


| Basic Information | |
|---|---|
| Family ID | F034353 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MEEIKELVDKVLKNRSLTVFLGIVVVALFLGWIGG |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.14 % |
| % of genes near scaffold ends (potentially truncated) | 16.57 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.286 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (44.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 42.86 |
| PF05866 | RusA | 10.29 |
| PF07102 | YbcO | 4.57 |
| PF03796 | DnaB_C | 3.43 |
| PF09723 | Zn-ribbon_8 | 2.29 |
| PF04071 | zf-like | 1.71 |
| PF01592 | NifU_N | 1.14 |
| PF04404 | ERF | 1.14 |
| PF13392 | HNH_3 | 1.14 |
| PF00476 | DNA_pol_A | 1.14 |
| PF00932 | LTD | 0.57 |
| PF05367 | Phage_endo_I | 0.57 |
| PF01402 | RHH_1 | 0.57 |
| PF00940 | RNA_pol | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 10.29 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 3.43 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 3.43 |
| COG2158 | Uncharacterized conserved protein, contains a Zn-finger-like domain | General function prediction only [R] | 1.71 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.14 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 1.14 |
| COG5108 | Mitochondrial DNA-directed RNA polymerase | Transcription [K] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.71 % |
| Unclassified | root | N/A | 42.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10072403 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1576 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10001460 | Not Available | 14447 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10243980 | Not Available | 550 | Open in IMG/M |
| 3300001450|JGI24006J15134_10015002 | All Organisms → Viruses → environmental samples → uncultured marine virus | 3685 | Open in IMG/M |
| 3300001450|JGI24006J15134_10020281 | All Organisms → Viruses → Predicted Viral | 3068 | Open in IMG/M |
| 3300001450|JGI24006J15134_10053979 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1623 | Open in IMG/M |
| 3300001589|JGI24005J15628_10125994 | Not Available | 816 | Open in IMG/M |
| 3300001683|GBIDBA_10006270 | Not Available | 7817 | Open in IMG/M |
| 3300001731|JGI24514J20073_1016047 | Not Available | 717 | Open in IMG/M |
| 3300001731|JGI24514J20073_1016131 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 715 | Open in IMG/M |
| 3300001735|JGI24520J20079_1003541 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300001740|JGI24656J20076_1013010 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300005520|Ga0066864_10022958 | All Organisms → Viruses → Predicted Viral | 1948 | Open in IMG/M |
| 3300005551|Ga0066843_10038740 | Not Available | 1458 | Open in IMG/M |
| 3300005592|Ga0066838_10010718 | Not Available | 2655 | Open in IMG/M |
| 3300005592|Ga0066838_10013250 | All Organisms → Viruses → Predicted Viral | 2373 | Open in IMG/M |
| 3300005592|Ga0066838_10019790 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
| 3300005592|Ga0066838_10119136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 745 | Open in IMG/M |
| 3300005603|Ga0066853_10209174 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 648 | Open in IMG/M |
| 3300005603|Ga0066853_10266534 | Not Available | 563 | Open in IMG/M |
| 3300005604|Ga0066852_10117935 | Not Available | 941 | Open in IMG/M |
| 3300006091|Ga0082018_1020798 | Not Available | 1187 | Open in IMG/M |
| 3300006093|Ga0082019_1009677 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300006164|Ga0075441_10034427 | All Organisms → Viruses → Predicted Viral | 2050 | Open in IMG/M |
| 3300006164|Ga0075441_10037321 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300006164|Ga0075441_10075790 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300006164|Ga0075441_10128498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 963 | Open in IMG/M |
| 3300006164|Ga0075441_10173104 | Not Available | 809 | Open in IMG/M |
| 3300006164|Ga0075441_10294551 | Not Available | 593 | Open in IMG/M |
