


| Basic Information | |
|---|---|
| Family ID | F034495 |
| Family Type | Metagenome |
| Number of Sequences | 174 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MDRLNKFFDLTLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 174 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.46 % |
| % of genes near scaffold ends (potentially truncated) | 27.59 % |
| % of genes from short scaffolds (< 2000 bps) | 73.56 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (6.897 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (25.287 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 174 Family Scaffolds |
|---|---|---|
| PF02900 | LigB | 39.08 |
| PF07746 | LigA | 5.17 |
| PF00106 | adh_short | 2.30 |
| PF13561 | adh_short_C2 | 1.72 |
| PF02955 | GSH-S_ATP | 1.72 |
| PF01476 | LysM | 1.72 |
| PF00730 | HhH-GPD | 1.15 |
| PF03401 | TctC | 0.57 |
| PF04199 | Cyclase | 0.57 |
| PF02566 | OsmC | 0.57 |
| PF00221 | Lyase_aromatic | 0.57 |
| PF04075 | F420H2_quin_red | 0.57 |
| PF00872 | Transposase_mut | 0.57 |
| PF13185 | GAF_2 | 0.57 |
| PF02518 | HATPase_c | 0.57 |
| PF03994 | DUF350 | 0.57 |
| PF00753 | Lactamase_B | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 174 Family Scaffolds |
|---|---|---|---|
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 3.45 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.15 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.15 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.15 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.15 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.15 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.57 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.57 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.57 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.57 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.57 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.31 % |
| Unclassified | root | N/A | 20.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16772991 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0803079 | All Organisms → cellular organisms → Bacteria | 5307 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101682023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2208 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101686008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3168 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1002004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3260 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1047460 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300000789|JGI1027J11758_12956141 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1006530 | Not Available | 1653 | Open in IMG/M |
| 3300002104|C687J26621_10099669 | Not Available | 935 | Open in IMG/M |
| 3300002120|C687J26616_10280336 | Not Available | 509 | Open in IMG/M |
| 3300002122|C687J26623_10006967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2739 | Open in IMG/M |
| 3300002485|C687J35088_10242710 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300003373|JGI25407J50210_10026616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1500 | Open in IMG/M |
| 3300003911|JGI25405J52794_10005472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2291 | Open in IMG/M |
| 3300003987|Ga0055471_10052070 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300003994|Ga0055435_10231856 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300003995|Ga0055438_10087448 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300003998|Ga0055472_10027097 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300004062|Ga0055500_10155557 | Not Available | 543 | Open in IMG/M |
| 3300004070|Ga0055488_10008392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1632 | Open in IMG/M |
| 3300004267|Ga0066396_10024551 | Not Available | 839 | Open in IMG/M |
| 3300004463|Ga0063356_100981637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300004782|Ga0062382_10433520 | Not Available | 623 | Open in IMG/M |
| 3300004808|Ga0062381_10298627 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005167|Ga0066672_10012906 | All Organisms → cellular organisms → Bacteria | 4112 | Open in IMG/M |
| 3300005169|Ga0066810_10016069 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005175|Ga0066673_10057916 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300005213|Ga0068998_10161458 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005289|Ga0065704_10014784 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300005289|Ga0065704_10715256 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005295|Ga0065707_10010905 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300005332|Ga0066388_100051530 | All Organisms → cellular organisms → Bacteria | 4234 | Open in IMG/M |
