


| Basic Information | |
|---|---|
| Family ID | F034278 |
| Family Type | Metagenome |
| Number of Sequences | 175 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VAEYLMTLAANYLELAERALILREPATAVRRQHIKVVQKE |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 35.43 % |
| % of genes near scaffold ends (potentially truncated) | 52.57 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.286 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 2.29 |
| PF12307 | DUF3631 | 1.14 |
| PF05050 | Methyltransf_21 | 1.14 |
| PF01594 | AI-2E_transport | 1.14 |
| PF00550 | PP-binding | 0.57 |
| PF00072 | Response_reg | 0.57 |
| PF04392 | ABC_sub_bind | 0.57 |
| PF06736 | TMEM175 | 0.57 |
| PF00162 | PGK | 0.57 |
| PF06411 | HdeA | 0.57 |
| PF12399 | BCA_ABC_TP_C | 0.57 |
| PF05598 | DUF772 | 0.57 |
| PF10129 | OpgC_C | 0.57 |
| PF02397 | Bac_transf | 0.57 |
| PF13586 | DDE_Tnp_1_2 | 0.57 |
| PF00027 | cNMP_binding | 0.57 |
| PF00665 | rve | 0.57 |
| PF00872 | Transposase_mut | 0.57 |
| PF03992 | ABM | 0.57 |
| PF00580 | UvrD-helicase | 0.57 |
| PF13546 | DDE_5 | 0.57 |
| PF02796 | HTH_7 | 0.57 |
| PF13358 | DDE_3 | 0.57 |
| PF13683 | rve_3 | 0.57 |
| PF02518 | HATPase_c | 0.57 |
| PF08734 | GYD | 0.57 |
| PF13442 | Cytochrome_CBB3 | 0.57 |
| PF03734 | YkuD | 0.57 |
| PF00561 | Abhydrolase_1 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.14 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.57 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.57 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.57 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.57 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.57 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.57 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.57 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.57 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.57 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.29 % |
| All Organisms | root | All Organisms | 33.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y02GD9OF | Not Available | 630 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10051806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 916 | Open in IMG/M |
| 3300004633|Ga0066395_10041131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1994 | Open in IMG/M |
| 3300005445|Ga0070708_102278546 | Not Available | 500 | Open in IMG/M |
| 3300005471|Ga0070698_100306185 | Not Available | 1520 | Open in IMG/M |
| 3300005518|Ga0070699_100188294 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300005556|Ga0066707_10854236 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005558|Ga0066698_10386636 | Not Available | 963 | Open in IMG/M |
| 3300005713|Ga0066905_100472200 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005713|Ga0066905_101501638 | Not Available | 613 | Open in IMG/M |
| 3300005764|Ga0066903_102108343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
| 3300005764|Ga0066903_102397606 | Not Available | 1020 | Open in IMG/M |
| 3300005764|Ga0066903_104467473 | Not Available | 746 | Open in IMG/M |
| 3300005764|Ga0066903_108916371 | Not Available | 508 | Open in IMG/M |
| 3300005764|Ga0066903_109093134 | Not Available | 502 | Open in IMG/M |
| 3300006028|Ga0070717_10740622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Peredibacter → unclassified Peredibacter → Peredibacter sp. | 893 | Open in IMG/M |
| 3300006175|Ga0070712_100183472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1632 | Open in IMG/M |
