


| Basic Information | |
|---|---|
| Family ID | F034973 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKSGKPKKAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 31.71 % |
| % of genes near scaffold ends (potentially truncated) | 43.93 % |
| % of genes from short scaffolds (< 2000 bps) | 67.05 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.647 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.763 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.931 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.601 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.81% β-sheet: 0.00% Coil/Unstructured: 89.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 21.97 |
| PF05853 | BKACE | 4.62 |
| PF08241 | Methyltransf_11 | 3.47 |
| PF13392 | HNH_3 | 2.31 |
| PF02945 | Endonuclease_7 | 2.31 |
| PF00154 | RecA | 2.31 |
| PF13489 | Methyltransf_23 | 1.16 |
| PF02434 | Fringe | 1.16 |
| PF05050 | Methyltransf_21 | 1.16 |
| PF00692 | dUTPase | 1.16 |
| PF01844 | HNH | 1.16 |
| PF01541 | GIY-YIG | 0.58 |
| PF00534 | Glycos_transf_1 | 0.58 |
| PF00386 | C1q | 0.58 |
| PF01041 | DegT_DnrJ_EryC1 | 0.58 |
| PF00271 | Helicase_C | 0.58 |
| PF06067 | DUF932 | 0.58 |
| PF01531 | Glyco_transf_11 | 0.58 |
| PF08291 | Peptidase_M15_3 | 0.58 |
| PF01391 | Collagen | 0.58 |
| PF13479 | AAA_24 | 0.58 |
| PF00132 | Hexapep | 0.58 |
| PF00565 | SNase | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 4.62 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 2.31 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.16 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 1.16 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.58 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.58 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.58 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.58 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.65 % |
| All Organisms | root | All Organisms | 43.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100638284 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300001282|B570J14230_10147770 | Not Available | 673 | Open in IMG/M |
| 3300001850|RCM37_1110553 | Not Available | 626 | Open in IMG/M |
| 3300001850|RCM37_1141317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300001968|GOS2236_1042343 | All Organisms → Viruses | 1650 | Open in IMG/M |
| 3300002092|JGI24218J26658_1015662 | Not Available | 1119 | Open in IMG/M |
| 3300002161|JGI24766J26685_10136543 | Not Available | 516 | Open in IMG/M |
| 3300002408|B570J29032_109352286 | Not Available | 707 | Open in IMG/M |
| 3300002476|metazooDRAFT_10900914 | Not Available | 1219 | Open in IMG/M |
| 3300003413|JGI25922J50271_10027257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1387 | Open in IMG/M |
| 3300003497|JGI25925J51416_10098625 | Not Available | 700 | Open in IMG/M |
| 3300003808|Ga0007844_1000006 | All Organisms → cellular organisms → Bacteria | 23952 | Open in IMG/M |
| 3300003827|Ga0007880_1018800 | Not Available | 619 | Open in IMG/M |
| 3300003852|Ga0031655_10002396 | Not Available | 10836 | Open in IMG/M |
| 3300003860|Ga0031658_1071675 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300004154|Ga0066603_10565684 | Not Available | 537 | Open in IMG/M |
| 3300004240|Ga0007787_10060563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1709 | Open in IMG/M |
| 3300004795|Ga0007756_11501626 | Not Available | 830 | Open in IMG/M |
| 3300005527|Ga0068876_10011533 | Not Available | 5797 | Open in IMG/M |
| 3300005527|Ga0068876_10015038 | All Organisms → cellular organisms → Bacteria → FCB group | 4980 | Open in IMG/M |
| 3300005527|Ga0068876_10061868 | All Organisms → Viruses → Predicted Viral | 2267 | Open in IMG/M |
| 3300005527|Ga0068876_10078107 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300005527|Ga0068876_10152456 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300005527|Ga0068876_10183567 | All Organisms → cellular organisms → Bacteria → FCB group | 1219 | Open in IMG/M |
| 3300005527|Ga0068876_10221582 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1092 | Open in IMG/M |
| 3300005527|Ga0068876_10273859 | Not Available | 963 | Open in IMG/M |
| 3300005527|Ga0068876_10352849 | All Organisms → Viruses | 827 | Open in IMG/M |
| 3300005528|Ga0068872_10650229 | Not Available | 556 | Open in IMG/M |
| 3300005662|Ga0078894_10580654 | Not Available | 1000 | Open in IMG/M |
