


| Basic Information | |
|---|---|
| Family ID | F034368 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSGKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.86 % |
| % of genes near scaffold ends (potentially truncated) | 45.14 % |
| % of genes from short scaffolds (< 2000 bps) | 86.29 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 82.22% β-sheet: 0.00% Coil/Unstructured: 17.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 20.57 |
| PF00571 | CBS | 2.86 |
| PF03401 | TctC | 2.29 |
| PF00903 | Glyoxalase | 1.71 |
| PF13714 | PEP_mutase | 1.71 |
| PF00190 | Cupin_1 | 1.14 |
| PF09839 | DUF2066 | 1.14 |
| PF00578 | AhpC-TSA | 1.14 |
| PF01522 | Polysacc_deac_1 | 1.14 |
| PF03972 | MmgE_PrpD | 1.14 |
| PF13531 | SBP_bac_11 | 1.14 |
| PF00346 | Complex1_49kDa | 1.14 |
| PF00216 | Bac_DNA_binding | 1.14 |
| PF04657 | DMT_YdcZ | 0.57 |
| PF02627 | CMD | 0.57 |
| PF00582 | Usp | 0.57 |
| PF01152 | Bac_globin | 0.57 |
| PF06186 | DUF992 | 0.57 |
| PF01042 | Ribonuc_L-PSP | 0.57 |
| PF03060 | NMO | 0.57 |
| PF04966 | OprB | 0.57 |
| PF14067 | LssY_C | 0.57 |
| PF03492 | Methyltransf_7 | 0.57 |
| PF00230 | MIP | 0.57 |
| PF07485 | DUF1529 | 0.57 |
| PF13659 | Obsolete Pfam Family | 0.57 |
| PF08448 | PAS_4 | 0.57 |
| PF01058 | Oxidored_q6 | 0.57 |
| PF00210 | Ferritin | 0.57 |
| PF02518 | HATPase_c | 0.57 |
| PF13417 | GST_N_3 | 0.57 |
| PF01192 | RNA_pol_Rpb6 | 0.57 |
| PF13505 | OMP_b-brl | 0.57 |
| PF01988 | VIT1 | 0.57 |
| PF07311 | Dodecin | 0.57 |
| PF01370 | Epimerase | 0.57 |
| PF03466 | LysR_substrate | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 20.57 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.29 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 1.14 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.14 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.14 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 1.14 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.57 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.57 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.57 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.57 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.57 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.57 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.57 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.57 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.57 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.57 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.57 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.57 |
| COG3238 | Uncharacterized membrane protein YdcZ, DUF606 family | Function unknown [S] | 0.57 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.57 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.57 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.29 % |
| Unclassified | root | N/A | 41.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1048863 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300000955|JGI1027J12803_100185144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1772 | Open in IMG/M |
| 3300001431|F14TB_100777175 | Not Available | 565 | Open in IMG/M |
| 3300004009|Ga0055437_10144265 | Not Available | 734 | Open in IMG/M |
| 3300004019|Ga0055439_10212364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU65207 | 622 | Open in IMG/M |
| 3300004479|Ga0062595_100747602 | Not Available | 795 | Open in IMG/M |
| 3300004633|Ga0066395_10124843 | Not Available | 1275 | Open in IMG/M |
| 3300005093|Ga0062594_101320856 | Not Available | 725 | Open in IMG/M |
| 3300005163|Ga0066823_10122795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300005165|Ga0066869_10008729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1338 | Open in IMG/M |
| 3300005173|Ga0066822_1001534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1037 | Open in IMG/M |
| 3300005205|Ga0068999_10124452 | Not Available | 531 | Open in IMG/M |
| 3300005206|Ga0068995_10103362 | Not Available | 582 | Open in IMG/M |
| 3300005218|Ga0068996_10020973 | Not Available | 1056 | Open in IMG/M |
| 3300005328|Ga0070676_10020855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3664 | Open in IMG/M |
| 3300005328|Ga0070676_11591664 | Not Available | 505 | Open in IMG/M |
| 3300005332|Ga0066388_100404716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2010 | Open in IMG/M |
| 3300005332|Ga0066388_100875204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300005332|Ga0066388_102155494 | Not Available | 1004 | Open in IMG/M |
| 3300005332|Ga0066388_104927876 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005332|Ga0066388_105230846 | Not Available | 658 | Open in IMG/M |