| 3300006190|Ga0075446_10137961 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006191|Ga0075447_10118372 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006191|Ga0075447_10218874 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006193|Ga0075445_10019433 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
| 3300006306|Ga0068469_1335563 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 599 | Open in IMG/M |
| 3300006310|Ga0068471_1252887 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300006310|Ga0068471_1265597 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300006310|Ga0068471_1304190 | All Organisms → Viruses → Predicted Viral | 2042 | Open in IMG/M |
| 3300006325|Ga0068501_1199092 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 503 | Open in IMG/M |
| 3300006335|Ga0068480_1190843 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300006335|Ga0068480_1232122 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300006336|Ga0068502_1129352 | All Organisms → cellular organisms → Bacteria | 5566 | Open in IMG/M |
| 3300006339|Ga0068481_1149644 | All Organisms → Viruses → Predicted Viral | 2192 | Open in IMG/M |
| 3300006339|Ga0068481_1165042 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300006339|Ga0068481_1192352 | All Organisms → Viruses → Predicted Viral | 2376 | Open in IMG/M |
| 3300006736|Ga0098033_1018898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter | 2147 | Open in IMG/M |
| 3300006736|Ga0098033_1143550 | Not Available | 670 | Open in IMG/M |
| 3300006738|Ga0098035_1018089 | All Organisms → Viruses → Predicted Viral | 2786 | Open in IMG/M |
| 3300006738|Ga0098035_1049747 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300006750|Ga0098058_1008079 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3173 | Open in IMG/M |
| 3300006750|Ga0098058_1127842 | Not Available | 678 | Open in IMG/M |
| 3300006752|Ga0098048_1062725 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300006753|Ga0098039_1268971 | Not Available | 572 | Open in IMG/M |
| 3300006754|Ga0098044_1031319 | All Organisms → Viruses → Predicted Viral | 2335 | Open in IMG/M |
| 3300006754|Ga0098044_1217399 | Not Available | 747 | Open in IMG/M |
| 3300006789|Ga0098054_1012931 | Not Available | 3415 | Open in IMG/M |
| 3300006793|Ga0098055_1002405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9710 | Open in IMG/M |
| 3300006793|Ga0098055_1004129 | Not Available | 7206 | Open in IMG/M |
| 3300006793|Ga0098055_1016709 | All Organisms → Viruses → Predicted Viral | 3183 | Open in IMG/M |
| 3300006810|Ga0070754_10004798 | Not Available | 9197 | Open in IMG/M |
| 3300006810|Ga0070754_10005073 | All Organisms → Viruses → environmental samples → uncultured marine virus | 8914 | Open in IMG/M |
| 3300006869|Ga0075477_10067090 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300006902|Ga0066372_10190606 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300006921|Ga0098060_1048208 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300006923|Ga0098053_1014381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1761 | Open in IMG/M |
| 3300006924|Ga0098051_1077656 | Not Available | 899 | Open in IMG/M |
| 3300006927|Ga0098034_1160980 | Not Available | 632 | Open in IMG/M |
| 3300006927|Ga0098034_1223016 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006928|Ga0098041_1005195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4507 | Open in IMG/M |
| 3300006929|Ga0098036_1054136 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
| 3300006947|Ga0075444_10006354 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 6769 | Open in IMG/M |
| 3300006947|Ga0075444_10145844 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 996 | Open in IMG/M |
| 3300006947|Ga0075444_10270321 | Not Available | 663 | Open in IMG/M |
| 3300007514|Ga0105020_1023020 | Not Available | 5912 | Open in IMG/M |
| 3300007514|Ga0105020_1300714 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300007514|Ga0105020_1456877 | Not Available | 661 | Open in IMG/M |
| 3300007756|Ga0105664_1016896 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 913 | Open in IMG/M |
| 3300007758|Ga0105668_1053888 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300007963|Ga0110931_1032016 | Not Available | 1590 | Open in IMG/M |