| 3300006796|Ga0066665_10204344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1535 | Open in IMG/M |
| 3300006796|Ga0066665_10281362 | Not Available | 1329 | Open in IMG/M |
| 3300007258|Ga0099793_10033073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2209 | Open in IMG/M |
| 3300009162|Ga0075423_11264550 | Not Available | 788 | Open in IMG/M |
| 3300009792|Ga0126374_11594862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300010043|Ga0126380_10251761 | Not Available | 1223 | Open in IMG/M |
| 3300010043|Ga0126380_10814180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300010043|Ga0126380_11323967 | Not Available | 628 | Open in IMG/M |
| 3300010046|Ga0126384_10409870 | Not Available | 1147 | Open in IMG/M |
| 3300010046|Ga0126384_10756689 | Not Available | 866 | Open in IMG/M |
| 3300010046|Ga0126384_11469404 | Not Available | 638 | Open in IMG/M |
| 3300010046|Ga0126384_12121011 | Not Available | 540 | Open in IMG/M |
| 3300010047|Ga0126382_10256124 | Not Available | 1286 | Open in IMG/M |
| 3300010047|Ga0126382_11058840 | Not Available | 716 | Open in IMG/M |
| 3300010048|Ga0126373_10602977 | Not Available | 1151 | Open in IMG/M |
| 3300010333|Ga0134080_10378879 | Not Available | 650 | Open in IMG/M |
| 3300010358|Ga0126370_10729468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia stuartii | 874 | Open in IMG/M |
| 3300010360|Ga0126372_10512207 | Not Available | 1130 | Open in IMG/M |
| 3300010361|Ga0126378_10231268 | Not Available | 1936 | Open in IMG/M |
| 3300010361|Ga0126378_10833052 | Not Available | 1031 | Open in IMG/M |
| 3300010361|Ga0126378_13316475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300010362|Ga0126377_10414644 | Not Available | 1361 | Open in IMG/M |
| 3300010362|Ga0126377_10590151 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300010362|Ga0126377_12682208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300010362|Ga0126377_13440294 | Not Available | 512 | Open in IMG/M |
| 3300010373|Ga0134128_12776216 | Not Available | 540 | Open in IMG/M |
| 3300010376|Ga0126381_103803139 | Not Available | 590 | Open in IMG/M |
| 3300010376|Ga0126381_104030328 | Not Available | 571 | Open in IMG/M |
| 3300010398|Ga0126383_10516398 | Not Available | 1255 | Open in IMG/M |
| 3300010398|Ga0126383_12665001 | Not Available | 583 | Open in IMG/M |
| 3300010863|Ga0124850_1008533 | Not Available | 3245 | Open in IMG/M |
| 3300010863|Ga0124850_1012060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2749 | Open in IMG/M |
| 3300010868|Ga0124844_1241613 | Not Available | 639 | Open in IMG/M |
| 3300011269|Ga0137392_10685302 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012180|Ga0153974_1106623 | Not Available | 639 | Open in IMG/M |
| 3300012201|Ga0137365_10261280 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300012202|Ga0137363_10482631 | Not Available | 1040 | Open in IMG/M |
| 3300012204|Ga0137374_11067395 | Not Available | 578 | Open in IMG/M |
| 3300012205|Ga0137362_11608346 | Not Available | 537 | Open in IMG/M |
| 3300012206|Ga0137380_10344324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1330 | Open in IMG/M |
| 3300012206|Ga0137380_10502580 | Not Available | 1068 | Open in IMG/M |
| 3300012207|Ga0137381_10049205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3476 | Open in IMG/M |
| 3300012209|Ga0137379_10355040 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300012209|Ga0137379_10415562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1254 | Open in IMG/M |