| 3300005332|Ga0066388_108780594 | Not Available | 502 | Open in IMG/M |
| 3300005334|Ga0068869_101957725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300005339|Ga0070660_101039293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 693 | Open in IMG/M |
| 3300005434|Ga0070709_11214485 | Not Available | 606 | Open in IMG/M |
| 3300005437|Ga0070710_10299695 | Not Available | 1049 | Open in IMG/M |
| 3300005439|Ga0070711_100690620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 859 | Open in IMG/M |
| 3300005441|Ga0070700_101809205 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005457|Ga0070662_100150396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1812 | Open in IMG/M |
| 3300005466|Ga0070685_11087183 | Not Available | 604 | Open in IMG/M |
| 3300005713|Ga0066905_100040933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 190 | 2745 | Open in IMG/M |
| 3300005718|Ga0068866_10396086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300005764|Ga0066903_106176958 | Not Available | 626 | Open in IMG/M |
| 3300005764|Ga0066903_107142511 | Not Available | 578 | Open in IMG/M |
| 3300005841|Ga0068863_100015305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7372 | Open in IMG/M |
| 3300005937|Ga0081455_10377932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 991 | Open in IMG/M |
| 3300006041|Ga0075023_100185153 | Not Available | 793 | Open in IMG/M |
| 3300006047|Ga0075024_100017065 | Not Available | 2918 | Open in IMG/M |
| 3300006047|Ga0075024_100088187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa palsarum | 1346 | Open in IMG/M |
| 3300006047|Ga0075024_100267249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 827 | Open in IMG/M |
| 3300006047|Ga0075024_100420856 | Not Available | 684 | Open in IMG/M |
| 3300006049|Ga0075417_10540161 | Not Available | 589 | Open in IMG/M |
| 3300006050|Ga0075028_100134415 | Not Available | 1294 | Open in IMG/M |
| 3300006057|Ga0075026_100202545 | Not Available | 1045 | Open in IMG/M |
| 3300006163|Ga0070715_10269691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300006175|Ga0070712_100332941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1237 | Open in IMG/M |
| 3300006175|Ga0070712_100376370 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300006904|Ga0075424_100570485 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006914|Ga0075436_101159795 | Not Available | 583 | Open in IMG/M |
| 3300009011|Ga0105251_10060448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1784 | Open in IMG/M |
| 3300009094|Ga0111539_11398306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300009094|Ga0111539_11593206 | Not Available | 757 | Open in IMG/M |
| 3300009101|Ga0105247_10049357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2587 | Open in IMG/M |
| 3300009101|Ga0105247_10220200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1284 | Open in IMG/M |
| 3300009156|Ga0111538_11015949 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300009156|Ga0111538_11261318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300009162|Ga0075423_10067543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3708 | Open in IMG/M |
| 3300009174|Ga0105241_10051972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3127 | Open in IMG/M |
| 3300009177|Ga0105248_10060324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4258 | Open in IMG/M |
| 3300009177|Ga0105248_10106133 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
| 3300009177|Ga0105248_12191910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 629 | Open in IMG/M |
| 3300009551|Ga0105238_10294819 | Not Available | 1605 | Open in IMG/M |
| 3300009792|Ga0126374_10302080 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009792|Ga0126374_10956524 | Not Available | 668 | Open in IMG/M |
| 3300010043|Ga0126380_11927871 | Not Available | 538 | Open in IMG/M |
| 3300010047|Ga0126382_10383757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1090 | Open in IMG/M |
| 3300010358|Ga0126370_10020329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3804 | Open in IMG/M |
| 3300010366|Ga0126379_11201682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 864 | Open in IMG/M |
| 3300010366|Ga0126379_12810609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300010376|Ga0126381_100527443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1670 | Open in IMG/M |
| 3300010396|Ga0134126_10247160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2112 | Open in IMG/M |
| 3300010397|Ga0134124_11004768 | Not Available | 846 | Open in IMG/M |
| 3300010397|Ga0134124_12888840 | Not Available | 524 | Open in IMG/M |