| 3300005332|Ga0066388_102394567 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005445|Ga0070708_100039204 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300005445|Ga0070708_100327780 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300005445|Ga0070708_101522955 | Not Available | 623 | Open in IMG/M |
| 3300005454|Ga0066687_10202734 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005467|Ga0070706_100149111 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300005468|Ga0070707_100140313 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300005471|Ga0070698_100641375 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005713|Ga0066905_101307683 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005830|Ga0074473_10145690 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005833|Ga0074472_10133620 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005898|Ga0075276_10126334 | Not Available | 576 | Open in IMG/M |
| 3300005937|Ga0081455_10203561 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300006049|Ga0075417_10024329 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300006845|Ga0075421_101619111 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006847|Ga0075431_100272263 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300006853|Ga0075420_100241456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1571 | Open in IMG/M |
| 3300006853|Ga0075420_101854651 | Not Available | 515 | Open in IMG/M |
| 3300006854|Ga0075425_100220807 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300006854|Ga0075425_100972488 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006876|Ga0079217_10309812 | Not Available | 880 | Open in IMG/M |
| 3300007076|Ga0075435_100583082 | Not Available | 969 | Open in IMG/M |
| 3300007076|Ga0075435_101568733 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300007790|Ga0105679_10386734 | Not Available | 1088 | Open in IMG/M |
| 3300009012|Ga0066710_100748387 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300009053|Ga0105095_10370591 | Not Available | 790 | Open in IMG/M |
| 3300009081|Ga0105098_10316624 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300009137|Ga0066709_100741332 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300009156|Ga0111538_10517670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1512 | Open in IMG/M |
| 3300009156|Ga0111538_13847779 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009157|Ga0105092_10037374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2587 | Open in IMG/M |
| 3300009167|Ga0113563_10218849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1910 | Open in IMG/M |
| 3300009168|Ga0105104_10746932 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009444|Ga0114945_10097587 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300009444|Ga0114945_10160387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300009801|Ga0105056_1008719 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300009807|Ga0105061_1030575 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300010043|Ga0126380_10073677 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300010046|Ga0126384_10072320 | Not Available | 2454 | Open in IMG/M |
| 3300010046|Ga0126384_10121285 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300010046|Ga0126384_11360827 | Not Available | 660 | Open in IMG/M |
| 3300010046|Ga0126384_11425205 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010336|Ga0134071_10018391 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
| 3300010358|Ga0126370_10281015 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300010359|Ga0126376_13046514 | Not Available | 518 | Open in IMG/M |
| 3300010366|Ga0126379_11162727 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010376|Ga0126381_104822197 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010391|Ga0136847_12223786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2362 | Open in IMG/M |
| 3300010396|Ga0134126_12809503 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300011269|Ga0137392_10481950 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300011430|Ga0137423_1011103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2835 | Open in IMG/M |
| 3300011432|Ga0137428_1002797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5984 | Open in IMG/M |