| 3300012210|Ga0137378_10731278 | Not Available | 901 | Open in IMG/M |
| 3300012210|Ga0137378_10994742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300012211|Ga0137377_10085262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2978 | Open in IMG/M |
| 3300012211|Ga0137377_11706965 | Not Available | 551 | Open in IMG/M |
| 3300012211|Ga0137377_11762263 | Not Available | 540 | Open in IMG/M |
| 3300012211|Ga0137377_11846779 | Not Available | 523 | Open in IMG/M |
| 3300012212|Ga0150985_118197511 | Not Available | 521 | Open in IMG/M |
| 3300012285|Ga0137370_10417076 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300012350|Ga0137372_10505639 | Not Available | 898 | Open in IMG/M |
| 3300012351|Ga0137386_10606923 | Not Available | 788 | Open in IMG/M |
| 3300012351|Ga0137386_11154409 | Not Available | 544 | Open in IMG/M |
| 3300012357|Ga0137384_10776044 | Not Available | 776 | Open in IMG/M |
| 3300012357|Ga0137384_10839132 | Not Available | 742 | Open in IMG/M |
| 3300012361|Ga0137360_11280416 | Not Available | 633 | Open in IMG/M |
| 3300012361|Ga0137360_11689499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300012917|Ga0137395_10442109 | Not Available | 934 | Open in IMG/M |
| 3300012923|Ga0137359_11606248 | Not Available | 538 | Open in IMG/M |
| 3300012948|Ga0126375_10363981 | Not Available | 1031 | Open in IMG/M |
| 3300012948|Ga0126375_10465254 | Not Available | 933 | Open in IMG/M |
| 3300012960|Ga0164301_11252312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 599 | Open in IMG/M |
| 3300012961|Ga0164302_10676242 | Not Available | 761 | Open in IMG/M |
| 3300012971|Ga0126369_13574731 | Not Available | 509 | Open in IMG/M |
| 3300015371|Ga0132258_13612006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300015373|Ga0132257_103726703 | Not Available | 555 | Open in IMG/M |
| 3300016319|Ga0182033_10193475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NC92 | 1612 | Open in IMG/M |
| 3300016319|Ga0182033_11367260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300016357|Ga0182032_11394237 | Not Available | 607 | Open in IMG/M |
| 3300016371|Ga0182034_10539401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300016387|Ga0182040_10508644 | Not Available | 963 | Open in IMG/M |
| 3300016422|Ga0182039_10835960 | Not Available | 819 | Open in IMG/M |
| 3300016422|Ga0182039_12249271 | Not Available | 503 | Open in IMG/M |
| 3300018027|Ga0184605_10377248 | Not Available | 638 | Open in IMG/M |
| 3300018468|Ga0066662_10947008 | Not Available | 849 | Open in IMG/M |
| 3300018468|Ga0066662_11570843 | Not Available | 686 | Open in IMG/M |
| 3300020581|Ga0210399_11254595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300021444|Ga0213878_10055396 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300021560|Ga0126371_11106020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 931 | Open in IMG/M |
| 3300021560|Ga0126371_11274930 | Not Available | 869 | Open in IMG/M |
| 3300021560|Ga0126371_11530448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia stuartii | 795 | Open in IMG/M |
| 3300026309|Ga0209055_1112611 | Not Available | 1056 | Open in IMG/M |
| 3300026310|Ga0209239_1104911 | Not Available | 1194 | Open in IMG/M |
| 3300026325|Ga0209152_10306029 | Not Available | 596 | Open in IMG/M |
| 3300026538|Ga0209056_10197546 | Not Available | 1476 | Open in IMG/M |
| 3300027288|Ga0208525_1035186 | Not Available | 614 | Open in IMG/M |
| 3300027671|Ga0209588_1090477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300027748|Ga0209689_1065224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1979 | Open in IMG/M |