| 3300012208|Ga0137376_11552398 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012512|Ga0157327_1093770 | Not Available | 502 | Open in IMG/M |
| 3300012948|Ga0126375_11373852 | Not Available | 597 | Open in IMG/M |
| 3300012957|Ga0164303_11528641 | Not Available | 505 | Open in IMG/M |
| 3300012960|Ga0164301_10043040 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300012960|Ga0164301_11895237 | Not Available | 504 | Open in IMG/M |
| 3300012985|Ga0164308_11578478 | Not Available | 605 | Open in IMG/M |
| 3300012988|Ga0164306_10489815 | Not Available | 943 | Open in IMG/M |
| 3300012988|Ga0164306_11085319 | Not Available | 664 | Open in IMG/M |
| 3300013100|Ga0157373_10698732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 743 | Open in IMG/M |
| 3300013297|Ga0157378_11455879 | Not Available | 729 | Open in IMG/M |
| 3300014324|Ga0075352_1092609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300014325|Ga0163163_11021264 | Not Available | 890 | Open in IMG/M |
| 3300015371|Ga0132258_10576976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2822 | Open in IMG/M |
| 3300015371|Ga0132258_11474774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1718 | Open in IMG/M |
| 3300015372|Ga0132256_101283848 | Not Available | 845 | Open in IMG/M |
| 3300015372|Ga0132256_101409624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300015372|Ga0132256_101889918 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300015373|Ga0132257_100370771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1734 | Open in IMG/M |
| 3300015373|Ga0132257_101529119 | Not Available | 852 | Open in IMG/M |
| 3300015374|Ga0132255_100611003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1613 | Open in IMG/M |
| 3300015374|Ga0132255_105990875 | Not Available | 514 | Open in IMG/M |
| 3300017939|Ga0187775_10356955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300017944|Ga0187786_10196877 | Not Available | 763 | Open in IMG/M |
| 3300017947|Ga0187785_10000286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19140 | Open in IMG/M |
| 3300017947|Ga0187785_10006307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3934 | Open in IMG/M |
| 3300017974|Ga0187777_10101364 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300018000|Ga0184604_10212629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300018028|Ga0184608_10462489 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300018029|Ga0187787_10122859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 856 | Open in IMG/M |
| 3300018054|Ga0184621_10209492 | Not Available | 698 | Open in IMG/M |
| 3300018060|Ga0187765_10032328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2593 | Open in IMG/M |
| 3300018060|Ga0187765_10610843 | Not Available | 705 | Open in IMG/M |
| 3300018072|Ga0184635_10024112 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300018073|Ga0184624_10505949 | Not Available | 525 | Open in IMG/M |
| 3300018074|Ga0184640_10261144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300018076|Ga0184609_10066613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1569 | Open in IMG/M |
| 3300019875|Ga0193701_1032900 | Not Available | 1064 | Open in IMG/M |
| 3300019879|Ga0193723_1021874 | Not Available | 1955 | Open in IMG/M |
| 3300020006|Ga0193735_1103582 | Not Available | 791 | Open in IMG/M |
| 3300021344|Ga0193719_10280288 | Not Available | 701 | Open in IMG/M |
| 3300021344|Ga0193719_10380491 | Not Available | 584 | Open in IMG/M |
| 3300021510|Ga0222621_1120661 | Not Available | 558 | Open in IMG/M |
| 3300021560|Ga0126371_10769556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1109 | Open in IMG/M |
| 3300021560|Ga0126371_11512463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 799 | Open in IMG/M |
| 3300021560|Ga0126371_11675281 | Not Available | 760 | Open in IMG/M |
| 3300022694|Ga0222623_10083397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1240 | Open in IMG/M |
| 3300022756|Ga0222622_10059232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2200 | Open in IMG/M |
| 3300025735|Ga0207713_1157558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300025903|Ga0207680_10047161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2551 | Open in IMG/M |
| 3300025903|Ga0207680_10055345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2390 | Open in IMG/M |
| 3300025905|Ga0207685_10683278 | Not Available | 557 | Open in IMG/M |
| 3300025919|Ga0207657_10287458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1304 | Open in IMG/M |
| 3300025921|Ga0207652_10295288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1462 | Open in IMG/M |
| 3300025932|Ga0207690_10188960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