| 3300008050|Ga0098052_1002468 | All Organisms → cellular organisms → Bacteria | 11203 | Open in IMG/M |
| 3300008050|Ga0098052_1145286 | Not Available | 942 | Open in IMG/M |
| 3300008050|Ga0098052_1239068 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 696 | Open in IMG/M |
| 3300008050|Ga0098052_1386631 | Not Available | 521 | Open in IMG/M |
| 3300008050|Ga0098052_1409933 | Not Available | 503 | Open in IMG/M |
| 3300008216|Ga0114898_1103962 | Not Available | 847 | Open in IMG/M |
| 3300008217|Ga0114899_1041942 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1663 | Open in IMG/M |
| 3300008217|Ga0114899_1047364 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300008221|Ga0114916_1075214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 867 | Open in IMG/M |
| 3300008221|Ga0114916_1097909 | Not Available | 715 | Open in IMG/M |
| 3300009130|Ga0118729_1018132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4946 | Open in IMG/M |
| 3300009420|Ga0114994_10758020 | Not Available | 632 | Open in IMG/M |
| 3300009420|Ga0114994_10798143 | Not Available | 613 | Open in IMG/M |
| 3300009428|Ga0114915_1092129 | Not Available | 911 | Open in IMG/M |
| 3300009428|Ga0114915_1119513 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 768 | Open in IMG/M |
| 3300009441|Ga0115007_11169821 | Not Available | 535 | Open in IMG/M |
| 3300009512|Ga0115003_10210944 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300009613|Ga0105228_126959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300009613|Ga0105228_129065 | Not Available | 507 | Open in IMG/M |
| 3300009622|Ga0105173_1003669 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300009622|Ga0105173_1015518 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300009622|Ga0105173_1106693 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 519 | Open in IMG/M |
| 3300009705|Ga0115000_10950279 | Not Available | 524 | Open in IMG/M |
| 3300009786|Ga0114999_10752306 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010149|Ga0098049_1024141 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
| 3300010150|Ga0098056_1239868 | Not Available | 602 | Open in IMG/M |
| 3300010151|Ga0098061_1092156 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300010153|Ga0098059_1016732 | All Organisms → Viruses → Predicted Viral | 3025 | Open in IMG/M |
| 3300010153|Ga0098059_1141783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300010155|Ga0098047_10040849 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1841 | Open in IMG/M |
| 3300010155|Ga0098047_10353771 | Not Available | 552 | Open in IMG/M |
| 3300010883|Ga0133547_10469321 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300012419|Ga0138260_10325666 | Not Available | 538 | Open in IMG/M |
| 3300017715|Ga0181370_1038562 | Not Available | 617 | Open in IMG/M |
| 3300017715|Ga0181370_1056909 | Not Available | 500 | Open in IMG/M |
| 3300017768|Ga0187220_1195783 | Not Available | 609 | Open in IMG/M |
| 3300017775|Ga0181432_1013899 | Not Available | 2006 | Open in IMG/M |
| 3300017775|Ga0181432_1244340 | Not Available | 566 | Open in IMG/M |
| 3300019751|Ga0194029_1001586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rubi → Agrobacterium rubi TR3 = NBRC 13261 | 2893 | Open in IMG/M |
| 3300019938|Ga0194032_1001210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rubi → Agrobacterium rubi TR3 = NBRC 13261 | 2922 | Open in IMG/M |
| 3300020364|Ga0211538_1073762 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
| 3300020458|Ga0211697_10113980 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300021442|Ga0206685_10016104 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
| 3300021957|Ga0222717_10002005 | Not Available | 16094 | Open in IMG/M |
| 3300022187|Ga0196899_1000576 | Not Available | 18804 | Open in IMG/M |
| 3300022225|Ga0187833_10003663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 15451 | Open in IMG/M |
| 3300022227|Ga0187827_10293099 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300022227|Ga0187827_10751289 | Not Available | 546 | Open in IMG/M |
| 3300024242|Ga0228673_1090976 | Not Available | 543 | Open in IMG/M |