| 3300028787|Ga0307323_10111202 | Not Available | 984 | Open in IMG/M |
| 3300028787|Ga0307323_10331828 | Not Available | 545 | Open in IMG/M |
| 3300031543|Ga0318516_10063804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2031 | Open in IMG/M |
| 3300031544|Ga0318534_10654725 | Not Available | 595 | Open in IMG/M |
| 3300031545|Ga0318541_10148161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300031545|Ga0318541_10453228 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031549|Ga0318571_10414400 | Not Available | 528 | Open in IMG/M |
| 3300031561|Ga0318528_10315978 | Not Available | 839 | Open in IMG/M |
| 3300031561|Ga0318528_10699580 | Not Available | 542 | Open in IMG/M |
| 3300031564|Ga0318573_10584555 | Not Available | 601 | Open in IMG/M |
| 3300031572|Ga0318515_10163908 | Not Available | 1187 | Open in IMG/M |
| 3300031572|Ga0318515_10180108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300031572|Ga0318515_10608630 | Not Available | 580 | Open in IMG/M |
| 3300031573|Ga0310915_10024117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3734 | Open in IMG/M |
| 3300031573|Ga0310915_10067623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2347 | Open in IMG/M |
| 3300031573|Ga0310915_10076861 | Not Available | 2211 | Open in IMG/M |
| 3300031573|Ga0310915_10078920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2184 | Open in IMG/M |
| 3300031573|Ga0310915_10275118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1187 | Open in IMG/M |
| 3300031573|Ga0310915_10387943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300031573|Ga0310915_10968358 | Not Available | 594 | Open in IMG/M |
| 3300031640|Ga0318555_10265722 | Not Available | 927 | Open in IMG/M |
| 3300031668|Ga0318542_10405111 | Not Available | 705 | Open in IMG/M |
| 3300031679|Ga0318561_10648059 | Not Available | 581 | Open in IMG/M |
| 3300031679|Ga0318561_10769908 | Not Available | 529 | Open in IMG/M |
| 3300031680|Ga0318574_10568551 | Not Available | 665 | Open in IMG/M |
| 3300031713|Ga0318496_10480164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300031719|Ga0306917_10259602 | Not Available | 1333 | Open in IMG/M |
| 3300031719|Ga0306917_10631473 | Not Available | 842 | Open in IMG/M |
| 3300031719|Ga0306917_10922059 | Not Available | 683 | Open in IMG/M |
| 3300031723|Ga0318493_10034207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2330 | Open in IMG/M |
| 3300031744|Ga0306918_10039930 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
| 3300031744|Ga0306918_10756959 | Not Available | 759 | Open in IMG/M |
| 3300031747|Ga0318502_10201488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300031764|Ga0318535_10352959 | Not Available | 657 | Open in IMG/M |
| 3300031769|Ga0318526_10479395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300031771|Ga0318546_10486465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300031771|Ga0318546_10978095 | Not Available | 595 | Open in IMG/M |
| 3300031777|Ga0318543_10316264 | Not Available | 698 | Open in IMG/M |
| 3300031778|Ga0318498_10089523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1391 | Open in IMG/M |
| 3300031793|Ga0318548_10627827 | Not Available | 522 | Open in IMG/M |
| 3300031819|Ga0318568_10842489 | Not Available | 568 | Open in IMG/M |
| 3300031833|Ga0310917_10157254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1503 | Open in IMG/M |
| 3300031845|Ga0318511_10506243 | Not Available | 559 | Open in IMG/M |