| 3300025933|Ga0207706_10609292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 937 | Open in IMG/M |
| 3300025944|Ga0207661_10715889 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025955|Ga0210071_1047344 | Not Available | 549 | Open in IMG/M |
| 3300026035|Ga0207703_10401898 | Not Available | 1271 | Open in IMG/M |
| 3300026095|Ga0207676_10305287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1454 | Open in IMG/M |
| 3300026452|Ga0256821_1003286 | Not Available | 1450 | Open in IMG/M |
| 3300027907|Ga0207428_10804449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300027915|Ga0209069_10069945 | Not Available | 1666 | Open in IMG/M |
| 3300028717|Ga0307298_10117290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300028755|Ga0307316_10355675 | Not Available | 539 | Open in IMG/M |
| 3300028784|Ga0307282_10067774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1617 | Open in IMG/M |
| 3300028787|Ga0307323_10283957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300028796|Ga0307287_10250886 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300028811|Ga0307292_10057830 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300028814|Ga0307302_10406967 | Not Available | 673 | Open in IMG/M |
| 3300028875|Ga0307289_10298291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300028876|Ga0307286_10376357 | Not Available | 531 | Open in IMG/M |
| 3300028885|Ga0307304_10241972 | Not Available | 783 | Open in IMG/M |
| 3300030844|Ga0075377_11671680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300030945|Ga0075373_11530115 | Not Available | 622 | Open in IMG/M |
| 3300031057|Ga0170834_102095664 | Not Available | 862 | Open in IMG/M |
| 3300031199|Ga0307495_10015379 | Not Available | 1207 | Open in IMG/M |
| 3300031199|Ga0307495_10252667 | Not Available | 508 | Open in IMG/M |
| 3300031226|Ga0307497_10396371 | Not Available | 658 | Open in IMG/M |
| 3300031231|Ga0170824_104458227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2256 | Open in IMG/M |
| 3300031231|Ga0170824_105532591 | Not Available | 777 | Open in IMG/M |
| 3300031231|Ga0170824_109033627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 809 | Open in IMG/M |
| 3300031421|Ga0308194_10041320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300031421|Ga0308194_10295991 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031446|Ga0170820_12594508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2304 | Open in IMG/M |
| 3300031469|Ga0170819_14098213 | Not Available | 1193 | Open in IMG/M |
| 3300031720|Ga0307469_11288132 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031720|Ga0307469_11508332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300031740|Ga0307468_100613978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 891 | Open in IMG/M |
| 3300031747|Ga0318502_10878209 | Not Available | 545 | Open in IMG/M |
| 3300031779|Ga0318566_10095193 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300031796|Ga0318576_10409937 | Not Available | 640 | Open in IMG/M |
| 3300031858|Ga0310892_10751964 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032013|Ga0310906_10003487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5173 | Open in IMG/M |
| 3300032052|Ga0318506_10054869 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300032174|Ga0307470_10170268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1357 | Open in IMG/M |
| 3300032179|Ga0310889_10052798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1595 | Open in IMG/M |
| 3300033412|Ga0310810_10358111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1531 | Open in IMG/M |
| 3300033433|Ga0326726_10204291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1824 | Open in IMG/M |
| 3300033433|Ga0326726_10236307 | Not Available | 1697 | Open in IMG/M |
| 3300034090|Ga0326723_0040516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1956 | Open in IMG/M |
| 3300034090|Ga0326723_0146418 | Not Available | 1036 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005173 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10488632 | 3300000655 | Forest Soil | SGKATAFVVGVLLXSLFWIVLAQQSYCTGSFADWLKMGDVEECR* |
| JGI1027J12803_1001851443 | 3300000955 | Soil | MSGKATSFVAGVLLASMFWIVLAQQSYCAGGLADWLKMGDVEECR* |
| F14TB_1007771751 | 3300001431 | Soil | MSVRATWFVGGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0055437_101442651 | 3300004009 | Natural And Restored Wetlands | MSGKAMAFLAGVLLASMFWIALAQQNYCTGSLADWLHMGDVEECR* |
| Ga0055439_102123641 | 3300004019 | Natural And Restored Wetlands | MAFLAGVLLASMFWIALAQQNYCTGSLADWLHMGDVEECR* |
