


| Basic Information | |
|---|---|
| Family ID | F034915 |
| Family Type | Metagenome |
| Number of Sequences | 173 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.57 % |
| % of genes near scaffold ends (potentially truncated) | 98.84 % |
| % of genes from short scaffolds (< 2000 bps) | 79.19 % |
| Associated GOLD sequencing projects | 43 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.740 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (71.676 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.988 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.145 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 68.18% β-sheet: 0.00% Coil/Unstructured: 31.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF01471 | PG_binding_1 | 4.62 |
| PF06791 | TMP_2 | 0.58 |
| PF16778 | Phage_tail_APC | 0.58 |
| PF08774 | VRR_NUC | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG5281 | Phage-related minor tail protein | Mobilome: prophages, transposons [X] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.74 % |
| All Organisms | root | All Organisms | 35.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005512|Ga0074648_1053955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1712 | Open in IMG/M |
| 3300006025|Ga0075474_10004348 | All Organisms → cellular organisms → Bacteria | 5783 | Open in IMG/M |
| 3300006025|Ga0075474_10014145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2987 | Open in IMG/M |
| 3300006025|Ga0075474_10024071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2185 | Open in IMG/M |
| 3300006025|Ga0075474_10042240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1565 | Open in IMG/M |
| 3300006025|Ga0075474_10100488 | Not Available | 934 | Open in IMG/M |
| 3300006025|Ga0075474_10103188 | Not Available | 919 | Open in IMG/M |
| 3300006025|Ga0075474_10145632 | Not Available | 745 | Open in IMG/M |
| 3300006025|Ga0075474_10168303 | Not Available | 682 | Open in IMG/M |
| 3300006025|Ga0075474_10169117 | Not Available | 680 | Open in IMG/M |
| 3300006025|Ga0075474_10239792 | Not Available | 547 | Open in IMG/M |
| 3300006026|Ga0075478_10172410 | Not Available | 668 | Open in IMG/M |
| 3300006026|Ga0075478_10191663 | Not Available | 626 | Open in IMG/M |
| 3300006026|Ga0075478_10218818 | Not Available | 578 | Open in IMG/M |
| 3300006027|Ga0075462_10097139 | Not Available | 916 | Open in IMG/M |
| 3300006027|Ga0075462_10145858 | Not Available | 724 | Open in IMG/M |
| 3300006637|Ga0075461_10028152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1851 | Open in IMG/M |
| 3300006637|Ga0075461_10040631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1519 | Open in IMG/M |
| 3300006637|Ga0075461_10156877 | Not Available | 695 | Open in IMG/M |
| 3300006637|Ga0075461_10172000 | Not Available | 656 | Open in IMG/M |
| 3300006802|Ga0070749_10011227 | All Organisms → cellular organisms → Bacteria | 5778 | Open in IMG/M |
| 3300006802|Ga0070749_10431840 | Not Available | 723 | Open in IMG/M |
| 3300006802|Ga0070749_10459929 | Not Available | 696 | Open in IMG/M |
| 3300006802|Ga0070749_10472068 | Not Available | 686 | Open in IMG/M |
| 3300006802|Ga0070749_10473383 | Not Available | 684 | Open in IMG/M |
| 3300006802|Ga0070749_10517227 | Not Available | 649 | Open in IMG/M |
| 3300006802|Ga0070749_10527402 | Not Available | 641 | Open in IMG/M |
| 3300006802|Ga0070749_10605804 | Not Available | 590 | Open in IMG/M |
| 3300006810|Ga0070754_10010660 | All Organisms → cellular organisms → Bacteria | 5789 | Open in IMG/M |
| 3300006810|Ga0070754_10030091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 3041 | Open in IMG/M |
| 3300006810|Ga0070754_10186606 | Not Available | 973 | Open in IMG/M |
| 3300006810|Ga0070754_10302468 | Not Available | 717 | Open in IMG/M |
| 3300006810|Ga0070754_10313921 | Not Available | 700 | Open in IMG/M |
| 3300006810|Ga0070754_10356385 | Not Available | 646 | Open in IMG/M |
| 3300006810|Ga0070754_10369576 | Not Available | 632 | Open in IMG/M |
| 3300006867|Ga0075476_10123520 | Not Available | 982 | Open in IMG/M |
| 3300006869|Ga0075477_10162430 | Not Available | 928 | Open in IMG/M |
| 3300006869|Ga0075477_10260491 | Not Available | 697 | Open in IMG/M |
| 3300006870|Ga0075479_10162467 | Not Available | 908 | Open in IMG/M |