| 3300031879|Ga0306919_10406809 | Not Available | 1044 | Open in IMG/M |
| 3300031879|Ga0306919_10756704 | Not Available | 747 | Open in IMG/M |
| 3300031890|Ga0306925_10632297 | Not Available | 1127 | Open in IMG/M |
| 3300031890|Ga0306925_11521181 | Not Available | 654 | Open in IMG/M |
| 3300031896|Ga0318551_10509062 | Not Available | 691 | Open in IMG/M |
| 3300031910|Ga0306923_11630610 | Not Available | 669 | Open in IMG/M |
| 3300031910|Ga0306923_11844365 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031941|Ga0310912_10575689 | Not Available | 876 | Open in IMG/M |
| 3300031942|Ga0310916_11477375 | Not Available | 555 | Open in IMG/M |
| 3300031945|Ga0310913_11089120 | Not Available | 558 | Open in IMG/M |
| 3300031946|Ga0310910_10192786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1578 | Open in IMG/M |
| 3300031946|Ga0310910_10473449 | Not Available | 994 | Open in IMG/M |
| 3300031946|Ga0310910_10988650 | Not Available | 658 | Open in IMG/M |
| 3300031959|Ga0318530_10086768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1230 | Open in IMG/M |
| 3300032010|Ga0318569_10047053 | Not Available | 1854 | Open in IMG/M |
| 3300032035|Ga0310911_10531226 | Not Available | 682 | Open in IMG/M |
| 3300032060|Ga0318505_10443503 | Not Available | 613 | Open in IMG/M |
| 3300032065|Ga0318513_10349019 | Not Available | 720 | Open in IMG/M |
| 3300032066|Ga0318514_10693848 | Not Available | 541 | Open in IMG/M |
| 3300032076|Ga0306924_10803292 | Not Available | 1048 | Open in IMG/M |
| 3300032076|Ga0306924_11639014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300032089|Ga0318525_10323256 | Not Available | 792 | Open in IMG/M |
| 3300032094|Ga0318540_10592872 | Not Available | 534 | Open in IMG/M |
| 3300032180|Ga0307471_103997324 | Not Available | 521 | Open in IMG/M |
| 3300032261|Ga0306920_101134758 | Not Available | 1132 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.57% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.57% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_03873330 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VAEHLMTLAANYLELAERALRLCEPATAVRRQHIKVVQKX |
| AF_2010_repII_A001DRAFT_100518063 | 3300000793 | Forest Soil | VAEYLMTLAANYLELAERALILREPAPAVRRQHIKVVQKE* |
| Ga0066395_100411312 | 3300004633 | Tropical Forest Soil | VAEHLMTLAANYLELAERALRLREPATAVRRQHIKAVQRE* |
| Ga0070708_1022785462 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AKECTKPSVAEYLMTLAANYLELAERALRLCEPATAVRRQHIKVVQKE* |
| Ga0070698_1003061853 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | CTKPSVAEYLTTLAANYLDLAEQALRLREPATAVRRQHIKVMQKE* |
| Ga0070699_1001882942 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEHLMTLAANYLELAERALRLCEPATAVRRQHIKVVQKE* |
| Ga0066707_108542362 | 3300005556 | Soil | CTKPSVAEYLMTLAAKYLELAERALGSRQPDTAIRRQHIKVVQKE* |
| Ga0066698_103866361 | 3300005558 | Soil | MTLAASYLELAERALRLREPVTAVRRQHIKVMQKE* |
| Ga0066905_1004722001 | 3300005713 | Tropical Forest Soil | VAEYLMTLAANYLELAERALRLCEPATAARRQHIKVMQKE* |
| Ga0066905_1015016381 | 3300005713 | Tropical Forest Soil | KPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVIQKE* |
| Ga0066903_1021083433 | 3300005764 | Tropical Forest Soil | RLAKECTKPSEAEHLMTLAANYLELAERALRLREPATGVRRQHIR* |
| Ga0066903_1023976061 | 3300005764 | Tropical Forest Soil | TKPSVAEYLMTLAANYLELAEQALILREPATAVRRQHIKAVQKE* |
| Ga0066903_1044674732 | 3300005764 | Tropical Forest Soil | MRLAANYLELAERALRLREPATAVRRQHIKAVQKD* |
