VHISGAKKLLQELQQKTGSHPELGEAITKLELALNVLGINTGGLL |
| Ga0302140_103972554 | 3300031261 | Bog | LISNAHQILKALEERIGKHPELGAAITKLEMALNILSVKTGGIL |
| Ga0170818_1088355181 | 3300031474 | Forest Soil | QATAHIAGAHQILRTLQEKMGQHPELATAITKLEMALSILAVKTGGQW |
| Ga0302326_102063257 | 3300031525 | Palsa | HHILKSLQGKIGEHPEIGAAITKLEMALNILAVKTGGVL |
| Ga0265314_100618021 | 3300031711 | Rhizosphere | AQAAEHIASAHQILKELQKKVGNHPELGEAITKLEMALNNLAIRTGGLL |
| Ga0265314_107090471 | 3300031711 | Rhizosphere | AAEHVAAASQLLKTLQEKIGEHPEIGEAVTKLEMALAVLGVQTGGLL |
| Ga0307476_101258241 | 3300031715 | Hardwood Forest Soil | HEILKALQEKIGEHPEIGAAITKLEMALNVLAVNTAGIL |
| Ga0307474_108208992 | 3300031718 | Hardwood Forest Soil | QILKGLQEKMGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0307468_1021460812 | 3300031740 | Hardwood Forest Soil | PAQAATHIASAHEILKTLQAKIGEHPELGAAITKLEMALNDLAIQTGGML |
| Ga0307477_107129652 | 3300031753 | Hardwood Forest Soil | AKVGEHIKSAYQTLKALQEKIGERHPEISTAITKLELALYDLEIDTGGLL |
| Ga0307475_107368902 | 3300031754 | Hardwood Forest Soil | VQAAKHVASAHQILKDLQKKVGHHPELGEAITKLEMALNNLAVQTGGLL |
| Ga0307479_102963051 | 3300031962 | Hardwood Forest Soil | HIRSAHQILKALQEKIGEHPEIGAAITKLEMALNDLAIQTGGLL |
| Ga0307479_119596373 | 3300031962 | Hardwood Forest Soil | SAHEILRTLQEKIGKHPEIGAAITKLETALNILAVKTGGVL |
| Ga0311301_120241822 | 3300032160 | Peatlands Soil | ASDHQILKELQQKVRNHPELGETITKLEMALNILAIQTGGLL |
| Ga0315281_110828352 | 3300032163 | Sediment | QAAAHIASAHQILKALQEKIGEHPELGAAISRLEMALNILAVQTGGML |
| Ga0335073_114807801 | 3300033134 | Soil | HIASAQQILKALQEKIGEHPEIGAAITKLEMALNDLAVQTGGVL |
| Ga0326727_109340561 | 3300033405 | Peat Soil | ILKDLQPKVGNHPELGEAITKLEMALNILAIKTGGLL |
| Ga0371489_0242686_2_124 | 3300033755 | Peat Soil | AHKILKELQQKVGDHPELGEAITKLEMALNILAIKTGGLL |
| ⦗Top⦘ |