| Ga0062595_1007476022 | 3300004479 | Soil | MSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0066395_101248432 | 3300004633 | Tropical Forest Soil | MSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR* |
| Ga0062594_1013208562 | 3300005093 | Soil | MSGKAAAFVAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEECR* |
| Ga0066823_101227951 | 3300005163 | Soil | EGELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0066869_100087292 | 3300005165 | Soil | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0066822_10015342 | 3300005173 | Soil | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEEC |
| Ga0068999_101244521 | 3300005205 | Natural And Restored Wetlands | MSGKAMAFLAGVLLASMFWIVLAQQNYCTGSLADYLHMGDVEECR* |
| Ga0068995_101033621 | 3300005206 | Natural And Restored Wetlands | MGGKAMAFLAGVLLASMFWIALAQQNYCTGSLANWLHMGDVEEGR* |
| Ga0068996_100209732 | 3300005218 | Natural And Restored Wetlands | MAFLAGVLLASMFWIVLAQQNYCTGSLADYLHMGDVEECR* |
| Ga0070676_100208552 | 3300005328 | Miscanthus Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0070676_115916641 | 3300005328 | Miscanthus Rhizosphere | MSGKAAAFVAGVLLASMFWIVLAQQSYCAGSLADWLKIGDVEECR* |
| Ga0066388_1004047162 | 3300005332 | Tropical Forest Soil | MGGKVTAFVAGVLLASLFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0066388_1008752041 | 3300005332 | Tropical Forest Soil | MSGKVTAFVAGVLLASLFWIVLAQQSYCAGSFADWLKMGDVEECR* |
| Ga0066388_1021554941 | 3300005332 | Tropical Forest Soil | MSGKVTAFVAGVLLASLFWIVLAHQSYCVGSLADWLKMGDVEECR* |
| Ga0066388_1049278762 | 3300005332 | Tropical Forest Soil | LTMSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0066388_1052308462 | 3300005332 | Tropical Forest Soil | MSGKAVAFVAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEECR* |
| Ga0066388_1087805941 | 3300005332 | Tropical Forest Soil | MSGKATAFVAGVLLASLFWIVLAQQGYCTGSLADWLQIGDVEECQ* |
| Ga0068869_1019577252 | 3300005334 | Miscanthus Rhizosphere | TAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0070660_1010392931 | 3300005339 | Corn Rhizosphere | MSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEEC |
| Ga0070709_112144851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKAAAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0070710_102996952 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKAAAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0070711_1006906202 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0070700_1018092051 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | CISDSEGELDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0070662_1001503963 | 3300005457 | Corn Rhizosphere | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0070685_110871832 | 3300005466 | Switchgrass Rhizosphere | MRGKTTAFVAGVLLASMFWIVLAQQRYCTGGFADWLKMGDIEECR* |
| Ga0066905_1000409334 | 3300005713 | Tropical Forest Soil | MSGKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0068866_103960862 | 3300005718 | Miscanthus Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSIADW |
| Ga0066903_1061769581 | 3300005764 | Tropical Forest Soil | ADIRKRSYNLTMSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR* |
| Ga0066903_1071425112 | 3300005764 | Tropical Forest Soil | MCSAKRHVRPTPIADTRWRDYNVIMSGKVTAFVAGVLLASLFWIVLAQLSYCAGSLADWLHMGDVEECR* |
| Ga0068863_1000153059 | 3300005841 | Switchgrass Rhizosphere | MSGKMTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0081455_103779322 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0075023_1001851532 | 3300006041 | Watersheds | MGGKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0075024_1000170652 | 3300006047 | Watersheds | MSGKAMAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0075024_1000881872 | 3300006047 | Watersheds | MSKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0075024_1002672492 | 3300006047 | Watersheds | MSGKATAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0075024_1004208562 | 3300006047 | Watersheds | VSGKAMAFLAGVLLASMFWIVLAQQSYCTGSLADWLHMGDVEECR* |
| Ga0075417_105401612 | 3300006049 | Populus Rhizosphere | FWGGKLTMSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0075028_1001344151 | 3300006050 | Watersheds | VAGVLLASMFWIVLAQQSYCAGSVADWLHMGDVEECR* |
| Ga0075026_1002025452 | 3300006057 | Watersheds | VSGKAMAFLAGVLLASMFWIALAQQNYCTGSLADWLHMGDVEECR* |
| Ga0070715_102696912 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDV |
| Ga0070712_1003329413 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKAMSFLAGVLLASMFWIVLAQQNYCTGGLADWLKMGDVEECR* |
| Ga0070712_1003763701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EGELTMSGKATAFVAGVLLASMFWIVLAQQSYCTGSLADWLHMGDVEECR* |