| 3300006874|Ga0075475_10404573 | Not Available | 548 | Open in IMG/M |
| 3300006916|Ga0070750_10208193 | Not Available | 863 | Open in IMG/M |
| 3300006916|Ga0070750_10327059 | Not Available | 651 | Open in IMG/M |
| 3300006916|Ga0070750_10356225 | Not Available | 617 | Open in IMG/M |
| 3300006919|Ga0070746_10350846 | Not Available | 669 | Open in IMG/M |
| 3300006919|Ga0070746_10457414 | Not Available | 566 | Open in IMG/M |
| 3300007234|Ga0075460_10223012 | Not Available | 635 | Open in IMG/M |
| 3300007344|Ga0070745_1155316 | Not Available | 865 | Open in IMG/M |
| 3300007344|Ga0070745_1160958 | Not Available | 846 | Open in IMG/M |
| 3300007344|Ga0070745_1231116 | Not Available | 674 | Open in IMG/M |
| 3300007344|Ga0070745_1243249 | Not Available | 653 | Open in IMG/M |
| 3300007345|Ga0070752_1038878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
| 3300007345|Ga0070752_1219634 | Not Available | 750 | Open in IMG/M |
| 3300007345|Ga0070752_1282436 | Not Available | 637 | Open in IMG/M |
| 3300007345|Ga0070752_1335912 | Not Available | 569 | Open in IMG/M |
| 3300007346|Ga0070753_1026906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2494 | Open in IMG/M |
| 3300007346|Ga0070753_1117719 | Not Available | 1025 | Open in IMG/M |
| 3300007346|Ga0070753_1162891 | Not Available | 840 | Open in IMG/M |
| 3300007346|Ga0070753_1210986 | Not Available | 715 | Open in IMG/M |
| 3300007538|Ga0099851_1197892 | Not Available | 732 | Open in IMG/M |
| 3300007540|Ga0099847_1056163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1233 | Open in IMG/M |
| 3300007541|Ga0099848_1018443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3001 | Open in IMG/M |
| 3300007541|Ga0099848_1146757 | Not Available | 876 | Open in IMG/M |
| 3300007541|Ga0099848_1196903 | Not Available | 725 | Open in IMG/M |
| 3300007541|Ga0099848_1225579 | Not Available | 664 | Open in IMG/M |
| 3300007542|Ga0099846_1311107 | Not Available | 538 | Open in IMG/M |
| 3300007640|Ga0070751_1042112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2039 | Open in IMG/M |
| 3300007960|Ga0099850_1010713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4143 | Open in IMG/M |
| 3300007960|Ga0099850_1308277 | Not Available | 600 | Open in IMG/M |
| 3300008012|Ga0075480_10272439 | Not Available | 868 | Open in IMG/M |
| 3300008012|Ga0075480_10413307 | Not Available | 663 | Open in IMG/M |
| 3300009158|Ga0114977_10043576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2791 | Open in IMG/M |
| 3300010300|Ga0129351_1014374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3290 | Open in IMG/M |
| 3300010318|Ga0136656_1242461 | Not Available | 595 | Open in IMG/M |
| 3300010368|Ga0129324_10024298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2958 | Open in IMG/M |
| 3300010368|Ga0129324_10277972 | Not Available | 662 | Open in IMG/M |
| 3300017960|Ga0180429_10229615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1233 | Open in IMG/M |
| 3300017960|Ga0180429_10266343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Mobiluncus → Mobiluncus mulieris | 1139 | Open in IMG/M |
| 3300017960|Ga0180429_11243587 | Not Available | 511 | Open in IMG/M |
| 3300017963|Ga0180437_10037564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4758 | Open in IMG/M |
| 3300017963|Ga0180437_10081676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2811 | Open in IMG/M |
| 3300017963|Ga0180437_10510545 | Not Available | 885 | Open in IMG/M |
| 3300017963|Ga0180437_10695379 | Not Available | 737 | Open in IMG/M |
| 3300017963|Ga0180437_11028259 | Not Available | 589 | Open in IMG/M |
| 3300017987|Ga0180431_10044035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4113 | Open in IMG/M |
| 3300017987|Ga0180431_10049128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3831 | Open in IMG/M |
| 3300017987|Ga0180431_10054048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3594 | Open in IMG/M |
| 3300017987|Ga0180431_10121832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2106 | Open in IMG/M |
| 3300017987|Ga0180431_10287287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1208 | Open in IMG/M |
| 3300017987|Ga0180431_10298432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300017987|Ga0180431_10305612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. 73-92 | 1160 | Open in IMG/M |