| Ga0066903_1089163711 | 3300005764 | Tropical Forest Soil | KECTKPSEAEHLMTLAANYLELAERALRLREPATGVRRQHIG* |
| Ga0066903_1090931341 | 3300005764 | Tropical Forest Soil | KECTKPSEAEHLMTLAANYLELAERALRLREPATGVRRQQIR* |
| Ga0070717_107406223 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KPSVAEYLMTLAVNYLELAQRALTLREPTTAVRRQHLKVLQKE* |
| Ga0070712_1001834722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KTCTKPPVAEQLVTLAANYLELAERALGLRQLASAVRQQIKVVRKE* |
| Ga0066665_102043441 | 3300006796 | Soil | AKECTKPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHFKVVQKE* |
| Ga0066665_102813621 | 3300006796 | Soil | AKECTKPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE* |
| Ga0099793_100330731 | 3300007258 | Vadose Zone Soil | RLAKECTKPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE* |
| Ga0075423_112645501 | 3300009162 | Populus Rhizosphere | MRLAANYLELAESALRLREAATAVRRQHIKAVQKE* |
| Ga0126374_115948622 | 3300009792 | Tropical Forest Soil | MTLAASYLELAERALRLREPATAVRRQHLKAVQKE* |
| Ga0126380_102517612 | 3300010043 | Tropical Forest Soil | VAEYLMKLAANYLELAERALILREPATAIRRQQHIKAVQKE* |
| Ga0126380_108141802 | 3300010043 | Tropical Forest Soil | KPSVAEHLMRLAANYLELAERALRLREPATAARRQHLKAVQKE* |
| Ga0126380_113239671 | 3300010043 | Tropical Forest Soil | AKECTKPGVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE* |
| Ga0126384_104098702 | 3300010046 | Tropical Forest Soil | VAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVVQKE* |
| Ga0126384_107566892 | 3300010046 | Tropical Forest Soil | PSVAEYLMTLAANYLELAEQALILREPATAVRRQHIKVVQKE* |
| Ga0126384_114694042 | 3300010046 | Tropical Forest Soil | VAEYLMTLAANYLELAEQALILREPATAVRRQHIKVVQKE* |
| Ga0126384_121210111 | 3300010046 | Tropical Forest Soil | TLAANYLELAERALMLREPATTVRRQHIKAVQKE* |
| Ga0126382_102561244 | 3300010047 | Tropical Forest Soil | VAEYLMTLAANYLELAEQALILREPATAARRQHIKIVQKE* |
| Ga0126382_110588402 | 3300010047 | Tropical Forest Soil | VAEHLMTLAANYLELAERALRLAEPATAVRRQHIKAVQKE* |
| Ga0126373_106029772 | 3300010048 | Tropical Forest Soil | VAEYLMTLAANYLELAERALILREPATAVRQQHIKVVQKE* |
| Ga0134080_103788791 | 3300010333 | Grasslands Soil | IRLAKECTKPSVAEHLVALAANYLELAEQALRLREPATAVRRQHIKVMQKE* |
| Ga0126370_107294682 | 3300010358 | Tropical Forest Soil | LMTLAANYLELAERALRLREPATAVRRQHIKAVQRE* |
| Ga0126372_105122073 | 3300010360 | Tropical Forest Soil | MTLAANYLELAEQALVLREPATAVRRQHIKVVQKE* |
| Ga0126378_102312685 | 3300010361 | Tropical Forest Soil | YLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE* |
| Ga0126378_108330522 | 3300010361 | Tropical Forest Soil | MMLAANYLELAEQALILREPATAVRRQHIKVVQKE* |
| Ga0126378_133164752 | 3300010361 | Tropical Forest Soil | MRLAANYLELAERALRLREPATAVRRQHLKAVQKE* |
| Ga0126377_104146441 | 3300010362 | Tropical Forest Soil | KPSVAEYLMTLAASYLELAERALRLRKPVTAVGRQHIKVVQKE* |
| Ga0126377_105901512 | 3300010362 | Tropical Forest Soil | VAEYLMTLAANYLELVERALRLCEPATAAQRQHIKVMQKE* |
| Ga0126377_126822081 | 3300010362 | Tropical Forest Soil | KPSVAEHLIRLAANYLELAERALRLREPATAVRRQHIKAVQKE* |
| Ga0126377_134402941 | 3300010362 | Tropical Forest Soil | RLAKECTKPSVAEYLMTLAANYLELAEQALILREPATAVRRQHIKVVQKE* |
| Ga0134128_127762162 | 3300010373 | Terrestrial Soil | VAEQLVTLAANYLELAERALRLRQPASVVRQQIKVVRKE* |
| Ga0126381_1038031392 | 3300010376 | Tropical Forest Soil | AVYLMTLAVNYLELAQRALTLREPTTAVRRQHIKVLQKE* |
| Ga0126381_1040303282 | 3300010376 | Tropical Forest Soil | MTLAANYLELAERALILREPATAVRRQHIKVVQKE* |
| Ga0126383_105163981 | 3300010398 | Tropical Forest Soil | RLAKECTKPSVAEYLMTLAANYLELAEQALVLREPATAVRRQHIRVVQKE* |