| 3300011445|Ga0137427_10035130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1971 | Open in IMG/M |
| 3300012160|Ga0137349_1026094 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012205|Ga0137362_10139303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2068 | Open in IMG/M |
| 3300012361|Ga0137360_10894265 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012930|Ga0137407_11251812 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012930|Ga0137407_12134930 | Not Available | 535 | Open in IMG/M |
| 3300012931|Ga0153915_10175280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2341 | Open in IMG/M |
| 3300012931|Ga0153915_10238610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2009 | Open in IMG/M |
| 3300012931|Ga0153915_11578506 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300012931|Ga0153915_13426217 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012948|Ga0126375_11932224 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012964|Ga0153916_10006942 | All Organisms → cellular organisms → Bacteria | 8779 | Open in IMG/M |
| 3300012964|Ga0153916_10708880 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300012971|Ga0126369_11476386 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300014873|Ga0180066_1009951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1613 | Open in IMG/M |
| 3300014876|Ga0180064_1028204 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300014882|Ga0180069_1123497 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300014885|Ga0180063_1256622 | Not Available | 558 | Open in IMG/M |
| 3300016387|Ga0182040_11003926 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300018052|Ga0184638_1054401 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300018053|Ga0184626_10001880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7543 | Open in IMG/M |
| 3300018054|Ga0184621_10312190 | Not Available | 554 | Open in IMG/M |
| 3300018063|Ga0184637_10072395 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300018068|Ga0184636_1115016 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300018073|Ga0184624_10127385 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300018075|Ga0184632_10134148 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300018077|Ga0184633_10016776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3576 | Open in IMG/M |
| 3300018081|Ga0184625_10438503 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018422|Ga0190265_10558950 | Not Available | 1261 | Open in IMG/M |
| 3300018422|Ga0190265_11936374 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300018422|Ga0190265_12782194 | Not Available | 584 | Open in IMG/M |
| 3300018468|Ga0066662_10004018 | All Organisms → cellular organisms → Bacteria | 7122 | Open in IMG/M |
| 3300020060|Ga0193717_1075418 | Not Available | 1116 | Open in IMG/M |
| 3300020583|Ga0210401_10466697 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300021063|Ga0206227_1022759 | Not Available | 1041 | Open in IMG/M |
| 3300021432|Ga0210384_10185457 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300021560|Ga0126371_10177938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2209 | Open in IMG/M |
| 3300022563|Ga0212128_10851052 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025119|Ga0209126_1028889 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300025157|Ga0209399_10097753 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300025159|Ga0209619_10469625 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025174|Ga0209324_10530615 | Not Available | 707 | Open in IMG/M |
| 3300025289|Ga0209002_10121100 | Not Available | 1698 | Open in IMG/M |
| 3300025289|Ga0209002_10328721 | Not Available | 891 | Open in IMG/M |
| 3300025314|Ga0209323_10290175 | Not Available | 1027 | Open in IMG/M |
| 3300025319|Ga0209520_10153446 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300025324|Ga0209640_10219854 | Not Available | 1610 | Open in IMG/M |
| 3300025327|Ga0209751_10966439 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300025792|Ga0210143_1046453 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025922|Ga0207646_10625241 | Not Available | 966 | Open in IMG/M |
| 3300026452|Ga0256821_1017627 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300026548|Ga0209161_10101777 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300027006|Ga0209896_1012282 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300027056|Ga0209879_1032800 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027330|Ga0207777_1098905 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027513|Ga0208685_1006218 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300027654|Ga0209799_1002189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3866 | Open in IMG/M |