| 3300025071|Ga0207896_1003874 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2789 | Open in IMG/M |
| 3300025071|Ga0207896_1017803 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300025071|Ga0207896_1046053 | Not Available | 720 | Open in IMG/M |
| 3300025078|Ga0208668_1013551 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300025082|Ga0208156_1001795 | Not Available | 6635 | Open in IMG/M |
| 3300025084|Ga0208298_1004556 | All Organisms → Viruses → Predicted Viral | 4048 | Open in IMG/M |
| 3300025098|Ga0208434_1038317 | Not Available | 1095 | Open in IMG/M |
| 3300025098|Ga0208434_1051050 | Not Available | 906 | Open in IMG/M |
| 3300025099|Ga0208669_1019343 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
| 3300025103|Ga0208013_1013467 | Not Available | 2543 | Open in IMG/M |
| 3300025110|Ga0208158_1145992 | Not Available | 538 | Open in IMG/M |
| 3300025133|Ga0208299_1105325 | Not Available | 946 | Open in IMG/M |
| 3300025266|Ga0208032_1111093 | Not Available | 505 | Open in IMG/M |
| 3300025268|Ga0207894_1029694 | Not Available | 978 | Open in IMG/M |
| 3300025276|Ga0208814_1110332 | Not Available | 676 | Open in IMG/M |
| 3300025276|Ga0208814_1110906 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 673 | Open in IMG/M |
| 3300025276|Ga0208814_1147159 | Not Available | 533 | Open in IMG/M |
| 3300025770|Ga0209362_1221814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 624 | Open in IMG/M |
| 3300026259|Ga0208896_1020284 | All Organisms → Viruses → Predicted Viral | 2283 | Open in IMG/M |
| 3300026259|Ga0208896_1042201 | Not Available | 1445 | Open in IMG/M |
| 3300026500|Ga0247592_1155613 | Not Available | 544 | Open in IMG/M |
| 3300027522|Ga0209384_1032720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1522 | Open in IMG/M |
| 3300027522|Ga0209384_1103728 | Not Available | 672 | Open in IMG/M |
| 3300027668|Ga0209482_1016492 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
| 3300027668|Ga0209482_1024363 | All Organisms → Viruses → Predicted Viral | 2547 | Open in IMG/M |
| 3300027672|Ga0209383_1020701 | All Organisms → Viruses → Predicted Viral | 2828 | Open in IMG/M |
| 3300027686|Ga0209071_1005352 | All Organisms → Viruses → environmental samples → uncultured marine virus | 4396 | Open in IMG/M |
| 3300027686|Ga0209071_1032740 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300027704|Ga0209816_1267436 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 531 | Open in IMG/M |
| 3300027813|Ga0209090_10228842 | Not Available | 948 | Open in IMG/M |
| 3300028126|Ga0228648_1120264 | Not Available | 512 | Open in IMG/M |
| 3300031140|Ga0308024_1000333 | Not Available | 19608 | Open in IMG/M |
| 3300031510|Ga0308010_1063289 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300031519|Ga0307488_10008185 | Not Available | 8539 | Open in IMG/M |
| 3300031519|Ga0307488_10071523 | Not Available | 2607 | Open in IMG/M |
| 3300031569|Ga0307489_10176348 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300031569|Ga0307489_10491435 | All Organisms → Viruses → environmental samples → uncultured marine virus | 833 | Open in IMG/M |
| 3300031599|Ga0308007_10198343 | Not Available | 699 | Open in IMG/M |
| 3300031608|Ga0307999_1118681 | Not Available | 611 | Open in IMG/M |
| 3300031647|Ga0308012_10413077 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 526 | Open in IMG/M |
| 3300031687|Ga0308008_1154683 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 531 | Open in IMG/M |
| 3300031695|Ga0308016_10139661 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 962 | Open in IMG/M |
| 3300032278|Ga0310345_11184766 | Not Available | 747 | Open in IMG/M |
| 3300032360|Ga0315334_10079895 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
| 3300032360|Ga0315334_11450163 | Not Available | 589 | Open in IMG/M |
| 3300033742|Ga0314858_095755 | Not Available | 751 | Open in IMG/M |
| 3300033742|Ga0314858_143676 | Not Available | 612 | Open in IMG/M |