| 3300005739|Ga0076948_1100632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300005758|Ga0078117_1028443 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300005758|Ga0078117_1082741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1395 | Open in IMG/M |
| 3300005805|Ga0079957_1001422 | Not Available | 22162 | Open in IMG/M |
| 3300005805|Ga0079957_1012875 | Not Available | 6204 | Open in IMG/M |
| 3300005805|Ga0079957_1159692 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300005844|Ga0068862_100056046 | All Organisms → cellular organisms → Bacteria | 3376 | Open in IMG/M |
| 3300005940|Ga0073913_10014635 | Not Available | 1090 | Open in IMG/M |
| 3300006115|Ga0007816_1048266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300006224|Ga0079037_102340161 | Not Available | 533 | Open in IMG/M |
| 3300006641|Ga0075471_10533721 | Not Available | 580 | Open in IMG/M |
| 3300006641|Ga0075471_10582949 | Not Available | 550 | Open in IMG/M |
| 3300006802|Ga0070749_10067084 | Not Available | 2156 | Open in IMG/M |
| 3300006805|Ga0075464_10782360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300006917|Ga0075472_10035612 | Not Available | 2329 | Open in IMG/M |
| 3300007169|Ga0102976_1008876 | All Organisms → cellular organisms → Bacteria | 4207 | Open in IMG/M |
| 3300007171|Ga0102977_1001802 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300007561|Ga0102914_1138416 | Not Available | 754 | Open in IMG/M |
| 3300007658|Ga0102898_1017858 | Not Available | 1576 | Open in IMG/M |
| 3300007670|Ga0102862_1103285 | Not Available | 715 | Open in IMG/M |
| 3300008107|Ga0114340_1090677 | Not Available | 1242 | Open in IMG/M |
| 3300008108|Ga0114341_10010090 | Not Available | 8383 | Open in IMG/M |
| 3300008108|Ga0114341_10020372 | Not Available | 7199 | Open in IMG/M |
| 3300008108|Ga0114341_10328317 | Not Available | 780 | Open in IMG/M |
| 3300008116|Ga0114350_1033435 | Not Available | 4787 | Open in IMG/M |
| 3300008117|Ga0114351_1001368 | Not Available | 49155 | Open in IMG/M |
| 3300008120|Ga0114355_1039398 | Not Available | 2257 | Open in IMG/M |
| 3300008120|Ga0114355_1170676 | Not Available | 743 | Open in IMG/M |
| 3300008259|Ga0114841_1153721 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae | 906 | Open in IMG/M |
| 3300008266|Ga0114363_1075536 | All Organisms → Viruses → Predicted Viral | 2615 | Open in IMG/M |
| 3300008267|Ga0114364_1002831 | Not Available | 12666 | Open in IMG/M |
| 3300008448|Ga0114876_1128698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae | 958 | Open in IMG/M |
| 3300008448|Ga0114876_1140156 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 897 | Open in IMG/M |
| 3300008448|Ga0114876_1229401 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300008450|Ga0114880_1068134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H34 | 1452 | Open in IMG/M |
| 3300009026|Ga0102829_1023329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
| 3300009059|Ga0102830_1050137 | Not Available | 1266 | Open in IMG/M |
| 3300009081|Ga0105098_10001375 | Not Available | 8704 | Open in IMG/M |
| 3300009081|Ga0105098_10828668 | Not Available | 502 | Open in IMG/M |
| 3300009165|Ga0105102_10114864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
| 3300009165|Ga0105102_10529335 | Not Available | 643 | Open in IMG/M |
| 3300009170|Ga0105096_10042303 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300009170|Ga0105096_10103643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
| 3300009170|Ga0105096_10216155 | Not Available | 971 | Open in IMG/M |
| 3300009170|Ga0105096_10360667 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009684|Ga0114958_10077853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1733 | Open in IMG/M |
| 3300012352|Ga0157138_1000189 | All Organisms → cellular organisms → Bacteria | 15362 | Open in IMG/M |
| 3300012968|Ga0129337_1317289 | Not Available | 597 | Open in IMG/M |
| 3300013004|Ga0164293_10120679 | Not Available | 1985 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10766956 | Not Available | 602 | Open in IMG/M |
| 3300017747|Ga0181352_1070271 | Not Available | 990 | Open in IMG/M |
| 3300017754|Ga0181344_1009028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3244 | Open in IMG/M |
| 3300017754|Ga0181344_1086758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 916 | Open in IMG/M |