| 3300027722|Ga0209819_10001138 | All Organisms → cellular organisms → Bacteria | 8083 | Open in IMG/M |
| 3300027722|Ga0209819_10212390 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027862|Ga0209701_10047363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2767 | Open in IMG/M |
| 3300027873|Ga0209814_10000740 | All Organisms → cellular organisms → Bacteria | 11066 | Open in IMG/M |
| 3300027911|Ga0209698_10880206 | Not Available | 673 | Open in IMG/M |
| 3300027917|Ga0209536_100038057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6441 | Open in IMG/M |
| 3300027961|Ga0209853_1151763 | Not Available | 560 | Open in IMG/M |
| 3300030006|Ga0299907_10101001 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300031228|Ga0299914_10074262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2947 | Open in IMG/M |
| 3300031228|Ga0299914_10843250 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031229|Ga0299913_10945582 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031474|Ga0170818_100638420 | Not Available | 596 | Open in IMG/M |
| 3300031754|Ga0307475_10605235 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031820|Ga0307473_10022390 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300031947|Ga0310909_10321087 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300031949|Ga0214473_10035577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5848 | Open in IMG/M |
| 3300031965|Ga0326597_10001823 | All Organisms → cellular organisms → Bacteria | 33014 | Open in IMG/M |
| 3300031965|Ga0326597_10087517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3814 | Open in IMG/M |
| 3300031965|Ga0326597_10539922 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031965|Ga0326597_11987534 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032180|Ga0307471_100832083 | Not Available | 1090 | Open in IMG/M |
| 3300032205|Ga0307472_100992214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300032770|Ga0335085_10124174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3288 | Open in IMG/M |
| 3300032770|Ga0335085_10323446 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300032783|Ga0335079_10273259 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300032893|Ga0335069_10138246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3031 | Open in IMG/M |
| 3300033433|Ga0326726_10385901 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300033433|Ga0326726_11633204 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300033433|Ga0326726_11804559 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300033814|Ga0364930_0271850 | Not Available | 572 | Open in IMG/M |
| 3300034148|Ga0364927_0004187 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300034165|Ga0364942_0163898 | Not Available | 724 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.87% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.30% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.72% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.15% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.15% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.57% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.57% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.57% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.57% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.57% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300002104 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002485 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01320870 | 2088090014 | Soil | MDRINKYFDLTMRYALEPGVNWVIDHPILSVLVVVALVYWSVRGYRML |
| ICChiseqgaiiDRAFT_08030793 | 3300000033 | Soil | MDRLEKLFDYTLRYALEPGLNWVIAHPIVSVIVVFVLVYWSVRGYRML* |
| INPhiseqgaiiFebDRAFT_1016820234 | 3300000364 | Soil | MDRLTKGFDFTMRYVLEPSVNWVIDHPLISVAVVIALVFWSVRGYRMI* |
| INPhiseqgaiiFebDRAFT_1016860083 | 3300000364 | Soil | MDRINKYFDLTMRYALEPGVNWVIDHPILSVLVVVALVYWSVRGYRML* |
| AF_2010_repII_A01DRAFT_10020041 | 3300000580 | Forest Soil | MHRIDKYFDLTMRYALEPGVNWVIDHPILSVLVVVALVYWSVRGYRML* |
| AF_2010_repII_A01DRAFT_10474601 | 3300000580 | Forest Soil | MDRLSKLLDLSLRYVFEPGLHWVLXHPIXSVVVVVXLVYWSVRGYRIL* |
| JGI1027J11758_129561412 | 3300000789 | Soil | MRFXEXGATHMDRLNKFLDLTMRYALEPGLTWVLEHPVISVVAVIALVYWSVRGYRIL* |
| AP72_2010_repI_A100DRAFT_10065301 | 3300000837 | Forest Soil | MDRIEKYFDLTMRYALEPGVNWVIDHPILSVLVVVALVYWSVRGYRML* |