| Ga0075424_1005704851 | 3300006904 | Populus Rhizosphere | SGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0075436_1011597952 | 3300006914 | Populus Rhizosphere | MRGKATAFVAGVLLASMFWIVLAQQRYCTGGFADWLKMGDIEECR* |
| Ga0105251_100604482 | 3300009011 | Switchgrass Rhizosphere | LGGISDSEGELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0111539_113983061 | 3300009094 | Populus Rhizosphere | LGGTSGWKGELDMSGKMTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0111539_115932061 | 3300009094 | Populus Rhizosphere | MSGHAAAFVAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEECR* |
| Ga0105247_100493574 | 3300009101 | Switchgrass Rhizosphere | MSGKMTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0105247_102202002 | 3300009101 | Switchgrass Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHM |
| Ga0111538_110159493 | 3300009156 | Populus Rhizosphere | MRGKTTAFVAGVLLASMFWIVLAQQRYCTGGFADWLKMGDIEEC |
| Ga0111538_112613181 | 3300009156 | Populus Rhizosphere | ELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0075423_100675435 | 3300009162 | Populus Rhizosphere | MGSFPATRFAFFWGGKLTMSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0105241_100519724 | 3300009174 | Corn Rhizosphere | GGISDSEGELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0105248_100603241 | 3300009177 | Switchgrass Rhizosphere | LTMSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0105248_101061334 | 3300009177 | Switchgrass Rhizosphere | MRGKATAFVAGVLLASMFWIVLAQQMYCTGGFADWLKMGDIEECR* |
| Ga0105248_121919101 | 3300009177 | Switchgrass Rhizosphere | MSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHM |
| Ga0105238_102948193 | 3300009551 | Corn Rhizosphere | AGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0126374_103020801 | 3300009792 | Tropical Forest Soil | GELTMSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0126374_109565243 | 3300009792 | Tropical Forest Soil | RREYNPTMRGKATAFVLGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR* |
| Ga0126380_119278711 | 3300010043 | Tropical Forest Soil | MSVRVTWFVAGVLLASMFWIVLAHQSYCAGSLADWLHMGDVEECQ* |
| Ga0126382_103837572 | 3300010047 | Tropical Forest Soil | ATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0126370_100203293 | 3300010358 | Tropical Forest Soil | VAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEQGR* |
| Ga0126379_112016821 | 3300010366 | Tropical Forest Soil | FVAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEECR* |
| Ga0126379_128106092 | 3300010366 | Tropical Forest Soil | MSGRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0126381_1005274432 | 3300010376 | Tropical Forest Soil | MSGKATAFVVGVLLASLFWIVLAQQSYCTGSWADWLKIGDVEECR* |
| Ga0134126_102471602 | 3300010396 | Terrestrial Soil | LGGTSGWKGELDMSGKMTAFVAGVLLASLFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0134124_110047681 | 3300010397 | Terrestrial Soil | KAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0134124_128888401 | 3300010397 | Terrestrial Soil | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDV |
| Ga0137376_115523981 | 3300012208 | Vadose Zone Soil | MSKATVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0157327_10937701 | 3300012512 | Arabidopsis Rhizosphere | MRGKLTAFVAGVLIASMVWIALAQQSYCVGGLADWLHIGDVEECR* |
| Ga0126375_113738522 | 3300012948 | Tropical Forest Soil | MSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLQMGDVEECP* |
| Ga0164303_115286411 | 3300012957 | Soil | AFVAGVLLASMFWIVLAQQNYCAGSLADWLHMGDVEECR* |
| Ga0164301_100430402 | 3300012960 | Soil | MSGKAIAFVAGVLLASMFWIVLAQQNYCAGSLADWLHMGDVEECR* |
| Ga0164301_118952371 | 3300012960 | Soil | MSGKAAAFVAGVLLASMFWIVLAQQSYCAGSLADGLKMGDVEECR* |
| Ga0164308_115784781 | 3300012985 | Soil | AGVLLASMFWIVLAQQNYCAGSLADWLHMGDVEECR* |
| Ga0164306_104898151 | 3300012988 | Soil | MSGKAAAFVAGVLLASMFWIVLAQQSYCTGSLADWVHMGDVGEGR* |
| Ga0164306_110853191 | 3300012988 | Soil | LTMSGKATAFVAGVLLASMFWIVLAQQSYCTGSLADWLHMGDVEECR* |
| Ga0157373_106987322 | 3300013100 | Corn Rhizosphere | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIANWLHMGDVEECR* |
| Ga0157378_114558791 | 3300013297 | Miscanthus Rhizosphere | LTMSGKAAAFVAGVLLASMFWIVLAQQSYCAGSHADWLKMGDVEECR* |
| Ga0075352_10926091 | 3300014324 | Natural And Restored Wetlands | MGGKAMAFLAGVLLASMFWIALAQQNYCTGSLADWLHMGDVEECR* |
| Ga0163163_110212641 | 3300014325 | Switchgrass Rhizosphere | GGLTMSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0132258_105769762 | 3300015371 | Arabidopsis Rhizosphere | MFGKEELTMSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0132258_114747742 | 3300015371 | Arabidopsis Rhizosphere | MGGKATAFVAGVLLASMFWIVLAQQSYCAGSVADWLHMGDVEECR* |