| 3300017754|Ga0181344_1186115 | Not Available | 585 | Open in IMG/M |
| 3300017754|Ga0181344_1239372 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300017766|Ga0181343_1218166 | Not Available | 519 | Open in IMG/M |
| 3300017788|Ga0169931_10426304 | All Organisms → Viruses | 968 | Open in IMG/M |
| 3300019784|Ga0181359_1118244 | All Organisms → Viruses | 951 | Open in IMG/M |
| 3300020048|Ga0207193_1022051 | Not Available | 7880 | Open in IMG/M |
| 3300020151|Ga0211736_10948161 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300020162|Ga0211735_11154321 | Not Available | 3080 | Open in IMG/M |
| 3300020540|Ga0208227_1020288 | Not Available | 1067 | Open in IMG/M |
| 3300020543|Ga0208089_1001566 | Not Available | 5331 | Open in IMG/M |
| 3300020551|Ga0208360_1014727 | Not Available | 1076 | Open in IMG/M |
| 3300021079|Ga0194055_10000954 | Not Available | 23512 | Open in IMG/M |
| 3300021142|Ga0214192_1033679 | Not Available | 1701 | Open in IMG/M |
| 3300021354|Ga0194047_10000049 | Not Available | 89898 | Open in IMG/M |
| 3300021438|Ga0213920_1000076 | Not Available | 114355 | Open in IMG/M |
| 3300021600|Ga0194059_1097196 | Not Available | 920 | Open in IMG/M |
| 3300021602|Ga0194060_10467003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300021956|Ga0213922_1120392 | Not Available | 517 | Open in IMG/M |
| 3300021962|Ga0222713_10095420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Absconditabacteria → Vampirococcus → Candidatus Vampirococcus lugosii | 2142 | Open in IMG/M |
| 3300021963|Ga0222712_10076421 | Not Available | 2406 | Open in IMG/M |
| 3300022141|Ga0213933_101562 | Not Available | 1968 | Open in IMG/M |
| 3300022543|Ga0212119_1037631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 772 | Open in IMG/M |
| 3300022752|Ga0214917_10060907 | Not Available | 2455 | Open in IMG/M |
| 3300024306|Ga0255148_1029778 | Not Available | 1017 | Open in IMG/M |
| 3300024481|Ga0256330_1000988 | All Organisms → Viruses → Predicted Viral | 4599 | Open in IMG/M |
| 3300024512|Ga0255186_1039368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300024565|Ga0255273_1011130 | All Organisms → Viruses → Predicted Viral | 1948 | Open in IMG/M |
| 3300024574|Ga0255275_1190833 | Not Available | 545 | Open in IMG/M |
| 3300025426|Ga0208739_1027937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300025732|Ga0208784_1087216 | Not Available | 938 | Open in IMG/M |
| 3300025889|Ga0208644_1061425 | All Organisms → Viruses → Predicted Viral | 2019 | Open in IMG/M |
| 3300027126|Ga0255098_1026351 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 944 | Open in IMG/M |
| 3300027260|Ga0208027_1000260 | Not Available | 12094 | Open in IMG/M |
| 3300027278|Ga0208439_1059889 | Not Available | 720 | Open in IMG/M |
| 3300027563|Ga0209552_1040001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1354 | Open in IMG/M |
| 3300027683|Ga0209392_1243228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 538 | Open in IMG/M |
| 3300027693|Ga0209704_1089639 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027721|Ga0209492_1000006 | Not Available | 95002 | Open in IMG/M |
| 3300027764|Ga0209134_10091713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
| 3300027805|Ga0209229_10047868 | All Organisms → Viruses → Predicted Viral | 1903 | Open in IMG/M |
| 3300027808|Ga0209354_10321593 | Not Available | 613 | Open in IMG/M |
| 3300027816|Ga0209990_10117432 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300027816|Ga0209990_10202850 | Not Available | 919 | Open in IMG/M |
| 3300027816|Ga0209990_10280364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum cavernae | 751 | Open in IMG/M |
| 3300027816|Ga0209990_10305867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 711 | Open in IMG/M |
| 3300027896|Ga0209777_10003598 | Not Available | 19042 | Open in IMG/M |
| 3300027956|Ga0209820_1002940 | All Organisms → cellular organisms → Bacteria | 4151 | Open in IMG/M |
| 3300027972|Ga0209079_10276448 | Not Available | 570 | Open in IMG/M |
| 3300028380|Ga0268265_10042347 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
| 3300029349|Ga0238435_108527 | Not Available | 987 | Open in IMG/M |
| 3300029349|Ga0238435_115180 | Not Available | 652 | Open in IMG/M |
| 3300031758|Ga0315907_10009644 | Not Available | 9716 | Open in IMG/M |
| 3300031758|Ga0315907_10040293 | All Organisms → Viruses → Predicted Viral | 4153 | Open in IMG/M |