| C687J26621_100996693 | 3300002104 | Groundwater | MRHLEKLFDLSLRYVFEPGLNWVIDHPVVAVVAVVGLVYWSVRGYRMI* |
| C687J26616_102803362 | 3300002120 | Soil | MRSIEKFFDLSLRYVFEPGLNWVIDHPAIAVVAVVGLVYWSVRGYRII* |
| C687J26623_100069675 | 3300002122 | Soil | WPMRHLEKLFDLSLRYVFEPGLNWVIDHPVVAVVAVVGLVYWSVRGYRMI* |
| C687J35088_102427101 | 3300002485 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRMI* |
| JGI25407J50210_100266163 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MDRINKAFDLTLRYVFEPGLNWVLEHPFISVVVVVTLVYWAVRGYRIL* |
| JGI25405J52794_100054724 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MDRLSKLLDLSLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0055471_100520702 | 3300003987 | Natural And Restored Wetlands | MDRLNKFFDLSMRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0055435_102318562 | 3300003994 | Natural And Restored Wetlands | DLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRMI* |
| Ga0055438_100874482 | 3300003995 | Natural And Restored Wetlands | MDRISKYFDLTMRYALEPGVNWVIDHPILSVLVFVALVYWSVRGYRIL* |
| Ga0055472_100270972 | 3300003998 | Natural And Restored Wetlands | MDRLNKFFDLSLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0055500_101555572 | 3300004062 | Natural And Restored Wetlands | MRSIEKFFDLSVRYVFEPGLNWVVDHPAIAVAVVVGLVYWSVRGYRMI* |
| Ga0055488_100083921 | 3300004070 | Natural And Restored Wetlands | EVCSKKGALDMDRLNKFFDLSLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0066396_100245511 | 3300004267 | Tropical Forest Soil | MDRIDKYFDLTMRYALEPGVNWVIDHPIVSVLVVVALVYWSVRGYRML* |
| Ga0063356_1009816371 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDRVEKLFDLALRYFFEPGLNWVLDHAIISVVLVVALVYWSVRGYRML* |
| Ga0062382_104335201 | 3300004782 | Wetland Sediment | MDRLTKFFDLTQRYVLDPGVNWVIDHPIIAVLAVVAMVFWSMRGYRIL* |
| Ga0062381_102986271 | 3300004808 | Wetland Sediment | TKFFDLTQRYVLDPGVNWVIDHPIIAVLAVVAMVFWSMRGYRIL* |
| Ga0066672_100129063 | 3300005167 | Soil | MDQITRLFDLLLQHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYRML* |
| Ga0066810_100160692 | 3300005169 | Soil | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVVLVYWSVRGYRIL* |
| Ga0066673_100579163 | 3300005175 | Soil | MDQISRLFDLLLRHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYRML* |
| Ga0068998_101614582 | 3300005213 | Natural And Restored Wetlands | LGSSKKGAIMDRLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIM* |
| Ga0065704_100147841 | 3300005289 | Switchgrass Rhizosphere | MDRLGKFFNLTLRYVFEPGLNWVLEHPIISVVVVVTLVYWAVRGYRIL* |
| Ga0065704_107152562 | 3300005289 | Switchgrass Rhizosphere | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0065707_100109054 | 3300005295 | Switchgrass Rhizosphere | MDRLGKFFNLTLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0066388_1000515302 | 3300005332 | Tropical Forest Soil | MERLSKLLDLTLRYVLEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0066388_1023945672 | 3300005332 | Tropical Forest Soil | SRLGGSKKGAIMDRLSKLLDLSLRYVFEPGLNWVLEHPIISVVVVVSLVYWSVRGYRIL* |
| Ga0070708_1000392046 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML* |
| Ga0070708_1003277802 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRINKYFDLTMRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI* |
| Ga0070708_1015229551 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRLNKFLDLTMRYALEPGLTWVLEHPVISVVVVVALVYWSVRGYRIL* |
| Ga0066687_102027342 | 3300005454 | Soil | SRLFDLLLRHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYKML* |
| Ga0070706_1001491114 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRITKYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML* |
| Ga0070707_1001403131 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRITKYFDLTMRYVLEPGVNWVIAHPILSLIVVVALVFWSVRGYRML* |
| Ga0070698_1006413752 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRINKYFDLTLRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI* |
| Ga0066905_1013076832 | 3300005713 | Tropical Forest Soil | MDRLGKLLDLSLRYVFEPGLNWVLEHPIISVVVVVSLVYWSVRGYRIL* |
| Ga0074473_101456902 | 3300005830 | Sediment (Intertidal) | MDYLEKLFDLSLRYVFEPGLNWVIDHPLVAVVIVVGLVYWSVRGYRMI* |
| Ga0074472_101336201 | 3300005833 | Sediment (Intertidal) | GEGLGMNEIGRVFDLGFRYVFEPGLNWVLDHPIISLLVVGVLVFWSMRGYRML* |
| Ga0075276_101263341 | 3300005898 | Rice Paddy Soil | MDDISRLIDLGLRYVFEPSLNWVLAHPLISLLVVVGLVYWSARGYRML* |
| Ga0081455_102035612 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDRINKAFDLTLRYVFEPGLNWVLEHPFISVVVVVVLVYWSVRGYRIL* |
| Ga0075417_100243295 | 3300006049 | Populus Rhizosphere | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVLLVYWSVRGYRIL* |
| Ga0075421_1016191112 | 3300006845 | Populus Rhizosphere | LSDSKKGARYMERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVLLVYWSVRGYRIL* |
| Ga0075431_1002722633 | 3300006847 | Populus Rhizosphere | MDRLEKLFDYTLRYALEPGLNWVIAHPIISVVVVFILVYWQ* |
| Ga0075420_1002414561 | 3300006853 | Populus Rhizosphere | KGLRMDRLEKLFDYTLRYALEPGLNWVIAHPIISVVVVFILVYWSVRGYRML* |
| Ga0075420_1018546511 | 3300006853 | Populus Rhizosphere | MDRLEKLFDYTLRYALEPGLNWVIAHPIISVVVVFILVYWSVRGYR |
| Ga0075425_1002208071 | 3300006854 | Populus Rhizosphere | MDKLTKFFDLSLRYVFEPGLNWVIDHPLISVVVVVALVYWSVRGYRMI* |
| Ga0075425_1009724881 | 3300006854 | Populus Rhizosphere | LTMRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI* |
| Ga0079217_103098121 | 3300006876 | Agricultural Soil | MDRLEKLFDYTLRYALEPGLNWVIAHPIISVVVVFILVYWSVRGYRML* |
| Ga0075435_1005830821 | 3300007076 | Populus Rhizosphere | MRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI* |
| Ga0075435_1015687331 | 3300007076 | Populus Rhizosphere | KKGARYMERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVVLVYWSVRGYRIL* |
| Ga0105679_103867341 | 3300007790 | Soil | MDRLEKIFGYALRYVFEPSLNWVIDHPIISVLFVITLVYWSVRGYRIL* |
| Ga0066710_1007483872 | 3300009012 | Grasslands Soil | MDKLTKLFDATLRYVLEPGLNWVIDHPLISVAVVIALVYWSVRGYRMI |
| Ga0105095_103705911 | 3300009053 | Freshwater Sediment | MNHLERLFNLSLRHVFEPGLNWVLDHPIVSVAVVAILIYWSVRGYRML* |
| Ga0105098_103166242 | 3300009081 | Freshwater Sediment | MDRINKLFELSLRYVFEPGLNWVLDHPVISVVVVVTLVYWAVRGYRIL* |
| Ga0066709_1007413321 | 3300009137 | Grasslands Soil | GGSKKGAPIMDRLNKFFDLSLRYVLEPGLNWVLEHPIISVVVVVGLVYWSVRGYRIL* |
| Ga0111538_105176704 | 3300009156 | Populus Rhizosphere | RKGLRMDRLEKLFDYTLRYALEPGLNWVIAHPIVSVIVVFVLVYWSVRGYRML* |
| Ga0111538_138477791 | 3300009156 | Populus Rhizosphere | RYALEPGLNWVLEHPIISVVVVVVLVYWSVRGYRIL* |
| Ga0105092_100373743 | 3300009157 | Freshwater Sediment | MDRINKVFELSLRYVFEPGLNWVLDHPIISVVVVVTLVYWAVRGYRIL* |
| Ga0113563_102188492 | 3300009167 | Freshwater Wetlands | MRYLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRMI* |
| Ga0105104_107469322 | 3300009168 | Freshwater Sediment | MDRLGKFFDLTLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0114945_100975873 | 3300009444 | Thermal Springs | MDYINKLFNLALRYVFEPGLNWVLDNPIISVLIVVGLVYWAVRGYRIL* |
| Ga0114945_101603874 | 3300009444 | Thermal Springs | MDYISKLFNLGLRYVFEPGLNWVLDNPIISVLLVVGLVYWAVRGYRIL* |
| Ga0105056_10087192 | 3300009801 | Groundwater Sand | MDRINKFFDLSLRYVFEPGLLWVLEHPIISVVVVVALVYWSVRGYRIM* |
| Ga0105061_10305751 | 3300009807 | Groundwater Sand | MDRINKFFDLSLRYVFEPGLIWVLEHPIISVVVVVALVYWSVRGYRIM* |
| Ga0126380_100736772 | 3300010043 | Tropical Forest Soil | MDRIDKYFNLTMRYALEPGVNWVIDHPIVSVLVVVALVYWSVRGYRML* |
| Ga0126384_100723201 | 3300010046 | Tropical Forest Soil | MDRLSKLLDLSLRYVFEPGLHWVLEHPIISVVVVVSLVYWSVRGYRIL* |
| Ga0126384_101212853 | 3300010046 | Tropical Forest Soil | MDRIDKYFNLTMRYALEPGVNWVIDHPILSVLVVVALVYWSVRGYRML* |
| Ga0126384_113608272 | 3300010046 | Tropical Forest Soil | MDRLSKLLDLSLRYVFEPGLHWVLEHPIISVVVVVSLVYWSV |
| Ga0126384_114252052 | 3300010046 | Tropical Forest Soil | KKGAIMDRLSKLLDLSLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0134071_100183912 | 3300010336 | Grasslands Soil | MDQISRLFDLLLQHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYRML* |
| Ga0126370_102810151 | 3300010358 | Tropical Forest Soil | MDQITKYFDLAMRYILEPSVDWVIAHPIITVIAVVALVYWSMRGYRML* |
| Ga0126376_130465141 | 3300010359 | Tropical Forest Soil | MDQITKYFDLAMRYVLEPSVDWVIAHPISTVIAVVALVYWSMRGYRML* |
| Ga0126379_111627272 | 3300010366 | Tropical Forest Soil | MDQITKYFDVAMRYVLEPSVDWVIAHPIITVIAVVALVYWSMRGYRML* |
| Ga0126381_1048221972 | 3300010376 | Tropical Forest Soil | VFEPGLHWVLEHPIISVVVVVSLVYWSVRGYRIL* |
| Ga0136847_122237865 | 3300010391 | Freshwater Sediment | MRHLEKFFDLSLRYVFEPGLNWVIDHPAITVVAVVGLLYWAVRGYRMI* |
| Ga0134126_128095031 | 3300010396 | Terrestrial Soil | MNRLSKVFDGAVRYVFEPGLNWVIDHPVISVAAVIFLVYWSVRGYRMI* |
| Ga0137392_104819502 | 3300011269 | Vadose Zone Soil | KELCMDRINKYFDLTMRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI* |
| Ga0137423_10111034 | 3300011430 | Soil | MERLNNFFDLSLRYVLEQGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0137428_10027975 | 3300011432 | Soil | MERLNNFFDLSLRYVLEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0137427_100351301 | 3300011445 | Soil | HKEVYSKKGAPDMERLNNFFDLSLRYVLEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0137349_10260942 | 3300012160 | Soil | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSLRGYRIL* |
| Ga0137362_101393033 | 3300012205 | Vadose Zone Soil | MDRLNKFLDLTMRYALEPGLTWVLEHPVISVVVVIALVYWSVRGYRIL* |