| 3300033742|Ga0314858_154643 | Not Available | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 44.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.14% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.43% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 3.43% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 2.86% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.29% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.29% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.29% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.71% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.71% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.71% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.71% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.14% |
| Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 1.14% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.57% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.57% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300001740 | Marine viral communities from the Deep Pacific Ocean - MSP-114 | Environmental | Open in IMG/M |
| 3300005520 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007758 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009613 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020364 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556021-ERR599037) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026259 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 (SPAdes) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100724034 | 3300000101 | Marine | MEKVMEVVNTILKNRSLTIFLGVCVVALFFGWVGG* |
| DelMOSpr2010_100014607 | 3300000116 | Marine | MEEIKELVDKVLKNRSLTIFLGIVVLALVMGWVGG* |
| DelMOSpr2010_102439802 | 3300000116 | Marine | MEEVKEVIDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| JGI24006J15134_100150028 | 3300001450 | Marine | MEKLMEVVNTVLKNRSLTVFLGIVVVALFLGWIGG* |
| JGI24006J15134_100202813 | 3300001450 | Marine | MEELKVLVDKVLKNRSLTVFLGIVVLALFMGWVGG* |
| JGI24006J15134_100539797 | 3300001450 | Marine | MEKLMEVVNTVLKNRSLTVFLGIVVIALFLGWIGG* |
| JGI24005J15628_101259941 | 3300001589 | Marine | MEKVKEVIDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| GBIDBA_1000627014 | 3300001683 | Hydrothermal Vent Plume | MKDMKDMIDTVLKNRSLTVFLAIVVVAMFFGFIGG* |
| JGI24514J20073_10160471 | 3300001731 | Marine | MNYQDLIDKVLKNKSLTVFLGIVVVAMLFGWIGG* |
| JGI24514J20073_10161313 | 3300001731 | Marine | MKDIKDMTDMVLKNKSLTIFLAIVVVAMLIGWIG* |
| JGI24520J20079_10035414 | 3300001735 | Marine | MXYQELIDKVLKNKSLTIFLAIVVVAMFFGWIGG* |
| JGI24656J20076_10130103 | 3300001740 | Deep Ocean | MNEIKDLVDTVLKNRSLTIFLAIVVVALFFGWIGG* |
| Ga0066864_100229585 | 3300005520 | Marine | MNEIKDLVDTVLKNRSLTVFLAIVVVALFFGWIGG* |
| Ga0066843_100387403 | 3300005551 | Marine | MKDLQEYINIVLKNKSLTIFLAIVIVAMFFDWLG* |
| Ga0066838_100107187 | 3300005592 | Marine | MKDLQEYINIVLKNKSLTIFLAIVIVAMFFGWLG* |
| Ga0066838_100132504 | 3300005592 | Marine | MNYQELIDKVLKNKSLTVFLAVVVVALFFGWIGG* |
| Ga0066838_100197905 | 3300005592 | Marine | MKDWKDLIDQVLANKSLTVFLGIVVVALVFGWIGG* |
| Ga0066838_101191364 | 3300005592 | Marine | MKDIKDVADVVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0066853_102091743 | 3300005603 | Marine | MKEVKDLIDQVLANKSLTVFLGIVVVALVFGWIGG* |
| Ga0066853_102665341 | 3300005603 | Marine | MNYQDLIDKVLKNRSLTVFLAVVVVALFFGWIGG* |
| Ga0066852_101179354 | 3300005604 | Marine | MNGYKDYIDTVLKNKSLTVFLAIVVVALFFGWIGG* |
| Ga0082018_10207983 | 3300006091 | Marine | MNYQELIDKVLKNKSLTIFLAVVVVALFFGWIGG* |
| Ga0082019_10096774 | 3300006093 | Marine | MNYQELIDKVLKNKSLTVFLGIVVVALFFGWIGG* |
| Ga0075441_100344274 | 3300006164 | Marine | MEKVMEVVNAVLKNRSLTIFLGVVIAAMFFGWVGGA* |
| Ga0075441_100373216 | 3300006164 | Marine | MEQVKELVDKVLKNRSLTIFLGIVVVALVMGWIGG* |
| Ga0075441_100757904 | 3300006164 | Marine | MEKVKELIDTVLKNKSLTVFLAIVVVALFMGWVGG* |
| Ga0075441_101284983 | 3300006164 | Marine | MEKVMEVVDAVLKNRSLTIFLGIVVVALVFGWLGGGEAV* |
| Ga0075441_101731042 | 3300006164 | Marine | MGLQDIKDMITKVLANKSLTVFLGIVVVALVLGWIG* |
| Ga0075441_102945512 | 3300006164 | Marine | MEQVKELIDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| Ga0075446_101379611 | 3300006190 | Marine | KYMEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| Ga0075447_101183724 | 3300006191 | Marine | MEDLKVLVDKVLKNRSLTIFLAIVVVALFMGWVGG* |