| 3300031758|Ga0315907_10124064 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2203 | Open in IMG/M |
| 3300031787|Ga0315900_10006068 | Not Available | 16375 | Open in IMG/M |
| 3300031787|Ga0315900_10166556 | All Organisms → Viruses → Predicted Viral | 2009 | Open in IMG/M |
| 3300031787|Ga0315900_10684322 | Not Available | 730 | Open in IMG/M |
| 3300031857|Ga0315909_10100048 | Not Available | 2501 | Open in IMG/M |
| 3300031857|Ga0315909_10391909 | Not Available | 998 | Open in IMG/M |
| 3300031951|Ga0315904_10387252 | Not Available | 1272 | Open in IMG/M |
| 3300031963|Ga0315901_10303900 | Not Available | 1320 | Open in IMG/M |
| 3300031963|Ga0315901_10927777 | Not Available | 616 | Open in IMG/M |
| 3300032050|Ga0315906_10001426 | Not Available | 35468 | Open in IMG/M |
| 3300032050|Ga0315906_10099857 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
| 3300032050|Ga0315906_10258461 | All Organisms → Viruses | 1595 | Open in IMG/M |
| 3300032050|Ga0315906_10533326 | Not Available | 984 | Open in IMG/M |
| 3300032092|Ga0315905_11003201 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300032093|Ga0315902_11132165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300032116|Ga0315903_10233583 | Not Available | 1604 | Open in IMG/M |
| 3300032116|Ga0315903_10429417 | All Organisms → Viruses | 1066 | Open in IMG/M |
| 3300032173|Ga0315268_11835743 | Not Available | 619 | Open in IMG/M |
| 3300032397|Ga0315287_12825679 | Not Available | 513 | Open in IMG/M |
| 3300033482|Ga0316627_102483716 | Not Available | 546 | Open in IMG/M |
| 3300033981|Ga0334982_0169353 | Not Available | 1100 | Open in IMG/M |
| 3300033996|Ga0334979_0085461 | Not Available | 1985 | Open in IMG/M |
| 3300034018|Ga0334985_0181206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1410 | Open in IMG/M |
| 3300034019|Ga0334998_0273350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1014 | Open in IMG/M |
| 3300034021|Ga0335004_0646373 | Not Available | 553 | Open in IMG/M |
| 3300034092|Ga0335010_0042299 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
| 3300034116|Ga0335068_0039702 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
| 3300034280|Ga0334997_0432469 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300034284|Ga0335013_0487563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.36% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.62% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.31% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.73% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 1.73% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.73% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.16% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.16% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.16% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.58% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.58% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.58% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.58% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003808 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 | Environmental | Open in IMG/M |
| 3300003827 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004383 | Marine microbial communities from Bothnian Bay, Baltic Sea | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022141 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1006382843 | 3300001213 | Wetland | MKAGKPRRAPKVTPPRPVNANYMKEADTKLRLKSKMWPMKSKRLSK* |
| JGIcombinedJ13530_1061252208 | 3300001213 | Wetland | MSVLTSKTSLKKAPKVKNPRPKDNYMKEADTKLRLKSPMWPMKQKRLSK* |
| B570J14230_101477702 | 3300001282 | Freshwater | KPRPAPKVAPPNPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| RCM37_11105532 | 3300001850 | Marine Plankton | MKGSGKPKKAPKVSPPRPINSNYMKEADTKLRRASKMWPLKTKRLSK* |
| RCM37_11413172 | 3300001850 | Marine Plankton | MSASNKTPGKPRKAPKVKNPMPKSNYMKEADRPERLKSPMWPMKQKRLSK* |
| GOS2236_10423434 | 3300001968 | Marine | VVVNAEEAATNMKAGKPKKAPKVTNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK* |
| JGI24218J26658_10156622 | 3300002092 | Lentic | MKSGKPRQAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| JGI24766J26685_101365432 | 3300002161 | Freshwater And Sediment | MKAGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPLKQKRLSK* |
| B570J29032_1093522861 | 3300002408 | Freshwater | KAKKSGKPRKAPKVAPPNPINGNYMKEADTKLRLKSPQWPMKRKRLSK* |