| Ga0137360_108942651 | 3300012361 | Vadose Zone Soil | MDRIIKYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML* |
| Ga0137407_112518122 | 3300012930 | Vadose Zone Soil | LSDSKKGARYMERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVVLVYWSVRGYRIL* |
| Ga0137407_121349301 | 3300012930 | Vadose Zone Soil | MDRLSKFFDLSLRYVLEPGLNWVLEHPIISVVVVIALVYWS |
| Ga0153915_101752804 | 3300012931 | Freshwater Wetlands | MRYLEKLFDLSLRYVFEPGLNWVIDHPVVAVVAVVGLVYWSVRGYRMI* |
| Ga0153915_102386104 | 3300012931 | Freshwater Wetlands | MDMISKLVDLGLRYVFEPGLNWVLDHPIISLLVVAGLVYWAARGYRMR* |
| Ga0153915_115785061 | 3300012931 | Freshwater Wetlands | MDDISRLIDLGLRYVFEPGLNWVLDHPIISLLVVAGLVYWSARGYRML* |
| Ga0153915_134262171 | 3300012931 | Freshwater Wetlands | YIFEPSLNWVLDHPVISLLVVVGLVYWSARGYRML* |
| Ga0126375_119322241 | 3300012948 | Tropical Forest Soil | KKGAIMDRLSKLLDLSLRYVFEPGLHWVLEHPIISVVVVVSLVYWSVRGYRIL* |
| Ga0153916_1000694210 | 3300012964 | Freshwater Wetlands | MNYLERLFDLSLRYVFEPGLNWVIDHPIVAVAIVVGLVYWSVRGYRMI* |
| Ga0153916_107088802 | 3300012964 | Freshwater Wetlands | MDNISRLIDLGLRYVFEPGLNWVLEHPIISLLVVVGLVYWSARGYRML* |
| Ga0126369_114763862 | 3300012971 | Tropical Forest Soil | LSLRYVFEPGLHWVLEHPIISVVVVVSLVYGSVRGYRIL* |
| Ga0180066_10099511 | 3300014873 | Soil | MRHIEKFFDLSLRYVFEPGLNWVIDHPAIAVVAVVGLVYWSVRGYRML* |
| Ga0180064_10282042 | 3300014876 | Soil | FFDLSLRYVLEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL* |
| Ga0180069_11234971 | 3300014882 | Soil | MRHLEKFFDLSLLYVFEPGLNWVIDHPAIAVVAVVGLVYWSVRGYRML* |
| Ga0180063_12566221 | 3300014885 | Soil | MRSIEKFFDLSLRYVFEPGLNWVIDHPTIAVVAVVGLVYWAVRGYRMI* |
| Ga0182040_110039262 | 3300016387 | Soil | RYAFEPGLNWVLAHPIISVVVVVALVYWSVRGYRIL |
| Ga0184638_10544012 | 3300018052 | Groundwater Sediment | MRHLEKFFDLSLRYVFEPGLNWVIDHPAVTVVAVVGLLYWAVRGYRML |
| Ga0184626_100018804 | 3300018053 | Groundwater Sediment | MDRLNKFFDLTLRYVFEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0184621_103121901 | 3300018054 | Groundwater Sediment | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0184637_100723954 | 3300018063 | Groundwater Sediment | MRHLEKLFDLSLRYVFEPGLHWVIDHPAIAVVAVVGLVYWSVRGYRML |
| Ga0184636_11150161 | 3300018068 | Groundwater Sediment | MRYLEKFFDLSLRYVFEPGLNWVIDHPAITVVAVVGLLYWAVRGYRML |
| Ga0184624_101273851 | 3300018073 | Groundwater Sediment | MERLNKFFDITLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0184632_101341481 | 3300018075 | Groundwater Sediment | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYW |
| Ga0184633_100167761 | 3300018077 | Groundwater Sediment | MRHIEKFFDLSLRYVFEPGLHWVIDHPAIAVVAVVGLVYWSVRGYRML |
| Ga0184625_104385032 | 3300018081 | Groundwater Sediment | FDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0190265_105589504 | 3300018422 | Soil | MNHLERFYNFSLRHVFEPGLNWVIDHPIVSVAGVVVLIYWSVRNYRML |
| Ga0190265_119363742 | 3300018422 | Soil | MDRLEKLFDYTLRYALEPGLNWVIAHPIVSVVVVFILVYWSVRGYRML |
| Ga0190265_127821941 | 3300018422 | Soil | MDRLEKFFDYTLRYALEPGLNWVIAHPIVSVVVVFMLVYWSVRGYRML |
| Ga0066662_100040181 | 3300018468 | Grasslands Soil | MDQITRLFDLLLQHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYRML |
| Ga0193717_10754183 | 3300020060 | Soil | MKHLEKFYDMSLRYIFEPGLNWVIAHPIISVVVVVVLVYWSVRNYRML |
| Ga0210401_104666971 | 3300020583 | Soil | MDRITKYFDLTMRYVLEPGVNWVIAHPILSLVVVVALVFWSVRGYRML |
| Ga0206227_10227591 | 3300021063 | Deep Subsurface Sediment | MRHLEKFFDLSLRYVFEPGLNWVIDHPAVAVVAIVGLVYWS |
| Ga0210384_101854572 | 3300021432 | Soil | MDRITKYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML |
| Ga0126371_101779381 | 3300021560 | Tropical Forest Soil | MDRLSKLLDLSLRYVFEPGLHWVLEHPIISVVVVVSLVYWSVRGYRIL |
| Ga0212128_108510522 | 3300022563 | Thermal Springs | KRLGMDYINKLFNLALRYVFEPGLNWVLDNPIISVLIVVGLVYWAVRGYRIL |
| Ga0209126_10288892 | 3300025119 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRMI |
| Ga0209399_100977531 | 3300025157 | Thermal Springs | MDYISKLFNLGLRYVFEPGLNWVLDNPIISVLIVVGLVYWAVRGYRIL |
| Ga0209619_104696251 | 3300025159 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYQ |
| Ga0209324_105306151 | 3300025174 | Soil | MRSIEKFFDLSLRYVFEPGLNWVIDHPAIAVVAVVGLVYWSVRGYRII |
| Ga0209002_101211002 | 3300025289 | Soil | MRFIEKFFDLSLRYVFEPGLNWVIDHPAIAVVVVVGLLYWAVRGYRMI |
| Ga0209002_103287213 | 3300025289 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRM |
| Ga0209323_102901751 | 3300025314 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPVVAVVAVVGLVYW |
| Ga0209520_101534462 | 3300025319 | Soil | MDYLERLVDLSLRYVFEPGLNWVIDHPLVAVVIVVGLVYWSVRGYRMI |