| Ga0075447_102188743 | 3300006191 | Marine | YMEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| Ga0075445_100194333 | 3300006193 | Marine | MEKVMEVVDAVLKNRSLTIFLGIVVVALVFGWLGGGETA* |
| Ga0068469_13355632 | 3300006306 | Marine | MKDMKDITDMVLKNKSLTIFLAIVVVAMLFGWIG* |
| Ga0068471_12528874 | 3300006310 | Marine | MNYQELIDKVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0068471_12655973 | 3300006310 | Marine | MNYQELIDKVLKNKSLTIFLAIVVVAMFFGWIGG* |
| Ga0068471_13041904 | 3300006310 | Marine | MKDIKDMTDMVLKNKSLTIFLAIVVVAMLFGWIA* |
| Ga0068501_11990922 | 3300006325 | Marine | MNYQELIDKVLKNKSLTVFLGIVVVAMLFGWIGG* |
| Ga0068480_11908433 | 3300006335 | Marine | MKDMKDMTDMVLKNKSLTIFLAIVVVAMLFGWIS* |
| Ga0068480_12321223 | 3300006335 | Marine | MNYQDLIDKVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0068502_11293525 | 3300006336 | Marine | MKDIKDMTDMVLKNKSLTIFLAIVVVAMLFGWIG* |
| Ga0068481_11496443 | 3300006339 | Marine | MKDMKDMTDMVLKNKSLTVFLAIVVVAMLFGWIG* |
| Ga0068481_11650423 | 3300006339 | Marine | MKDMKDITDMVLKNKSLTIFLAIVVVAMLFGWIS* |
| Ga0068481_11923523 | 3300006339 | Marine | MNYQELIDKVLKNKSLTIFLAIVVVAMLFGWIGG* |
| Ga0098033_10188986 | 3300006736 | Marine | GEYMKDLQEYINIVLKNKSLTIFLAIVIVAMFFGWLG* |
| Ga0098033_11435502 | 3300006736 | Marine | MNEIKDLVDTVLKNKSLTVFLAIVVVALFFGWIGG* |
| Ga0098035_10180894 | 3300006738 | Marine | MNYQELIDKVLKNKSLTVFLAIVVVAMFFGWIGG* |
| Ga0098035_10497472 | 3300006738 | Marine | MKDIKDMTDMVLKNKSLTIFLAVVVVAMLFGWIG* |
| Ga0098058_10080796 | 3300006750 | Marine | MNYQDLIDKVLKNRSLTVFLAIVVLALFFGWIGG* |
| Ga0098058_11278421 | 3300006750 | Marine | MKDLQEYINIVLKNKSLTVFLAIVIVAMFFGWLG* |
| Ga0098048_10627254 | 3300006752 | Marine | MNYQELIDKVLKNRSLTVFLAIVVLALLFGWIGG* |
| Ga0098039_12689712 | 3300006753 | Marine | MKDLQEYIDIVLKNKSLTVFLAIVIVAMFFGWLG* |
| Ga0098044_10313195 | 3300006754 | Marine | MKDIIDQVLKNKSLTVFLAVCVVALFFGWIGGGEV* |
| Ga0098044_12173992 | 3300006754 | Marine | MNYQELINKVLKNKSLTVFLGIVVVAMLFGWIGG* |
| Ga0098054_10129315 | 3300006789 | Marine | MNGYKDYIDTVLKNKSLTVFLAIVVVAMFFGWIGG* |
| Ga0098055_10024059 | 3300006793 | Marine | MEKVMDVINTILKNRSLTVFLGICVVALFFGWVGG* |
| Ga0098055_10041299 | 3300006793 | Marine | MNYQELIDKVLKNKSLTVFLAIVVVALFFGWIGG* |
| Ga0098055_10167096 | 3300006793 | Marine | MNYQELTDKVLKNKSLTIFLGIVVVALLFGWIGG* |
| Ga0070754_100047985 | 3300006810 | Aqueous | MEKIMEVLNTVLKNRSLTVFLGICVVALFFGWVGG* |
| Ga0070754_100050731 | 3300006810 | Aqueous | MEKVIEVVNTILKNRSLTIFLGVCVVALFFGWVGG* |
| Ga0075477_100670907 | 3300006869 | Aqueous | FVITRRESMEKIMEVLNTVLKNRSLTVFLGICVVALFFGWVGG* |
| Ga0066372_101906064 | 3300006902 | Marine | MKDIKDMTDMVLKNKSLTVFLAIVVVAMLFGWIG* |
| Ga0098060_10482082 | 3300006921 | Marine | MEKVIDVINTILKNRSLTVFLGVCVVALFFGWVGG* |
| Ga0098053_10143815 | 3300006923 | Marine | MNYQELIDKVLKNKSLTVFLAVVVVALFFDWIGG* |
| Ga0098051_10776561 | 3300006924 | Marine | GVVMKEVIEKVLENKSLTVFLGIFVVALLFGWIGG* |
| Ga0098034_11609803 | 3300006927 | Marine | VRMNYQELIDRVLKNKSLTIFLAIVVVAMFFGWIGG* |
| Ga0098034_12230162 | 3300006927 | Marine | MNYEELIDKVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0098041_10051959 | 3300006928 | Marine | MEKIMEVVNTVLKNRSLTVFLGICVVALFFGWVGG* |
| Ga0098036_10541362 | 3300006929 | Marine | MNYQELTDKVLKNRSLTVFLAIVVLALLFGWIGG* |
| Ga0075444_100063541 | 3300006947 | Marine | KMEKVMEVVDAVLKNRSLTIFLGIVVVALVFGWLGGGEAV* |
| Ga0075444_101458441 | 3300006947 | Marine | MEQIKELVDKVLKNRSLTIFLGIVVLALVMGWIGG* |
| Ga0075444_102703212 | 3300006947 | Marine | MEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG* |
| Ga0105020_102302010 | 3300007514 | Marine | MNYQELINKVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0105020_13007143 | 3300007514 | Marine | MNYQELIDKVLKNRSLTVFLAIVVLAMMFGWIGG* |
| Ga0105020_14568772 | 3300007514 | Marine | MNYQELIDRVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0105664_10168961 | 3300007756 | Background Seawater | GVVRMKEYIDIVLKNRSLTVFLGIVVVALLFGWIGG* |
| Ga0105668_10538884 | 3300007758 | Background Seawater | MKDIKDMTDMVLKNKSLTIFLAIVVVAMLFGWIS* |
| Ga0110931_10320167 | 3300007963 | Marine | GHYQGVERMKEIMDMVLKNRSLTVFLAIVVVALLFGWIGG* |
| Ga0098052_100246812 | 3300008050 | Marine | MNFQELIDKVLKNKSLTVFLGIVVVAMLFGWIGG* |
| Ga0098052_11452864 | 3300008050 | Marine | MNYQELIDKVLKNKSLTVFLGIVVVALLFGWIGG* |