| metazooDRAFT_109009141 | 3300002476 | Lake | AEEVAINMKAGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPLKTKRLSK* |
| JGI25922J50271_100272572 | 3300003413 | Freshwater Lake | MKSGRPKKAPKVSPPRPINANYMKEADTKLRRKSKMWPMKSKRLSK* |
| JGI25925J51416_100986251 | 3300003497 | Freshwater Lake | RKAPKVNNPNPKDNFMREADTKLRLKSPMLPMKQKRLSK* |
| Ga0007844_100000630 | 3300003808 | Freshwater | MKSGKPRPAPKVKPPSKAKPNFMKEADTKERLKSPMWPMKQKRLSK* |
| Ga0007880_10188001 | 3300003827 | Freshwater | RKAPKVKPPSRKAPNFMKEADTKERLKSPMWPMKQKRLSK* |
| Ga0031655_1000239617 | 3300003852 | Freshwater Lake Sediment | MKSGKPRPAPKVKPPSKAAPNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0031658_10716752 | 3300003860 | Freshwater Lake Sediment | MKAGKPKKAPKVHNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0066603_105656841 | 3300004154 | Freshwater | MKSGKPRPAPKVKAPSRANPNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0007787_100605633 | 3300004240 | Freshwater Lake | MKSGKPKLAPKVKNPRPKDNYMKEADTKLRLKSPQWPMKQKRLSK* |
| Ga0064591_101883631 | 3300004383 | Marine Sediment | MSVLKSKTSLKKAPKVPPPKPINGNYMKEADTKLRLKSPQWPMKQKRLSK* |
| Ga0007756_115016262 | 3300004795 | Freshwater Lake | MKSGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPMKSK |
| Ga0068876_100115333 | 3300005527 | Freshwater Lake | MKSGKPKKAPKVNNPRPKDNYMRESDSKLRLKSPMFPLKSKRLSK* |
| Ga0068876_100150384 | 3300005527 | Freshwater Lake | MKAGKPKKAPKVHNPRPKDNYMKEADTKLRLKSKMWPMRVKRLSK* |
| Ga0068876_100618686 | 3300005527 | Freshwater Lake | VVDVEEDANMKSGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKRL |
| Ga0068876_100781071 | 3300005527 | Freshwater Lake | MKSGRPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKVKRLSK* |
| Ga0068876_101524563 | 3300005527 | Freshwater Lake | MKSGKPKKAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0068876_101835673 | 3300005527 | Freshwater Lake | MKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKMWPMKSKRLSK* |
| Ga0068876_102215822 | 3300005527 | Freshwater Lake | VVNVNTDVNMKAGKPKKAPKVHNPNPLGNFMREADTKLRLKSKNWPLKQKRLSK* |
| Ga0068876_102738593 | 3300005527 | Freshwater Lake | KPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKRLSK* |
| Ga0068876_103528491 | 3300005527 | Freshwater Lake | MKSGRPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKRLSK* |
| Ga0068872_106502293 | 3300005528 | Freshwater Lake | MKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKNWPLK |
| Ga0078894_105806543 | 3300005662 | Freshwater Lake | MHKPVKAPKVAPPKPVDANYMKEADTPARLRSKMWPLKQKRLSK* |
| Ga0076948_11006324 | 3300005739 | Lake Water | MKAGKPKKAPKVPNPRPKDNYMKEADTKLRLRSKMWPLRQKRLSK* |
| Ga0078117_10284431 | 3300005758 | Lake Water | NMKSGKPKKAPKVSPPRPINGNYMKEADTKLRLKSKMWPMKVKRLSK* |
| Ga0078117_10827413 | 3300005758 | Lake Water | MKAGKPKKAPKVHNPNPKGNFMKEADTKLRLKSKMWPMRQKRLSK* |
| Ga0079957_100142231 | 3300005805 | Lake | MKAGKPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPMKVKRLSK* |
| Ga0079957_101287511 | 3300005805 | Lake | MKSGKPKKAPKVHNPRPKDNYMKEADTKLRLKSPMWPMKQKRLSK* |
| Ga0079957_11596924 | 3300005805 | Lake | MKSGKPRKAPKVHNPNVKGNYMKEADTKLRLKSKMWPMKQKRLSK* |
| Ga0068862_1000560464 | 3300005844 | Switchgrass Rhizosphere | MKSGKPKKAPKVNNPDPKGNYMKEFDQPKNLKSKMWPLKSKRLSK* |
| Ga0073913_100146352 | 3300005940 | Sand | MKSGKPKKAPKVSPPKPVNANYMKEADTKLRRSSKMWPMKSKRLSK* |
| Ga0007816_10482664 | 3300006115 | Freshwater | MKAGKPRKAPKVKPPSRKAPNFMKEADTKERLKSPMWPM |
| Ga0079037_1023401612 | 3300006224 | Freshwater Wetlands | MKSGKPKKAPKVPPPKPINGNYMKEADTKLRLKSKMWPLKSKRLSK* |
| Ga0075471_105337212 | 3300006641 | Aqueous | MKAGKPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0075471_105829491 | 3300006641 | Aqueous | VVNVNTVVNMKSGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMK |
| Ga0070749_100670841 | 3300006802 | Aqueous | MKSGKPQKAPKVKAPNPKKPNFMREADTPSRLKSPMAPMKQKRLSK* |
| Ga0075464_107823602 | 3300006805 | Aqueous | MKSGKPQKAPKVKAPNPKKPNFMREADTPSRLKSPMAPMKSKRLSK* |
| Ga0075472_100356123 | 3300006917 | Aqueous | MKSGKPKKAPKVPPPKPINANYMKEADTKLRRSSKMWPMKTKRLSK* |
| Ga0102976_10088762 | 3300007169 | Freshwater Lake | MKSGRPKKAPKVSPPRPINGNYMKEADTKLRLKSKMWPMKVKRLSK* |
| Ga0102977_10018022 | 3300007171 | Freshwater Lake | MKSGKPKKAPKVSPPRPINGNYMKEADTKLRLKSKMWPMKVKRLSK* |
| Ga0102914_11384161 | 3300007561 | Estuarine | SGTPRPAPKVAPPKPVNGNYMKEADTPRRLQSKMWPLKQKRLSK* |