| Ga0209640_102198541 | 3300025324 | Soil | MRSIEKFFDLSLRYVFEPGLNWVIDHPVIAVVAVVGLVYWSVRGYRMI |
| Ga0209751_109664392 | 3300025327 | Soil | IEKFFDLSLRYVFEPGLNWVIDHPAIAVVVVVGLLYWAVRGYRMI |
| Ga0210143_10464531 | 3300025792 | Natural And Restored Wetlands | MDRLNKFFDLSLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0207646_106252411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRINKYFDLTMRYVLEPGVNWVIDHPILSVVVVVALVYWSVRGYRMI |
| Ga0256821_10176271 | 3300026452 | Sediment | MDQIGKLLDFGLRYVFEPGLNWVLDHPIISLLIVVGLVYWAARGYRML |
| Ga0209161_101017771 | 3300026548 | Soil | MDQISRLFDLLLQHALEPGLNWVLDHPIVSVVVVVVLVYWSVRGYRML |
| Ga0209896_10122821 | 3300027006 | Groundwater Sand | IMDRINKFFDLSLRYVFEPGLLWVLEHPIISVVVVVALVYWSVRGYRIM |
| Ga0209879_10328001 | 3300027056 | Groundwater Sand | MDRINKFFDLSLRYVFEPGLLWVLEHPIISVVVVVALVYWSVRGYRIM |
| Ga0207777_10989052 | 3300027330 | Tropical Forest Soil | MDTISRLMELGLRYVFEPGLNWVLDHPIISLLAVAGLVYWAARGYRLL |
| Ga0208685_10062186 | 3300027513 | Soil | MERLNNFFDLSLRYVLEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0209799_10021896 | 3300027654 | Tropical Forest Soil | MDRIDKYFNLTMRYALEPGVNWVIDHPIVSVLVVVALVYWSVRGYRML |
| Ga0209819_100011386 | 3300027722 | Freshwater Sediment | MDRINKVFELSLRYVFEPGLNWVLDHPIISVVVVVTLVYWAVRGYRIL |
| Ga0209819_102123901 | 3300027722 | Freshwater Sediment | SRFFELSLRYVFEPGLNWVLDHPVISVVVVVTLVYWAVRGYRIL |
| Ga0209701_100473632 | 3300027862 | Vadose Zone Soil | MRYVLEPGVNWVIDHPILSVVLVVALVYWSVRGYRMI |
| Ga0209814_100007404 | 3300027873 | Populus Rhizosphere | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVLLVYWSVRGYRIL |
| Ga0209698_108802061 | 3300027911 | Watersheds | MDTISRLIDLGSRYVFEPGLDWVLDHPIISVLVVVGLVYWSVRGYRML |
| Ga0209536_1000380579 | 3300027917 | Marine Sediment | MNRIEKFFDLAMRYVFDPGLNWVLEHPIISVVVVVALVFWAVRGYRML |
| Ga0209853_11517631 | 3300027961 | Groundwater Sand | MDRINKFFDLSLRYVFEPGLLWVLEHPIISVVVVVALVYWSVRGYR |
| Ga0299907_101010015 | 3300030006 | Soil | MDRVEKLFDMVLRYVLEPGLNWVIHHPIVSVVVVFVLVYWSVRGYRML |
| Ga0299914_100742624 | 3300031228 | Soil | MDRLSKLFDYALKYMLEPGLNWVIDHPIISLIGVFVLVYWSVRGYRMI |
| Ga0299914_108432502 | 3300031228 | Soil | MDRISKLFDYALKYMLEPGLNWVIEHPIVSVIGVFVLVYWSVRGYRMI |
| Ga0299913_109455822 | 3300031229 | Soil | KLFDMVLRYVLEPGLNWVIHHPIVSVVVVFVLVYWSVRGYRML |
| Ga0170818_1006384201 | 3300031474 | Forest Soil | MDRIIKYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML |
| Ga0307475_106052351 | 3300031754 | Hardwood Forest Soil | RYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRML |
| Ga0307473_100223903 | 3300031820 | Hardwood Forest Soil | MERLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVVLVYWSVRGYRIL |
| Ga0310909_103210872 | 3300031947 | Soil | MDRLSKFFDLTFRYAFEPGLNWVLAHPIISVVVVVALVYWSVRGYRIL |
| Ga0214473_100355774 | 3300031949 | Soil | MRSIEKFFDLSLRYVFEPGLDWVIDHPAITVVAVVGLVYWAVRGYRMI |
| Ga0326597_1000182313 | 3300031965 | Soil | MRHLEKLFDLSLRYVFEPGLNWVIDHPAIAVVAVVGLVYWSVRGYRMI |
| Ga0326597_100875175 | 3300031965 | Soil | MRSIEKFFDLSLRYVFEPGLNWVIDHPAIAVAAVVGLVYWSVRGYRMI |
| Ga0326597_105399222 | 3300031965 | Soil | MDQIARLLNLATRHVFEPAFDWVLAHPIISVLVVIGLIYWSVRGYRML |
| Ga0326597_119875342 | 3300031965 | Soil | RPMRSIEKFFDLSLRYVFEPGLNWVIDHPVIAVVAVVGLVYWSVRGYRMI |
| Ga0315910_102657992 | 3300032144 | Soil | MNHLERLYNLSLRYVFEPGLNWVIDHPIVSVAVVVALIYFSVRNYRML |
| Ga0307471_1008320832 | 3300032180 | Hardwood Forest Soil | MDRITKYFDLTMRYVLEPGVNWVIAHPILSLAVVVALVFWSVRGYRM |
| Ga0307472_1009922141 | 3300032205 | Hardwood Forest Soil | MDRLNKFLDLTMRYALEPGLTWVLEHPVISVVVVIALVYWSVRGYRI |
| Ga0335085_101241741 | 3300032770 | Soil | MDKMLDRLGNAFDVTLRYVLEPGMEWVIDHPIISVAVVAGLIYWSVRGYRML |
| Ga0335085_103234462 | 3300032770 | Soil | MDQITKYFDLAMRYVLEPGVDWVIAHPIITLIAVVALVYWSVRGYRML |
| Ga0335079_102732593 | 3300032783 | Soil | MDRITKYFDLAMRYVLEPSVDWVIAHPIITVIVVLALVYWSVRGYRML |
| Ga0335069_101382466 | 3300032893 | Soil | EPAEELCMDRITKYFDLAMRYVLEPSVDWVIAHPIITVIVVLALVYWSVRGYRML |
| Ga0326726_103859012 | 3300033433 | Peat Soil | KGAIMDRLNKFFDLTLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0326726_116332041 | 3300033433 | Peat Soil | MRYLEKLFDLSLRYVFEPGLNWVIDHPAVAVVAVVGLVYWSVRGYRMI |
| Ga0326726_118045591 | 3300033433 | Peat Soil | MDKISKLIDLGLRYVFEPGLNWVLEHPIISLVVVVVLVYWSARGYRML |
| Ga0364930_0271850_202_348 | 3300033814 | Sediment | MRHLEKFFDLSLLYVFEPGLNWVIDHPAIAVVAIVGLVYWSVRGYRMI |
| Ga0364927_0004187_1008_1154 | 3300034148 | Sediment | MERLNNFFDLSLRYALEPGLNWVLEHPIISVVVVVALVYWSVRGYRIL |
| Ga0364942_0163898_601_723 | 3300034165 | Sediment | MRHLEKFFDLSLLYVFEPGLNWVIDHPAIAVVAIVGLVYWS |
| ⦗Top⦘ |