| Ga0098052_12390683 | 3300008050 | Marine | VVIMKDMIDQVLKNKSLTIFLGIVVVALLFGWIGG* |
| Ga0098052_13866311 | 3300008050 | Marine | KKGVVRMNYQELIDKVLKNKSLTVFLAIVVVAMFFGWIGG* |
| Ga0098052_14099332 | 3300008050 | Marine | MNYQELIDKVLKNRSLTVFLAIVVVAMFFGWIGL* |
| Ga0114898_11039622 | 3300008216 | Deep Ocean | MNFEELIDKVLKNKSLTVFLGIVVVAMLFGWIGG* |
| Ga0114899_10419425 | 3300008217 | Deep Ocean | MNFEELIDKVLKNKSLTVFLAIVVVAMLFGWIGG* |
| Ga0114899_10473645 | 3300008217 | Deep Ocean | MNYQELIDKVLKNKSLTVFLGIFVVAMLFGWIGG* |
| Ga0114916_10752143 | 3300008221 | Deep Ocean | MDKLMEVVDTVLKNRSLTIFLGIVVVALFMGWVGG* |
| Ga0114916_10979092 | 3300008221 | Deep Ocean | MELQDIKDMVTKVLANKSLTVFLGIVVVALVLGWIG* |
| Ga0118729_10181329 | 3300009130 | Marine | MEKVMEVVDTILKNRSLTVFLGICVLALFFGWVGG* |
| Ga0114994_107580202 | 3300009420 | Marine | MEKVMEVVNAVLKNRSLTIFLGVVVAAMFFGWIGGA* |
| Ga0114994_107981431 | 3300009420 | Marine | MEEVKELVDKVLKNRSLTIFLGIVVLALVMGWVGG* |
| Ga0114915_10921292 | 3300009428 | Deep Ocean | MEKVKELINTVLKNKSLTVFLAIVVVALFMGWVGG* |
| Ga0114915_11195133 | 3300009428 | Deep Ocean | MEEIKELVDKVLKNRSLTVFLGIVVVALFLGWIGG* |
| Ga0115007_111698212 | 3300009441 | Marine | MDKLMEVVDTVLKNRSLTIFLGIVVVALIFGWIGG* |
| Ga0115003_102109444 | 3300009512 | Marine | MGLQDIKDMITKVLANKSLTVFLGIVVVALVLGWID* |
| Ga0105228_1269592 | 3300009613 | Marine Oceanic | MNYQELIDKVLKNKSLTIFLGIVVVAMLFGWIGG* |
| Ga0105228_1290652 | 3300009613 | Marine Oceanic | MKDMKDGIDMILKNKSLTIFLAIVVVAMFFGWVG* |
| Ga0105173_10036692 | 3300009622 | Marine Oceanic | MNYQELIDKVLKNKSLTVFLGIVVVAMLFGWIGL* |
| Ga0105173_10155182 | 3300009622 | Marine Oceanic | MEEVKKLVDTVLKNKSLTIFLGIVIAALVFDWIGG* |
| Ga0105173_11066932 | 3300009622 | Marine Oceanic | MKDMKDMTDMVLKNKSLTIFLAIVVVAMFFGWIG* |
| Ga0115000_109502792 | 3300009705 | Marine | MEDIKAMIEKVLANKSLTVFLGIVVAALVLGWIG* |
| Ga0114999_107523062 | 3300009786 | Marine | MEEVKELVDKVLKNRSLTIFLGIVVLALFMGWVGG* |
| Ga0098049_10241413 | 3300010149 | Marine | MKDIVDQVLKNKSLTVFLAVCVVALFFGWIGGGEV* |
| Ga0098056_12398682 | 3300010150 | Marine | MNYEELIDKVLKNKSLTVFLAIVVVAMFFGWIGG* |
| Ga0098061_10921563 | 3300010151 | Marine | MNYQDLIDKVLKNRSLTVFLAIVVLAMFFGWIGG* |
| Ga0098059_10167325 | 3300010153 | Marine | MNYQELIDKVLKNKSLTIFLGIVVVALLFGWIGG* |
| Ga0098059_11417834 | 3300010153 | Marine | MEKVMDVINTILKNRSLTVFLGVCVVALFFGWVGG* |
| Ga0098047_100408493 | 3300010155 | Marine | MNYQELTDKVLKNKSLTIFLGIVVVAMLFGWIGG* |
| Ga0098047_103537712 | 3300010155 | Marine | MKDLQEYINIVLKNKSLTVFLAIVIVAMFFDWLG* |
| Ga0133547_104693213 | 3300010883 | Marine | MEEIKELVDKVLKNRSLTIFLGIVVVALVMGWIGG* |
| Ga0138260_103256661 | 3300012419 | Polar Marine | MGLQDIKDMVTKVLANKSLTVFLGIVVVALVLGWIG* |
| Ga0181370_10385623 | 3300017715 | Marine | MNEIKDLVDTVLKNRSLTVFLAIVVVALFFGWVGG |
| Ga0181370_10569091 | 3300017715 | Marine | MNEIKDLVDTVLKNKSLTVFLAIVVVALFFGWVGG |
| Ga0187220_11957831 | 3300017768 | Seawater | RSMEKVMEVVNTILKNRSLTIFLGVCVVALFFGWVGG |
| Ga0181432_10138992 | 3300017775 | Seawater | MDGYKDYINAVLKNRSLTVFLAIVVMAMFFGWIGG |
| Ga0181432_12443401 | 3300017775 | Seawater | RMNYQELIDKVLKNKSLTVFLGIVVVAMLFGWIGG |
| Ga0194029_10015861 | 3300019751 | Freshwater | MEKVMEVVNTILKNRSLTIFLGICVVALFFGWVGG |
| Ga0194032_10012109 | 3300019938 | Freshwater | MEKIMEVVNTVLKNRSLTVFLGICVVALFFGWVGG |
| Ga0211538_10737622 | 3300020364 | Marine | MKDWKDLIDQVLANKSLTVFLGIVVVALVFGWIGG |
| Ga0211697_101139804 | 3300020458 | Marine | KGVVRMNYQDLIDKVLKNKSLTVFLAIVVVAMLFGWIGG |
| Ga0206685_100161042 | 3300021442 | Seawater | MNGYKDYINTVLKNKSLTVFLAIVVVAMFFGWIGG |
| Ga0222717_100020056 | 3300021957 | Estuarine Water | MEKVMEVVNTILKNRSLTIFLGVCVVALFFGWVGG |
| Ga0196899_100057619 | 3300022187 | Aqueous | MEKIMEVLNTVLKNRSLTVFLGICVVALFFGWVGG |
| Ga0187833_1000366324 | 3300022225 | Seawater | MKDIKDVADVVLKNKSLTVFLAIVVVAMLFGWIGG |
| Ga0187827_102930993 | 3300022227 | Seawater | MNEIKDLVDTVLKNRSLTVFLAIVVVALFFGWIGG |
| Ga0187827_107512891 | 3300022227 | Seawater | GSIRMNYQDLIDKVLKNRSLTVFLAIVVLALFFGWIGG |
| Ga0228673_10909761 | 3300024242 | Seawater | MEKVMDVINTILKNRSLTVFLGICVVALFFGWVGG |
| Ga0207896_10038742 | 3300025071 | Marine | MEKLMEVVNTVLKNRSLTVFLGIVVVALFLGWIGG |