| 3300017987|Ga0180431_10506538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 840 | Open in IMG/M |
| 3300017987|Ga0180431_10711256 | Not Available | 679 | Open in IMG/M |
| 3300017987|Ga0180431_10723780 | Not Available | 671 | Open in IMG/M |
| 3300017987|Ga0180431_10728687 | Not Available | 669 | Open in IMG/M |
| 3300017987|Ga0180431_10740680 | Not Available | 662 | Open in IMG/M |
| 3300017987|Ga0180431_10856489 | Not Available | 605 | Open in IMG/M |
| 3300017989|Ga0180432_10158880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1852 | Open in IMG/M |
| 3300017989|Ga0180432_10332751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. 73-92 | 1148 | Open in IMG/M |
| 3300017989|Ga0180432_10388407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300017989|Ga0180432_10433982 | Not Available | 968 | Open in IMG/M |
| 3300017989|Ga0180432_10776675 | Not Available | 666 | Open in IMG/M |
| 3300017989|Ga0180432_10780556 | Not Available | 664 | Open in IMG/M |
| 3300017989|Ga0180432_10914390 | Not Available | 601 | Open in IMG/M |
| 3300017989|Ga0180432_10940973 | Not Available | 591 | Open in IMG/M |
| 3300017990|Ga0180436_10596698 | Not Available | 822 | Open in IMG/M |
| 3300017991|Ga0180434_10909726 | Not Available | 662 | Open in IMG/M |
| 3300017991|Ga0180434_11097080 | Not Available | 597 | Open in IMG/M |
| 3300017992|Ga0180435_11118473 | Not Available | 673 | Open in IMG/M |
| 3300018065|Ga0180430_11214366 | Not Available | 530 | Open in IMG/M |
| 3300018080|Ga0180433_10031606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5295 | Open in IMG/M |
| 3300018080|Ga0180433_10549347 | Not Available | 872 | Open in IMG/M |
| 3300018080|Ga0180433_10842631 | Not Available | 675 | Open in IMG/M |
| 3300018080|Ga0180433_11341687 | Not Available | 516 | Open in IMG/M |
| 3300021425|Ga0213866_10122534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
| 3300021960|Ga0222715_10269830 | Not Available | 981 | Open in IMG/M |
| 3300021964|Ga0222719_10435240 | Not Available | 806 | Open in IMG/M |
| 3300022050|Ga0196883_1019660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 811 | Open in IMG/M |
| 3300022057|Ga0212025_1020456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Mobiluncus → Mobiluncus mulieris | 1070 | Open in IMG/M |
| 3300022068|Ga0212021_1028227 | Not Available | 1085 | Open in IMG/M |
| 3300022071|Ga0212028_1051286 | Not Available | 770 | Open in IMG/M |
| 3300022167|Ga0212020_1068464 | Not Available | 599 | Open in IMG/M |
| 3300022167|Ga0212020_1077967 | Not Available | 557 | Open in IMG/M |
| 3300022198|Ga0196905_1075839 | Not Available | 921 | Open in IMG/M |
| 3300022198|Ga0196905_1086468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300025610|Ga0208149_1026964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1599 | Open in IMG/M |
| 3300025610|Ga0208149_1043000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Mobiluncus → Mobiluncus mulieris | 1192 | Open in IMG/M |
| 3300025610|Ga0208149_1099095 | Not Available | 701 | Open in IMG/M |
| 3300025630|Ga0208004_1003515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5741 | Open in IMG/M |
| 3300025630|Ga0208004_1015372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2472 | Open in IMG/M |
| 3300025630|Ga0208004_1072759 | Not Available | 869 | Open in IMG/M |
| 3300025630|Ga0208004_1112164 | Not Available | 634 | Open in IMG/M |
| 3300025630|Ga0208004_1136995 | Not Available | 542 | Open in IMG/M |
| 3300025630|Ga0208004_1148686 | Not Available | 508 | Open in IMG/M |
| 3300025646|Ga0208161_1005745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5661 | Open in IMG/M |
| 3300025646|Ga0208161_1009730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4073 | Open in IMG/M |
| 3300025646|Ga0208161_1020998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2459 | Open in IMG/M |
| 3300025646|Ga0208161_1082385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 927 | Open in IMG/M |
| 3300025646|Ga0208161_1089494 | Not Available | 872 | Open in IMG/M |
| 3300025646|Ga0208161_1111327 | Not Available | 738 | Open in IMG/M |
| 3300025671|Ga0208898_1014508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3741 | Open in IMG/M |