| Ga0132256_1012838481 | 3300015372 | Arabidopsis Rhizosphere | EGELDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0132256_1014096242 | 3300015372 | Arabidopsis Rhizosphere | LGGTSGWEGELDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0132256_1018899182 | 3300015372 | Arabidopsis Rhizosphere | VRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0132257_1003707712 | 3300015373 | Arabidopsis Rhizosphere | LGGISDWQGEPNMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0132257_1015291191 | 3300015373 | Arabidopsis Rhizosphere | DSEGELDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR* |
| Ga0132255_1006110032 | 3300015374 | Arabidopsis Rhizosphere | MSGKEELTMSGRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ* |
| Ga0132255_1059908752 | 3300015374 | Arabidopsis Rhizosphere | MAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR* |
| Ga0187775_103569552 | 3300017939 | Tropical Peatland | MSGKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ |
| Ga0187786_101968772 | 3300017944 | Tropical Peatland | MGGKVTAFVAGVLLASLFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0187785_100002869 | 3300017947 | Tropical Peatland | MSKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0187785_100063078 | 3300017947 | Tropical Peatland | MGGKVTAFVAGVLLASMFWIVLAHQSYCSGSLADWLHMGDVEECQ |
| Ga0187777_101013641 | 3300017974 | Tropical Peatland | SASTMSPMRGKATAFVAGVLIASLFWIVLAQQSYCAGGLADWLHIGDIEECR |
| Ga0184604_102126291 | 3300018000 | Groundwater Sediment | MSKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEE |
| Ga0184608_104624891 | 3300018028 | Groundwater Sediment | MSKATVFVAGVLLASMFWIVLAQQSYCTGSLADWLKMGDVEECR |
| Ga0187787_101228592 | 3300018029 | Tropical Peatland | MSGKATAFVAGVLLASMFWIVLAQQSYCTGSLADYLHMGDVEECQ |
| Ga0184621_102094922 | 3300018054 | Groundwater Sediment | MSGKATAFVAGVLIARMFWIVLAQQSYCTGSLADWLKMGDVEECR |
| Ga0187765_100323284 | 3300018060 | Tropical Peatland | GVLLASLFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0187765_106108432 | 3300018060 | Tropical Peatland | MPDQKELTMSSRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ |
| Ga0184635_100241123 | 3300018072 | Groundwater Sediment | MSGKATAFVAGVLLASMFWIVLAQQSYCTGGLADWLKMGDVEECR |
| Ga0184624_105059491 | 3300018073 | Groundwater Sediment | MSGKTTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0184640_102611441 | 3300018074 | Groundwater Sediment | MSVRATWFVAGVLLASMFWIVLAQQSFCAGSLADWLHMGDVEECR |
| Ga0184609_100666133 | 3300018076 | Groundwater Sediment | MSGKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0193701_10329001 | 3300019875 | Soil | MSKATVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0193723_10218743 | 3300019879 | Soil | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0193735_11035821 | 3300020006 | Soil | MSGKVTAFVAGVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0193719_102802881 | 3300021344 | Soil | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMG |
| Ga0193719_103804912 | 3300021344 | Soil | MSKATAFVAGVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0222621_11206611 | 3300021510 | Groundwater Sediment | MSKATAFVAGVLLASMFWIVLAHQSYCAGSVVADWLHMGDVEECR |
| Ga0126371_107695562 | 3300021560 | Tropical Forest Soil | MSVRATWFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ |
| Ga0126371_115124632 | 3300021560 | Tropical Forest Soil | FVAGVLLASMFWIVLAQQSYCAGSLADWLKMGDVEECR |
| Ga0126371_116752812 | 3300021560 | Tropical Forest Soil | MSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR |
| Ga0222623_100833971 | 3300022694 | Groundwater Sediment | MSGKATAFVAGVLLASMFWIVLAQQSYCTGSLADWLKMGDVEECR |
| Ga0222622_100592326 | 3300022756 | Groundwater Sediment | EPTMSKATAFVAGVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0207713_11575581 | 3300025735 | Switchgrass Rhizosphere | LGGISDSEGELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0207680_100471614 | 3300025903 | Switchgrass Rhizosphere | ELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0207680_100553454 | 3300025903 | Switchgrass Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEEC |
| Ga0207685_106832782 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKATAFVAGMLLASMFWVVLAQQSYCAGSVADWLHMGDVEECR |
| Ga0207657_102874582 | 3300025919 | Corn Rhizosphere | MSGKLTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0207652_102952883 | 3300025921 | Corn Rhizosphere | MSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMG |
| Ga0207690_101889601 | 3300025932 | Corn Rhizosphere | GKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0207706_106092922 | 3300025933 | Corn Rhizosphere | LGGISDWQGEPNMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0207661_107158892 | 3300025944 | Corn Rhizosphere | GEVDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0210071_10473442 | 3300025955 | Natural And Restored Wetlands | MSGKAMAFLAGVLLASMFWIGLAQQNYCTGSLADWLHMGDVEECR |