| Ga0126383_126650011 | 3300010398 | Tropical Forest Soil | SVAEYLMKLAANYLELAERALILREPATAIRPQQHIKAVQKE* |
| Ga0124850_10085331 | 3300010863 | Tropical Forest Soil | MMLAANYLELAEQALILREPATAVRRQHFKVVQQE* |
| Ga0124850_10120604 | 3300010863 | Tropical Forest Soil | VAEYLMTLAANYLELAEQALILLEPATAVRRQHIKVVQKE* |
| Ga0124844_12416132 | 3300010868 | Tropical Forest Soil | MTLAANYLDLAEQALRLREPASAVRRQHIKVMQKE* |
| Ga0137392_106853022 | 3300011269 | Vadose Zone Soil | VAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE* |
| Ga0153974_11066231 | 3300012180 | Attine Ant Fungus Gardens | VAEYLITLAANYLELAEQALILREPATAVRRQHIK |
| Ga0137365_102612803 | 3300012201 | Vadose Zone Soil | VAEYLMTLAANYLELAERALRLRQPATAVRQEIKVVQKE* |
| Ga0137363_104826311 | 3300012202 | Vadose Zone Soil | VAEYLMTLAANYLELAERALILREPATAVRRQHIKVVQKE* |
| Ga0137374_110673951 | 3300012204 | Vadose Zone Soil | EQLMTLAANYLELAERAIRLRQPATAVRQQINVVQKE* |
| Ga0137362_116083461 | 3300012205 | Vadose Zone Soil | KECTKPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVIQKE* |
| Ga0137380_103443242 | 3300012206 | Vadose Zone Soil | VAEYLMTLAANYLELAEQALRLREPATVVRRQHIKVMQKE* |
| Ga0137380_105025802 | 3300012206 | Vadose Zone Soil | VAEHLTTLAANYLELAERAIRLRQPATADRQQINVVQKE* |
| Ga0137381_100492051 | 3300012207 | Vadose Zone Soil | VAEYLMTLAANYLELAERAIRLRQPATADRQQINVVQKE* |
| Ga0137379_103550402 | 3300012209 | Vadose Zone Soil | VAEYLMTLAANYLDLAEQALRLREPATVVRRQHIKVMQKE* |
| Ga0137379_104155622 | 3300012209 | Vadose Zone Soil | VAEYLMTLAASYLELAEQALRLRQPVTAVRRQHIKLVQKE* |
| Ga0137378_107312783 | 3300012210 | Vadose Zone Soil | RLAKECTKPSVAEYLMTLAANYLDLAEQAIRLGEPASAVRRQHIKVMQKE* |
| Ga0137378_109947422 | 3300012210 | Vadose Zone Soil | VAEHLTTLAANYLELAERALMLREPATTVRRQHIKAVQKE* |
| Ga0137377_100852627 | 3300012211 | Vadose Zone Soil | KPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHFKVVQKE* |
| Ga0137377_117069652 | 3300012211 | Vadose Zone Soil | AKECTKPSVAEHLVTLAANYLELAEQALRAPEPATAVRRRHIKVMQKE* |
| Ga0137377_117622631 | 3300012211 | Vadose Zone Soil | AEYLMTLAANYLELAEQALRLRQPVTAVRRQHIKLVQKE* |
| Ga0137377_118467791 | 3300012211 | Vadose Zone Soil | TLAASYLELAERALRLREPVTAVRRQHIKVMQKE* |
| Ga0150985_1181975111 | 3300012212 | Avena Fatua Rhizosphere | VAEQLVTLAANYLELAERALRLRQPASAVRQQIKVVRKG* |
| Ga0137370_104170762 | 3300012285 | Vadose Zone Soil | VAEQLMTLAANYLELAERALRLRQPATVVRRQIKLVQ |
| Ga0137372_105056391 | 3300012350 | Vadose Zone Soil | VAEYLMTLAANYLELAEQALRLREPATAVRRRHIKVMQKE* |
| Ga0137386_106069231 | 3300012351 | Vadose Zone Soil | VAEYLMTLAASYLELAEQALRLREPATAVRRRHIKVMQKE* |
| Ga0137386_111544092 | 3300012351 | Vadose Zone Soil | KPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE* |
| Ga0137384_107760441 | 3300012357 | Vadose Zone Soil | VAEQLMTLAANYLELAERAIRLRQPATADRQQINVVQKE* |
| Ga0137384_108391321 | 3300012357 | Vadose Zone Soil | LMTLAANYLELAEQALRLCEPATAVRRQHFKVVQKE* |
| Ga0137360_112804161 | 3300012361 | Vadose Zone Soil | MTLAANYLDLAEQALRVREPATAVRRRHIKIMEKE* |
| Ga0137360_116894991 | 3300012361 | Vadose Zone Soil | VAEYLMALAATYLELAVRALRLRQLATANRRHHIKLVQNE* |
| Ga0137395_104421091 | 3300012917 | Vadose Zone Soil | VAEYLMTLAANYLELAERALRLCEPATAVRRQHIKVVQKE* |
| Ga0137359_116062482 | 3300012923 | Vadose Zone Soil | MEGGSTTANYLELAERALRLREPATAIRRRHIKVMQKE* |
| Ga0126375_103639811 | 3300012948 | Tropical Forest Soil | VAEHLMTLAANYLELAERALRLREPATAVRRQHIKVVQRE* |
| Ga0126375_104652541 | 3300012948 | Tropical Forest Soil | VAEHLMSLAANYLELAERALRLREPATAVRRQHIKAVQKE* |