| 3300025671|Ga0208898_1036354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1941 | Open in IMG/M |
| 3300025671|Ga0208898_1054291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1432 | Open in IMG/M |
| 3300025671|Ga0208898_1102655 | Not Available | 865 | Open in IMG/M |
| 3300025674|Ga0208162_1083773 | Not Available | 980 | Open in IMG/M |
| 3300025687|Ga0208019_1009729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4155 | Open in IMG/M |
| 3300025687|Ga0208019_1024157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2338 | Open in IMG/M |
| 3300025687|Ga0208019_1108606 | Not Available | 839 | Open in IMG/M |
| 3300025687|Ga0208019_1154063 | Not Available | 645 | Open in IMG/M |
| 3300025751|Ga0208150_1111720 | Not Available | 887 | Open in IMG/M |
| 3300025751|Ga0208150_1140464 | Not Available | 770 | Open in IMG/M |
| 3300025759|Ga0208899_1004704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8541 | Open in IMG/M |
| 3300025759|Ga0208899_1131062 | Not Available | 886 | Open in IMG/M |
| 3300025759|Ga0208899_1162753 | Not Available | 749 | Open in IMG/M |
| 3300025759|Ga0208899_1181793 | Not Available | 686 | Open in IMG/M |
| 3300025769|Ga0208767_1086404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1301 | Open in IMG/M |
| 3300025769|Ga0208767_1143059 | Not Available | 883 | Open in IMG/M |
| 3300025771|Ga0208427_1003143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6861 | Open in IMG/M |
| 3300025771|Ga0208427_1122127 | Not Available | 881 | Open in IMG/M |
| 3300025815|Ga0208785_1104495 | Not Available | 695 | Open in IMG/M |
| 3300025815|Ga0208785_1104990 | Not Available | 693 | Open in IMG/M |
| 3300025818|Ga0208542_1025383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 1969 | Open in IMG/M |
| 3300025818|Ga0208542_1136320 | Not Available | 677 | Open in IMG/M |
| 3300025818|Ga0208542_1156317 | Not Available | 617 | Open in IMG/M |
| 3300025828|Ga0208547_1022342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae | 2530 | Open in IMG/M |
| 3300025840|Ga0208917_1017634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3070 | Open in IMG/M |
| 3300025840|Ga0208917_1164314 | Not Available | 763 | Open in IMG/M |
| 3300025853|Ga0208645_1007997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6797 | Open in IMG/M |
| 3300025853|Ga0208645_1195955 | Not Available | 720 | Open in IMG/M |
| 3300025889|Ga0208644_1009679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6690 | Open in IMG/M |
| 3300025889|Ga0208644_1024860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3697 | Open in IMG/M |
| 3300027888|Ga0209635_10646897 | Not Available | 782 | Open in IMG/M |
| 3300031578|Ga0307376_10873149 | Not Available | 550 | Open in IMG/M |
| 3300034375|Ga0348336_099003 | Not Available | 994 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 71.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 21.97% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.31% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.16% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.58% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300017992 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0074648_10539551 | 3300005512 | Saline Water And Sediment | ELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS* |
| Ga0075474_100043481 | 3300006025 | Aqueous | PRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0075474_100141454 | 3300006025 | Aqueous | LLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0075474_100240713 | 3300006025 | Aqueous | RTPYPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075474_100422403 | 3300006025 | Aqueous | GTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS* |
| Ga0075474_101004883 | 3300006025 | Aqueous | GTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS* |
| Ga0075474_101031883 | 3300006025 | Aqueous | GTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS* |