| Ga0102868_11093992 | 3300007653 | Estuarine | APPKPINGNYMKESDTPARLKSKMWPLKQKRLSK* |
| Ga0102898_10178581 | 3300007658 | Estuarine | AKGSGTPRPAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0102862_11032851 | 3300007670 | Estuarine | KGSGTPRPAPKVAAPSRAKPNYMKEADTPARLKSKMWPLKQKRLSK* |
| Ga0114340_10906773 | 3300008107 | Freshwater, Plankton | KAPKVHNPNPLGNFMREADTKLRLKSKMWPLKQKRLSK* |
| Ga0114341_1001009011 | 3300008108 | Freshwater, Plankton | MKAGKPKKAPKVHNPNPLGNFMREADTKLRLKSKMWPLKQKRLSK* |
| Ga0114341_1002037214 | 3300008108 | Freshwater, Plankton | MKAGKPKKAPKVHNPNPLGNFMREADTKLRLKSKMWPLKSKRLSK* |
| Ga0114341_103283172 | 3300008108 | Freshwater, Plankton | VVNVNTDVNNMKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKMWPMKSKRLSK* |
| Ga0114350_103343512 | 3300008116 | Freshwater, Plankton | KKAPKVHNPSPKNNYMKEADTKLRLKSPMWPMKQKRLSK* |
| Ga0114351_100136832 | 3300008117 | Freshwater, Plankton | MKAGKPKKAPKVHNPNPKGNFMKESDTKLRLKSPQWPMKQKRLSK* |
| Ga0114355_10393984 | 3300008120 | Freshwater, Plankton | MKSGKPKKAPKVHNPSPKNNYMKEADTKLRLKSPMWPMKQKRLSK* |
| Ga0114355_11706762 | 3300008120 | Freshwater, Plankton | MKAGKPKKAPKVHNPNPKGNFMKESDTKLRLKSPQWPMKQKRLAK* |
| Ga0114841_11537211 | 3300008259 | Freshwater, Plankton | GKPKKAPKVHNPRPKDNYMKEADTKLRLKSKMWPMRVKRLSK* |
| Ga0114363_10755362 | 3300008266 | Freshwater, Plankton | MKAGKPKKAPKVHNPRPNANYMKEADTKLRLKSKMWPLRQKRLSK* |
| Ga0114364_100283117 | 3300008267 | Freshwater, Plankton | MKAGKPKKAPKVHNPNPKGNYMKEADTKLRLKSKMWPMKSKRLSK* |
| Ga0114876_11286982 | 3300008448 | Freshwater Lake | MKAGKPKKAPKVHNPNPKGNYMKEADTKLRLKSSMWPMKQKRLSK* |
| Ga0114876_11401561 | 3300008448 | Freshwater Lake | PKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0114876_12294012 | 3300008448 | Freshwater Lake | PKVAPPKPINGNYMREADTPSRLKSKMWPLKQKRLSK* |
| Ga0114880_10681343 | 3300008450 | Freshwater Lake | MKAGKPKKAPKVPPPKPINANYMKEADTKLRRSSKMWPMKTKRLSK* |
| Ga0102829_10233291 | 3300009026 | Estuarine | KPAKAPKVASPKPINGNFMREADTPSRLKSPMAPMKQKRLSK* |
| Ga0102830_10501373 | 3300009059 | Estuarine | SGTPRPAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0105098_100013759 | 3300009081 | Freshwater Sediment | MKSGKPRTAPKVNNPRPKDNYMKEADTKLRLKSKMWPMKQKRLSK* |
| Ga0105098_108286682 | 3300009081 | Freshwater Sediment | APKVAPPNPVDGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0105102_101148641 | 3300009165 | Freshwater Sediment | APKVKNPRPKDNYMKEADTKLRLKSPQWPMKQKRLSK* |
| Ga0105102_105293352 | 3300009165 | Freshwater Sediment | MKSGKPKKAPKVAPPKPVNGNYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0105096_100423034 | 3300009170 | Freshwater Sediment | PKVKNPRPKDNYMKEADTKLRLKSPQWPMKQKRLSK* |
| Ga0105096_101036432 | 3300009170 | Freshwater Sediment | MKSGKPRTAPKVNNPRPKDNYMKEADTKLRLKSKMWPMKSKRLSK* |
| Ga0105096_102161552 | 3300009170 | Freshwater Sediment | MKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKMWPLKQKRLSK* |
| Ga0105096_103606671 | 3300009170 | Freshwater Sediment | IWLLMKAGKPKKAPKVHNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK* |
| Ga0114958_100778533 | 3300009684 | Freshwater Lake | MKSGQPKKAPKVINPKPKDNYMKEGDTKLRLKSKMWPLKSKRLSK* |
| Ga0157138_100018918 | 3300012352 | Freshwater | MKSGKPRKAPKVKAPNPKKPNFMREADTPSRLKSPMAPMKQKRLSK* |
| Ga0129337_13172891 | 3300012968 | Aqueous | MKSGRPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKR |
| Ga0164293_101206791 | 3300013004 | Freshwater | MTAGKAKGSGKPRPAPKVAPPNPVDGNYMKEADTKLRLRSKNWPLKQKRLSK* |
| (restricted) Ga0172372_107669561 | 3300013132 | Freshwater | MKSGRPKKAPKVSPPRPVNANYMKEADTKLRRKSKMW |
| Ga0181352_10702713 | 3300017747 | Freshwater Lake | PKVKPPKPINGNYMKEADTPSRLKSPMAPMKQKRLSK |
| Ga0181344_10090281 | 3300017754 | Freshwater Lake | KSGAPKKAPKVPNPRPKDNYMKEADTKLRLKSPMWPMKQKRLSK |
| Ga0181344_10867581 | 3300017754 | Freshwater Lake | KAPKVSPPKPVNANYMKEADTKLRRSSKMWPMKSKRLSK |
| Ga0181344_11861151 | 3300017754 | Freshwater Lake | MKSGKPRKAPKVKAPNPKKPNFMREADTPSRLKSPMAPMKQKRLSK |
| Ga0181344_12393721 | 3300017754 | Freshwater Lake | MKSGKPKKAPKVSPPKPVNANYMKEADTKLRRSSKMWPMKSKRLSK |
| Ga0181343_12181662 | 3300017766 | Freshwater Lake | MTSGKAKKSGTPQKAPKVKNPRPKDNYMKEADTKLRLKSKMWPMKQ |
| Ga0169931_104263043 | 3300017788 | Freshwater | VVNAEEVAINMKSGRPKKAPKVSPPRPVNANYMKEADTKLRRKSKMWPMKT |
| Ga0181359_11182442 | 3300019784 | Freshwater Lake | VVNAEEVATNMKSGRPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPLKTKRLSK |
| Ga0207193_102205120 | 3300020048 | Freshwater Lake Sediment | MKSGKPQKAPKVKAPNPKKPNFMREADTPSRLKSPMAPMKSKRLSK |
| Ga0211736_109481615 | 3300020151 | Freshwater | SGTPRPAPKVAPPKPINGNYMKESDTPARLKSKMWPLKQKRLSK |
| Ga0211735_111543218 | 3300020162 | Freshwater | SGTPRPAPKVAPPKPVNGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0208227_10202883 | 3300020540 | Freshwater | AGKAKKSGKPRKAPKVAPPNPINGNYMKEADTKLRLKSPQWPMKRKRLSK |
| Ga0208089_10015661 | 3300020543 | Freshwater | KAKKSGKPRKAPKVAPPNPINGNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0208360_10147273 | 3300020551 | Freshwater | PKVAPPKPVDGNYMKEADTKLRLRSKMWPLKQKRLSK |
| Ga0194055_1000095420 | 3300021079 | Anoxic Zone Freshwater | MKSGTPRKAPKVKAPSKKSPNFMREANTKLRLKSPMAPMKQKRLSK |
| Ga0214192_10336792 | 3300021142 | Freshwater | MKSGKPRPAPKVKPPSKAKPNFMKEADTKERLKSPMWPMKQKRLSK |
| Ga0194047_1000004998 | 3300021354 | Anoxic Zone Freshwater | MKSGKPQKAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0213920_1000076137 | 3300021438 | Freshwater | MKSGKPRNAPKVKAPNPKKPNFMKEADTPSRLKSPMTPMKSKRLSK |
| Ga0194059_10971962 | 3300021600 | Anoxic Zone Freshwater | MKSGQPKKAPKVINPKPKDNYMKEGDTKLRLKSKMWPLKSKRLSK |
| Ga0194060_104670032 | 3300021602 | Anoxic Zone Freshwater | PAKAPKVANPKPVDANYMKEADTPSRLKSPMLPMKQKRLSK |
| Ga0213922_11203921 | 3300021956 | Freshwater | MKSGKPQKAPKVAPPKPVNSNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0222713_100954202 | 3300021962 | Estuarine Water | MKAGKPRRAPKVTPPRPVNANYMKEADTKLRLKSKMWPMKSKRLSK |
| Ga0222712_100764216 | 3300021963 | Estuarine Water | QKAPKVAPPKPVDGNYMREADTPRRLKSPMWPLKQKRLSK |
| Ga0213933_1015626 | 3300022141 | Freshwater | MKSGKPRNAPKVKAPNPKKPNFMKEADTPSRLKIPMTPMKSKRLSK |
| Ga0212119_10376312 | 3300022543 | Freshwater | MKSGKPKKAPKVAPPKPVNGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0214917_100609073 | 3300022752 | Freshwater | VVNAEEVATNMKSGRPKKAPKVSPPRPINGNYMKEADTKLRLKSKMWPLKTKRLSK |
| Ga0255148_10297782 | 3300024306 | Freshwater | MKAGKPRRAPKVTNPRPKDNYMKEADTKLRLKSKMWPMKQKRLSK |
| Ga0256330_10009881 | 3300024481 | Freshwater | MKAGKPKKAPKVPPPKPINANYMKEADTKLRRSSKMWPMKSKRLSK |
| Ga0255186_10393681 | 3300024512 | Freshwater | MKAGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMW |
| Ga0255273_10111301 | 3300024565 | Freshwater | MKAGKPKKAPKVPPPKPINANYMKEADTKLRRSSKMW |
| Ga0255275_11908332 | 3300024574 | Freshwater | LMKAGKPRRAPKVTNPRPKDNYMKEADTKLRLKSKMWPMKQKRLSK |
| Ga0208739_10279374 | 3300025426 | Freshwater | MKAGKPRKAPKVKPPSRKAPNFMKEADTKERLKSPMWPMKQKRL |
| Ga0208784_10872163 | 3300025732 | Aqueous | VNTVVNMKSGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKVKRLSK |
| Ga0208644_10614251 | 3300025889 | Aqueous | MKSGKPQKAPKVKNPNPKGNYMKEADTKLRLKSKMWPMKQK |
| Ga0255098_10263511 | 3300027126 | Freshwater | PRPAPKVAPPKPINGNYMKEADTPARLKSKMWPLKQKRLSK |
| Ga0208027_10002601 | 3300027260 | Estuarine | PRPAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0208439_10598892 | 3300027278 | Estuarine | PAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209552_10400011 | 3300027563 | Freshwater Lake | KVAPPKPINGNYMREADTPSRLKSPMLPMKQKRLSK |
| Ga0209392_12432282 | 3300027683 | Freshwater Sediment | APKVKNPRPKDNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0209704_10896392 | 3300027693 | Freshwater Sediment | MKAGKPKKAPKVHNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209492_100000625 | 3300027721 | Freshwater Sediment | MKSGRPKKAPKVSPPRPINANYMKEADTKLRRKSKMWPMKSKRLSK |
| Ga0209134_100917131 | 3300027764 | Freshwater Lake | KAPKVPNSRPKDNYMKEADTKLRLKSPMFPMKQKRLSK |
| Ga0209229_100478683 | 3300027805 | Freshwater And Sediment | MKAGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209354_103215933 | 3300027808 | Freshwater Lake | KKSGAPRKAPKVPNSRPKDNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0209990_101174321 | 3300027816 | Freshwater Lake | MKSGKPKKAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209990_102028501 | 3300027816 | Freshwater Lake | MTSGKAKGSGKPRPAPKVAPPKPINGNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209990_102803642 | 3300027816 | Freshwater Lake | VVNAEEVAINMKSGRPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKVKRLSK |
| Ga0209990_103058673 | 3300027816 | Freshwater Lake | MKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKNWPLKQKRLSK |
| Ga0209777_1000359819 | 3300027896 | Freshwater Lake Sediment | MKSGKPRPAPKVKPPSKAAPNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0209536_1027658331 | 3300027917 | Marine Sediment | MAANKKTSLKKAPKVSNPNVKGNYMKEADTKLRLKSPMLPMKQKRLSK |