| Ga0207703_104018981 | 3300026035 | Switchgrass Rhizosphere | GLTMSGKAMAFLAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0207676_103052872 | 3300026095 | Switchgrass Rhizosphere | GGISDSEGELKMSGKLTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0256821_10032862 | 3300026452 | Sediment | MAFLAGVLLASMFWIALAQQSYCTGSLADYLHMGDVEECR |
| Ga0207428_108044492 | 3300027907 | Populus Rhizosphere | SGWKGELDMSGKMTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0209069_100699453 | 3300027915 | Watersheds | MSGKAMAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307298_101172902 | 3300028717 | Soil | MSKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307316_103556752 | 3300028755 | Soil | GVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0307282_100677742 | 3300028784 | Soil | MSKATAFVAGVLLASMFWIVLAHQSYCAGSLADLLHMGDIEECR |
| Ga0307323_102839572 | 3300028787 | Soil | SGKTTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307287_102508862 | 3300028796 | Soil | MSKATVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMG |
| Ga0307292_100578303 | 3300028811 | Soil | TVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307302_104069671 | 3300028814 | Soil | MSGKATAFVAGVLLASLFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307289_102982912 | 3300028875 | Soil | KTTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307286_103763572 | 3300028876 | Soil | FVAGVLLASMFWIVLAHQSYCAGSVVADWLHMGDVEECR |
| Ga0307304_102419721 | 3300028885 | Soil | MSKATAFVAGVLLASMFWIVLAHQSYCAGSVVADWLHM |
| Ga0075377_116716801 | 3300030844 | Soil | ELTMSDKAMAFLAGVLLRSMFWIVLAQQSYCAGSVADWLHMGDVEECR |
| Ga0075373_115301152 | 3300030945 | Soil | MSGKATAFVAGVLLASMFWIVLAQQSYCTGSLADWLHM |
| Ga0170834_1020956642 | 3300031057 | Forest Soil | MSGKATAFVAGVLLWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0307495_100153791 | 3300031199 | Soil | AFVAGVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0307495_102526671 | 3300031199 | Soil | MSGKTTVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEGVPISG |
| Ga0307497_103963712 | 3300031226 | Soil | TAFVAGVLLASMFWIVLAHQSYCAGSVADWLHMGDVEECR |
| Ga0170824_1044582271 | 3300031231 | Forest Soil | PTMSKATAFVAGVLLASMFWIVLAHQSYCAGGVADWLHMGDVEECR |
| Ga0170824_1055325912 | 3300031231 | Forest Soil | MSGKAMAFLAGVLLTSMFWIVLAQQSYCAGSVADWLHMGDVEECR |
| Ga0170824_1090336272 | 3300031231 | Forest Soil | MSGKTTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVGGGR |
| Ga0308194_100413202 | 3300031421 | Soil | MSKATAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDV |
| Ga0308194_102959911 | 3300031421 | Soil | MSKATVFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEEC |
| Ga0170820_125945081 | 3300031446 | Forest Soil | TMSKATAFVAGVLLASMFWIVLAHQSYCAGGVADWLHMGDVEECR |
| Ga0170819_140982131 | 3300031469 | Forest Soil | MTGRRTNHEQATAFVAGVLLASMFWIVLAHQSYCAGSVVADWLHMGDVEECR |
| Ga0307469_112881321 | 3300031720 | Hardwood Forest Soil | MSGKAMAFFAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECQ |
| Ga0307469_115083322 | 3300031720 | Hardwood Forest Soil | MSGKMTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0307468_1006139782 | 3300031740 | Hardwood Forest Soil | MSGKMTAFVAGVLLASLFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0318502_108782092 | 3300031747 | Soil | SYNLTMSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR |
| Ga0318566_100951934 | 3300031779 | Soil | IRKRSYNLTMSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR |
| Ga0318576_104099372 | 3300031796 | Soil | MSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDV |
| Ga0310892_107519641 | 3300031858 | Soil | TAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0310906_100034877 | 3300032013 | Soil | CISDSEGELDMSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVEECR |
| Ga0318506_100548691 | 3300032052 | Soil | RSYNLTMSGKATAFVVGVLLASLFWIVLAQQSYCTGSFADWLKMGDVEECR |
| Ga0307470_101702682 | 3300032174 | Hardwood Forest Soil | MSGKMTAFVAGVLLASMFWIVLAQQCYCAGSIADWLHMGDVEECR |
| Ga0310889_100527984 | 3300032179 | Soil | MSGKVTAFVAGVLLASMFWIVLAQQSYCAGSIADWLHMGDVE |
| Ga0310810_103581111 | 3300033412 | Soil | GHHDWEGELTMSGKAIAFVAGVLLASMFWIVLAQQNYCAGSLADWLHMGDVEECR |
| Ga0326726_102042913 | 3300033433 | Peat Soil | MSGKAIAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR |
| Ga0326726_102363071 | 3300033433 | Peat Soil | MSGKAMAFLAGVLLASMFWIVLAQQNYCAGSFADWLHMGDVEECR |
| Ga0326723_0040516_1852_1956 | 3300034090 | Peat Soil | MSGKAIAFVAGVLLASMFWIVLAQQSYCAGSLADW |
| Ga0326723_0146418_538_675 | 3300034090 | Peat Soil | MSGKAMAFLAGVLLASMFWIALAQQNYCTGSLADWLHMGDVEECR |
| ⦗Top⦘ |