| Ga0075474_101456323 | 3300006025 | Aqueous | GTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0075474_101683033 | 3300006025 | Aqueous | AELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075474_101691171 | 3300006025 | Aqueous | GTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075474_102397922 | 3300006025 | Aqueous | RTPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075478_101724102 | 3300006026 | Aqueous | PRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0075478_101916631 | 3300006026 | Aqueous | AELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0075478_102188181 | 3300006026 | Aqueous | AVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0075462_100971391 | 3300006027 | Aqueous | YPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075462_101458582 | 3300006027 | Aqueous | PYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0075461_100281521 | 3300006637 | Aqueous | RRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0075461_100406311 | 3300006637 | Aqueous | RTPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0075461_101568771 | 3300006637 | Aqueous | TPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075461_101720001 | 3300006637 | Aqueous | RRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS* |
| Ga0070749_100112271 | 3300006802 | Aqueous | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0070749_104318401 | 3300006802 | Aqueous | RGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS* |
| Ga0070749_104599291 | 3300006802 | Aqueous | PRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS* |
| Ga0070749_104720681 | 3300006802 | Aqueous | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQNRGKR* |
| Ga0070749_104733831 | 3300006802 | Aqueous | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR* |
| Ga0070749_105172271 | 3300006802 | Aqueous | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0070749_105274021 | 3300006802 | Aqueous | PRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070749_106058042 | 3300006802 | Aqueous | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070754_100106609 | 3300006810 | Aqueous | YPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0070754_100300911 | 3300006810 | Aqueous | ELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0070754_101866063 | 3300006810 | Aqueous | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070754_103024681 | 3300006810 | Aqueous | QLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS* |
| Ga0070754_103139213 | 3300006810 | Aqueous | AVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0070754_103563851 | 3300006810 | Aqueous | LAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070754_103695761 | 3300006810 | Aqueous | PYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0075476_101235203 | 3300006867 | Aqueous | RGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS* |
| Ga0075477_101624303 | 3300006869 | Aqueous | LAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0075477_102604913 | 3300006869 | Aqueous | VSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS* |
| Ga0075479_101624671 | 3300006870 | Aqueous | YPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0075475_104045732 | 3300006874 | Aqueous | VAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070750_102081931 | 3300006916 | Aqueous | RGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070750_103270592 | 3300006916 | Aqueous | RQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0070750_103562252 | 3300006916 | Aqueous | VAVGWWPPEIEFETKDLNTVVDVFEEQKKQQRVKH* |
| Ga0070746_103508461 | 3300006919 | Aqueous | TPYPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070746_104574142 | 3300006919 | Aqueous | GTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR* |
| Ga0075460_102230121 | 3300007234 | Aqueous | RGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070745_11553163 | 3300007344 | Aqueous | YPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070745_11609583 | 3300007344 | Aqueous | LAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070745_12311161 | 3300007344 | Aqueous | RTPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH* |
| Ga0070745_12432492 | 3300007344 | Aqueous | RGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0070752_10388781 | 3300007345 | Aqueous | QLAELLVAVSWSPPHKEFDLNDLNTVVDVIEEQKKQHGKR* |