| Ga0207896_10178035 | 3300025071 | Marine | MEELKVLVDKVLKNRSLTVFLGIVVLALFMGWVGG |
| Ga0207896_10460532 | 3300025071 | Marine | MEEVKEVIDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0208668_10135512 | 3300025078 | Marine | MNEIKDLVDTVLKNKSLTVFLAIVVVALFFGWIGG |
| Ga0208156_100179510 | 3300025082 | Marine | MKEVKDLINQVLANKSLTVFLGIVVVALVFGWIGG |
| Ga0208298_100455611 | 3300025084 | Marine | MKDIIDQVLKNKSLTVFLAVCVVALFFGWIGGGEV |
| Ga0208434_10383171 | 3300025098 | Marine | GVERMKEIMDMVLKNRSLTVFLAIVVVALLFGWIGG |
| Ga0208434_10510501 | 3300025098 | Marine | GVERMKEIMDMVLKNRSLTVFLAIVVVALLFGWVGG |
| Ga0208669_10193431 | 3300025099 | Marine | MEKVIDVINTILKNRSLTVFLGVCVVALFFGWVGG |
| Ga0208013_10134675 | 3300025103 | Marine | MNGYKDYIDTVLKNKSLTVFLAIVVVAMFFGWIGG |
| Ga0208158_11459923 | 3300025110 | Marine | FFFNKEKDMQDMINKVLENKSLTVFLAVCVLALFFGWIGG |
| Ga0208299_11053254 | 3300025133 | Marine | VKRMKEIMDMVLKNRSLTVFLAIVVVALLFGWVGG |
| Ga0208032_11110932 | 3300025266 | Deep Ocean | MEDLKVLVDKVLKNRSLTIFLAIVVVALFMGWVGG |
| Ga0207894_10296942 | 3300025268 | Deep Ocean | MNEIKDLVDTVLKNRSLTIFLAIVVVALFFGWIGG |
| Ga0208814_11103322 | 3300025276 | Deep Ocean | MEQVKELIDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0208814_11109061 | 3300025276 | Deep Ocean | MEEIKELVDKVLKNRSLTVFLGIVVVALFLGWIGG |
| Ga0208814_11471592 | 3300025276 | Deep Ocean | MEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0209362_12218141 | 3300025770 | Marine | MEEVKELVDKVLKNRSLTIFLGIVVLALVMGWVGG |
| Ga0208896_10202847 | 3300026259 | Marine | MKEVKDLIDQVLANKSLTVFLGIVVVALVFGWIGG |
| Ga0208896_10422013 | 3300026259 | Marine | MNGYKDYIDTVLKNKSLTVFLAIVVVALFFGWIGG |
| Ga0247592_11556131 | 3300026500 | Seawater | EKKVKEVIEKVLENKSLTVFLGIFVFALLFGWIGG |
| Ga0209384_10327202 | 3300027522 | Marine | MEQVKELVDKVLKNRSLTIFLGIVVVALVMGWIGG |
| Ga0209384_11037281 | 3300027522 | Marine | KYMEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0209482_10164925 | 3300027668 | Marine | MGLQDIKDMITKVLANKSLTVFLGIVVVALVLGWIG |
| Ga0209482_10243634 | 3300027668 | Marine | MEEIKELVDKVLKNRSLTIFLGIVVLALVMGWVGG |
| Ga0209383_10207016 | 3300027672 | Marine | MEKVMEVVDAVLKNRSLTIFLGIVVVALVFGWLGGGETA |
| Ga0209071_100535210 | 3300027686 | Marine | MEEVKELIDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0209071_10327406 | 3300027686 | Marine | YMEEIKELVDKVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0209816_12674361 | 3300027704 | Marine | MEKVMEVVDAVLKNRSLTIFLGIVVVALVFGWLGGGEAV |
| Ga0209090_102288423 | 3300027813 | Marine | MEQVKELVDKVLKNRSLTIFLGIVVLALVMGWVGG |
| Ga0228648_11202641 | 3300028126 | Seawater | REVMEKVMDVINTILKNRSLTVFLGICVVALFFGWVGG |
| Ga0308024_100033319 | 3300031140 | Marine | MEEIKELVDKVLKNRSLTIFLGIVVVALVMGWIGG |
| Ga0308010_10632892 | 3300031510 | Marine | MEKVMEVVNAVLKNRSLTIFLGVVIAAMFFGWVGGA |
| Ga0307488_100081857 | 3300031519 | Sackhole Brine | MEKVMEVVNAVLKNRSLTIFLGVVVAAMFFGWIGGA |
| Ga0307488_100715236 | 3300031519 | Sackhole Brine | MEQVKELIDKVLKNRSLTIFLGIVVLALVMGWVGG |
| Ga0307489_101763482 | 3300031569 | Sackhole Brine | MGLQDIKDMITKVLANKSLTVFLGIVVVALVLGWVG |
| Ga0307489_104914353 | 3300031569 | Sackhole Brine | MEKVMEVVNAVLKNRSLTIFLGIVVAAMFFGWIGGA |
| Ga0308007_101983431 | 3300031599 | Marine | MEEVKELIDKVLKNRSLTIFLAIVVVALFMGWVGG |
| Ga0307999_11186813 | 3300031608 | Marine | SYWREIMDKLMEVVDTVLKNRSLTIFLGIVVVALFMGWVGG |
| Ga0308012_104130772 | 3300031647 | Marine | MEQIKELVDKVLKNRSLTIFLGIVVLALVMGWIGG |
| Ga0308008_11546831 | 3300031687 | Marine | KESNMEDIKELVDKVLKNRSLTVFLGIVVVALFLGWIGG |
| Ga0308016_101396614 | 3300031695 | Marine | MEQIKELVDKVLKNRSLTIFLGIVVLALVMGWVGG |
| Ga0310345_111847662 | 3300032278 | Seawater | QGVVXLMKDMIDIVLKNKSLTVFLAIVVVAMFFGWIGG |
| Ga0315334_100798952 | 3300032360 | Seawater | MIKGDYMKEMIEQVLANKSLTVFLGIVIVALVLGWLG |
| Ga0315334_114501633 | 3300032360 | Seawater | RMNYQELIDKVLKNKSLTIFLAIVVVAMFFGWIGG |
| Ga0314858_095755_610_717 | 3300033742 | Sea-Ice Brine | MEEVKELVDKVLKNRSLTIFLGIVVLALFMGWVGG |
| Ga0314858_143676_322_432 | 3300033742 | Sea-Ice Brine | MGLQDIKDMVTKVLANKSLTVFLGIVVVALVLGWIG |
| Ga0314858_154643_448_555 | 3300033742 | Sea-Ice Brine | MEQVKELVDKVLKNRSLTIFLGIVVVALFMGWVGG |
| ⦗Top⦘ |