| Ga0209820_10029408 | 3300027956 | Freshwater Sediment | MKSGKPRTAPKVNNPRPKDNYMKEADTKLRLKSKMWPMKQKRLSK |
| Ga0209079_102764482 | 3300027972 | Freshwater Sediment | KAPKVAPPKPVDGNYMREADTPLRLKSKMWPLKQKRLSK |
| Ga0268265_100423474 | 3300028380 | Switchgrass Rhizosphere | MKSGKPKKAPKVNNPDPKGNYMKEFDQPKNLKSKMWPLKSKRLSK |
| Ga0238435_1085272 | 3300029349 | Freshwater | VANAEEVATNMKSGRPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPLKTKRLSK |
| Ga0238435_1151802 | 3300029349 | Freshwater | VAPPNPINGNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0315291_109388012 | 3300031707 | Sediment | MSVLKSKTSLKKAPKVAPPKPINGNYMKEADTKLRLKSPQWPMKRKRLSK |
| Ga0315907_100096445 | 3300031758 | Freshwater | MKSGKPKKAPKVNNPRPKDNYMRESDSKLRLKSPMFPLKSKRLSK |
| Ga0315907_100402936 | 3300031758 | Freshwater | MKAGKPKKAPKVPPPKPINANYMKEADTKLRRSSKMWPMKTKRLSK |
| Ga0315907_101240644 | 3300031758 | Freshwater | MKSGKPKKAPKVHNPSPKNNYMKEADTKLRLKSPMWPMKQKRLSK |
| Ga0315900_1000606823 | 3300031787 | Freshwater | MKAGKPKKAPKVHNPNPKGNFMREADTKLRLKSKMWPMKSKRLSK |
| Ga0315900_101665562 | 3300031787 | Freshwater | MKSGKPKKAPKVHNPNPKGNFMKEADTKLRLKSKMWPMKSKRLSK |
| Ga0315900_106843221 | 3300031787 | Freshwater | VVNAEEVATNMKSGRPKKAPKVPNPRPNSNYMKEPDTKLRLKSKMWPMKVKRLSK |
| Ga0315909_101000488 | 3300031857 | Freshwater | MKSGKPKKAPKVNNPNPKGNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0315909_103919093 | 3300031857 | Freshwater | MKSGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWP |
| Ga0315904_103872523 | 3300031951 | Freshwater | PKVPPPKPINANYMKEADTKLRRSSKMWPMKTKRLSK |
| Ga0315901_103039003 | 3300031963 | Freshwater | KVNNPRPKDNYMRESDSKLRLKSPMFPLKSKRLSK |
| Ga0315901_109277771 | 3300031963 | Freshwater | GKAKKSGAPRKAPKVPNPRPKDNYMKEADTKLRLKSPMWPMKSKRLSK |
| Ga0315289_107016872 | 3300032046 | Sediment | MSVLKSKTSLKKAPKVAPPKPINGNYMKEADTKLRLKSPQWPMKRKRFSK |
| Ga0315906_1000142652 | 3300032050 | Freshwater | MKAGKPKKAPKVHNPNPKGNFMKESDTKLRLKSPQWPMKQKRLSK |
| Ga0315906_100998572 | 3300032050 | Freshwater | MKSGRPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKVKRLSK |
| Ga0315906_102584611 | 3300032050 | Freshwater | VEDAEEDANMKSGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKR |
| Ga0315906_105333261 | 3300032050 | Freshwater | MKSGKPKKAPKVPNPRPKDNYMKEADTKLRLKSKMWPLKSKR |
| Ga0315905_110032011 | 3300032092 | Freshwater | AGKPKKAPKVHNPRPKDNYMKEADTKLRLKSPQWPMKQKRLSK |
| Ga0315902_111321651 | 3300032093 | Freshwater | PRQAPKVKNPRPKDNYMKEADTKLRLKSKMWPMKQKRLSK |
| Ga0315903_102335832 | 3300032116 | Freshwater | MKSGRPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKSKRLSK |
| Ga0315903_104294174 | 3300032116 | Freshwater | MKSGKPKKAPKVHNPSPKNNYMKEADTKLRLKSPMWPMKQKRLS |
| Ga0315268_118357431 | 3300032173 | Sediment | KVSPPSKKAPNYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0315287_128256792 | 3300032397 | Sediment | KAKKSGKPKKAPKVAPPNPINGNYMREADTKLRLKSPQWPMKQKRLSK |
| Ga0315273_130109581 | 3300032516 | Sediment | MSVLKSKTSLKKAPKVAPPKPINGNYMKEADTKLRLKSPQWPMK |
| Ga0316627_1024837161 | 3300033482 | Soil | MKSGKPKKAPKVKNPNPKGNYMKEADTKLRLKSPMWPMKQKR |
| Ga0334982_0169353_968_1099 | 3300033981 | Freshwater | GKPRPAPKVAPPNPINGNYMKEADTKLRLRSKMWPLKQKRLSK |
| Ga0334979_0085461_2_157 | 3300033996 | Freshwater | TAGKAKGSGKPRPAPKVAPPNPVDGNYMKEADTKLRLRSKNWPLKQKRLSK |
| Ga0334985_0181206_10_168 | 3300034018 | Freshwater | MTAGKAKGSGTPRPAPKVAPPKPVNGNYMKEADTPARLKSKMWPLKQKRLSK |
| Ga0334998_0273350_2_163 | 3300034019 | Freshwater | NAEEVAINMKSGKPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPLKTKRLSK |
| Ga0335004_0646373_34_171 | 3300034021 | Freshwater | MKSGKPKKAPKVPNPRPNSNYMKEADTKLRLKSKMWPMKVKRLSK |
| Ga0335010_0042299_727_864 | 3300034092 | Freshwater | MKSGRPKKAPKVKNPRPKDNYMKEADTKLRLKSPQWPMEQKRLSK |
| Ga0335029_0300074_819_971 | 3300034102 | Freshwater | MSILKSKTSLKKAPKVAPPKPINGNYMNEADTKLRLKSPQWPMKQKRLSK |
| Ga0335068_0039702_63_230 | 3300034116 | Freshwater | VVNAEEVATNMKSGKPKKAPKVPNPRPNANYMKEADTKLRLKSKMWPLKTKRLSK |
| Ga0334997_0432469_3_131 | 3300034280 | Freshwater | GKPKKAPKVHNPRPNANYMKEADTKLRLKSKMWPLKQKRLSK |
| Ga0335007_0413652_721_837 | 3300034283 | Freshwater | APKVPAPKPINGNYMKESDTKLQRKSPMLPMKQKRLSK |
| Ga0335013_0487563_595_738 | 3300034284 | Freshwater | AKGSGKPRPAPKVAPPNPVDGNYMKEADTKLRLRSKNWPLKQKRLSK |
| ⦗Top⦘ |