| Ga0070752_12196343 | 3300007345 | Aqueous | RQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0070752_12824362 | 3300007345 | Aqueous | ELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0070752_13359121 | 3300007345 | Aqueous | LVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0070753_10269063 | 3300007346 | Aqueous | RRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070753_11177193 | 3300007346 | Aqueous | QLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070753_11628913 | 3300007346 | Aqueous | APYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0070753_12109861 | 3300007346 | Aqueous | ELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQNRGKR* |
| Ga0099851_11978923 | 3300007538 | Aqueous | QLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0099847_10561633 | 3300007540 | Aqueous | LAGVVWFPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR* |
| Ga0099848_10184434 | 3300007541 | Aqueous | RGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0099848_11467573 | 3300007541 | Aqueous | ELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQRVKH* |
| Ga0099848_11969031 | 3300007541 | Aqueous | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS* |
| Ga0099848_12255792 | 3300007541 | Aqueous | LLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0099846_13111071 | 3300007542 | Aqueous | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH* |
| Ga0070751_10421121 | 3300007640 | Aqueous | RRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR* |
| Ga0099850_10107135 | 3300007960 | Aqueous | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS* |
| Ga0099850_13082771 | 3300007960 | Aqueous | LAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHRVKH* |
| Ga0075480_102724393 | 3300008012 | Aqueous | QLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS* |
| Ga0075480_104133071 | 3300008012 | Aqueous | PRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH* |
| Ga0114977_100435761 | 3300009158 | Freshwater Lake | GRGTYRKQLAELLVSVGWWPPHIEFDTRDLSTVISVLNEQAKERRQR* |
| Ga0129351_10143741 | 3300010300 | Freshwater To Marine Saline Gradient | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQRVKH* |
| Ga0136656_12424611 | 3300010318 | Freshwater To Marine Saline Gradient | PRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR* |
| Ga0129324_100242981 | 3300010368 | Freshwater To Marine Saline Gradient | PYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH* |
| Ga0129324_102779722 | 3300010368 | Freshwater To Marine Saline Gradient | RRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH* |
| Ga0180429_102296151 | 3300017960 | Hypersaline Lake Sediment | PYPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKANGRRRS |
| Ga0180429_102663431 | 3300017960 | Hypersaline Lake Sediment | PRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQHRVKH |
| Ga0180429_112435871 | 3300017960 | Hypersaline Lake Sediment | PRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRSRS |
| Ga0180437_100375641 | 3300017963 | Hypersaline Lake Sediment | RRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQNRGTRH |
| Ga0180437_100816761 | 3300017963 | Hypersaline Lake Sediment | YPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH |
| Ga0180437_105105451 | 3300017963 | Hypersaline Lake Sediment | GTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180437_106953791 | 3300017963 | Hypersaline Lake Sediment | ELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0180437_110282591 | 3300017963 | Hypersaline Lake Sediment | QLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180431_100440351 | 3300017987 | Hypersaline Lake Sediment | PYPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0180431_100491281 | 3300017987 | Hypersaline Lake Sediment | ELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0180431_100540481 | 3300017987 | Hypersaline Lake Sediment | AVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR |
| Ga0180431_101218321 | 3300017987 | Hypersaline Lake Sediment | RRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0180431_102872873 | 3300017987 | Hypersaline Lake Sediment | RGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180431_102984321 | 3300017987 | Hypersaline Lake Sediment | TPYPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180431_103056121 | 3300017987 | Hypersaline Lake Sediment | PRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0180431_105065383 | 3300017987 | Hypersaline Lake Sediment | VAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0180431_107112561 | 3300017987 | Hypersaline Lake Sediment | PPYPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRSRS |
| Ga0180431_107237801 | 3300017987 | Hypersaline Lake Sediment | YPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQNRGTRH |
| Ga0180431_107286871 | 3300017987 | Hypersaline Lake Sediment | LAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQNRGKR |
| Ga0180431_107406801 | 3300017987 | Hypersaline Lake Sediment | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH |
| Ga0180431_108564891 | 3300017987 | Hypersaline Lake Sediment | YPRGTRRRQLAELLVAVSWWPPNIEFDLKDLNTVVDVIEEQKKQNGKR |
| Ga0180432_101588803 | 3300017989 | Hypersaline Lake Sediment | RAPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQNRGTRH |
| Ga0180432_103327511 | 3300017989 | Hypersaline Lake Sediment | RRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0180432_103884071 | 3300017989 | Hypersaline Lake Sediment | LLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0180432_104339823 | 3300017989 | Hypersaline Lake Sediment | AELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180432_107766751 | 3300017989 | Hypersaline Lake Sediment | LLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0180432_107805562 | 3300017989 | Hypersaline Lake Sediment | AVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0180432_109143902 | 3300017989 | Hypersaline Lake Sediment | AELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKANGRRRS |
| Ga0180432_109409731 | 3300017989 | Hypersaline Lake Sediment | QLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS |
| Ga0180436_105966981 | 3300017990 | Hypersaline Lake Sediment | QLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRSRS |
| Ga0180434_109097261 | 3300017991 | Hypersaline Lake Sediment | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQHRVKH |
| Ga0180434_110970802 | 3300017991 | Hypersaline Lake Sediment | GTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0180435_111184731 | 3300017992 | Hypersaline Lake Sediment | RQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0180430_112143662 | 3300018065 | Hypersaline Lake Sediment | RGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0180433_100316069 | 3300018080 | Hypersaline Lake Sediment | LAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH |
| Ga0180433_105493471 | 3300018080 | Hypersaline Lake Sediment | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0180433_108426311 | 3300018080 | Hypersaline Lake Sediment | GGMLGAGGWGAPEIEFETKDLNTVVDVLEDQKKQHRVKH |
| Ga0180433_113416871 | 3300018080 | Hypersaline Lake Sediment | ELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0213866_101225345 | 3300021425 | Seawater | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH |
| Ga0222715_102698301 | 3300021960 | Estuarine Water | YPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH |
| Ga0222719_104352403 | 3300021964 | Estuarine Water | RRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0196883_10196603 | 3300022050 | Aqueous | PELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0212025_10204563 | 3300022057 | Aqueous | RRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0212021_10282271 | 3300022068 | Aqueous | GTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR |
| Ga0212028_10512861 | 3300022071 | Aqueous | RQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0212020_10684641 | 3300022167 | Aqueous | GSRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0212020_10779671 | 3300022167 | Aqueous | RMLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH |
| Ga0196905_10758391 | 3300022198 | Aqueous | LVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0196905_10864682 | 3300022198 | Aqueous | LLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208149_10269643 | 3300025610 | Aqueous | RRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208149_10430001 | 3300025610 | Aqueous | GTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH |
| Ga0208149_10990951 | 3300025610 | Aqueous | TRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR |
| Ga0208004_10035151 | 3300025630 | Aqueous | QLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0208004_10153723 | 3300025630 | Aqueous | TRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208004_10727591 | 3300025630 | Aqueous | TRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0208004_11121642 | 3300025630 | Aqueous | VAVSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS |
| Ga0208004_11369951 | 3300025630 | Aqueous | LAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208004_11486862 | 3300025630 | Aqueous | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208161_10057459 | 3300025646 | Aqueous | RGTRRRQLAELLVAVGWWPPDIEFETKDLNTVVDVFEEQKKQQNRGKR |
| Ga0208161_10097301 | 3300025646 | Aqueous | QLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208161_10209981 | 3300025646 | Aqueous | ELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0208161_10823853 | 3300025646 | Aqueous | RGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208161_10894941 | 3300025646 | Aqueous | LLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQRVKH |
| Ga0208161_11113273 | 3300025646 | Aqueous | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208898_10145081 | 3300025671 | Aqueous | APYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208898_10363541 | 3300025671 | Aqueous | LLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0208898_10542913 | 3300025671 | Aqueous | YPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS |
| Ga0208898_11026553 | 3300025671 | Aqueous | YPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0208162_10837731 | 3300025674 | Aqueous | AELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH |
| Ga0208019_10097291 | 3300025687 | Aqueous | RRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0208019_10241571 | 3300025687 | Aqueous | QLAELLVAVGWWPPEIEFETKDLNTVVDVIEEQKKANGRSRS |
| Ga0208019_11086061 | 3300025687 | Aqueous | RRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQNRGKR |
| Ga0208019_11540631 | 3300025687 | Aqueous | AELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208150_11117201 | 3300025751 | Aqueous | GTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208150_11404643 | 3300025751 | Aqueous | AELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0208899_10047041 | 3300025759 | Aqueous | YPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208899_11310623 | 3300025759 | Aqueous | TPYPRGTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANGRHRS |
| Ga0208899_11627533 | 3300025759 | Aqueous | RQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208899_11817931 | 3300025759 | Aqueous | RQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208767_10864043 | 3300025769 | Aqueous | YPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208767_11430593 | 3300025769 | Aqueous | RRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS |
| Ga0208427_100314311 | 3300025771 | Aqueous | LVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208427_11221273 | 3300025771 | Aqueous | QLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQRVKH |
| Ga0208785_11044952 | 3300025815 | Aqueous | LAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKANGRHRS |
| Ga0208785_11049902 | 3300025815 | Aqueous | PRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208542_10253833 | 3300025818 | Aqueous | RTPYPRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208542_11363201 | 3300025818 | Aqueous | LAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKANVGHRS |
| Ga0208542_11563171 | 3300025818 | Aqueous | TRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0208547_10223421 | 3300025828 | Aqueous | GTRRRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208917_10176341 | 3300025840 | Aqueous | PRGTRRRQLAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208917_11643141 | 3300025840 | Aqueous | VAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGRSRS |
| Ga0208645_100799711 | 3300025853 | Aqueous | PYPRGTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQQKQQNRGKR |
| Ga0208645_11959553 | 3300025853 | Aqueous | LAELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQQRVKH |
| Ga0208644_100967911 | 3300025889 | Aqueous | GTRRRQLAELLVAVGWWPPEIEFETKDLNTVVDVLEEQKKQQNRGKR |
| Ga0208644_10248601 | 3300025889 | Aqueous | RRQLAELLVAVSWWPPHIEFDLKDLNTVVDVIEEQKKQHGKR |
| Ga0209635_106468973 | 3300027888 | Marine Sediment | AELLVAVSWWPPQIEFDLKDLNTVVDVIEEQKKQNRGTRH |
| Ga0307376_108731491 | 3300031578 | Soil | LVAVSWWPPQIEFDLKDLNTVVDVIEEQKKANGKR |
| Ga0348336_099003_874_993 | 3300034375 | Aqueous | ELLVAVGWWPPEIEFETKDLNTVVDVFEEQKKQQNRGKR |
| ⦗Top⦘ |