| Ga0164301_112523121 | 3300012960 | Soil | VAEHLVTLAANYLELAEQALRLREPATAVRRQHIKVM |
| Ga0164302_106762421 | 3300012961 | Soil | VAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVLQKA* |
| Ga0126369_135747312 | 3300012971 | Tropical Forest Soil | VAEHLMTLAANYLELAERALRLREAATAVRRQHIKVVQKASVASG* |
| Ga0132258_136120061 | 3300015371 | Arabidopsis Rhizosphere | MTLAASYLELAERALRLREPGTAVRRQHIKVIQKE* |
| Ga0132257_1037267032 | 3300015373 | Arabidopsis Rhizosphere | MRLAANYLELAEAALRLREPATAVRRQHIKAVQKE* |
| Ga0182033_101934753 | 3300016319 | Soil | VAEYLMTLAANYLDLAEQALRLREPATVVRRQQIKVMQKE |
| Ga0182033_113672601 | 3300016319 | Soil | SVAEHLMTLAANYLELAERALRLREPAAAVRRQHLKAVQKE |
| Ga0182032_113942372 | 3300016357 | Soil | LAKECTKPSVAEHLMTLAASYLELAERALRLREPATAVRRQHIKVMQKE |
| Ga0182034_105394013 | 3300016371 | Soil | KPSVAECLMTLAANYLELAEQALRLREPATAVRRQHIKVKHKE |
| Ga0182040_105086443 | 3300016387 | Soil | KPSVAEYLMKLAANYLELAERALRLRQRVTAVGRQHIKVVQKE |
| Ga0182039_108359601 | 3300016422 | Soil | EYLMTLAANYLDLAEQALRLREPATVVRRQQIKVMQKE |
| Ga0182039_122492712 | 3300016422 | Soil | LMTLAANYLELAEQALILREPAAAVRRQHIKAVQKE |
| Ga0184605_103772481 | 3300018027 | Groundwater Sediment | VAEYLMTLAANYLELAERALILREPATAVRRQHIKAVQRE |
| Ga0066662_109470082 | 3300018468 | Grasslands Soil | AKECTKPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE |
| Ga0066662_115708432 | 3300018468 | Grasslands Soil | AKECTKPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHFKVVQKE |
| Ga0210399_112545952 | 3300020581 | Soil | EAEHLMTLAANYLELAERALRLREPATGVRRQHIR |
| Ga0213878_100553961 | 3300021444 | Bulk Soil | VAEYLMALAANHLELAERALILREPATAVRRQHIKVVQKE |
| Ga0126371_111060202 | 3300021560 | Tropical Forest Soil | VAEYLMTLAANYLELAERALILREPAPAVRRQHIKVVQKE |
| Ga0126371_112749302 | 3300021560 | Tropical Forest Soil | MKLAANYLELAERALRLREPATAVRQQHIKVMQKE |
| Ga0126371_115304482 | 3300021560 | Tropical Forest Soil | CNKPSVAEHLMTLAANYLELAERALRLAEPATAVRRQHIKAVQKE |
| Ga0209055_11126112 | 3300026309 | Soil | VAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE |
| Ga0209239_11049112 | 3300026310 | Grasslands Soil | VAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVMQKE |
| Ga0209152_103060292 | 3300026325 | Soil | LAKECTKPSVAEYLMTLAANYLELAEQALRLCEPATAVRRQHIKVVQKE |
| Ga0209056_101975462 | 3300026538 | Soil | VAEYLMTLAANYLELAEQALRLCEPATAVRRQHFKVVQKE |
| Ga0208525_10351861 | 3300027288 | Soil | MTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0209588_10904771 | 3300027671 | Vadose Zone Soil | LMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0209689_10652245 | 3300027748 | Soil | KACTKPKVAEYLMTLAANYLDLAEQAIRLGEPASAVRRQHIKVMQKE |
| Ga0307323_101112022 | 3300028787 | Soil | EYLMTLAANYLELAERALILREPATAVRRQHIKAVQRE |
| Ga0307323_103318281 | 3300028787 | Soil | VAEYLMPLAANYLELAERALILREPATAVRRQHIKAVQRE |
| Ga0318516_100638043 | 3300031543 | Soil | VAEYLMTLAANYLELAERALRLYEPATAARRQHIKVMQKE |
| Ga0318534_106547252 | 3300031544 | Soil | VAEYLMTLGANYLELAERALRLCEPATAARRQHIKVMQKE |
| Ga0318541_101481611 | 3300031545 | Soil | MLAKECTKPSVAEHLMTLAASYLELAERALRLREPATAVRRQHIKVMQKE |
| Ga0318541_104532282 | 3300031545 | Soil | VAEYLMTLGANYLELAERALRLCEPATAARRQHIKVIQKE |
| Ga0318571_104144002 | 3300031549 | Soil | VAEYLMTLAANYLELAEQALMLREPATAVRRQHIKIVQKE |
| Ga0318528_103159781 | 3300031561 | Soil | MRLAVNYLELAERALRLREPATAVRQQHIKVMQKE |
| Ga0318528_106995801 | 3300031561 | Soil | MDLRTRYKPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0318573_105845551 | 3300031564 | Soil | CTKPSVAEYLMTLAANYLELAEQALMLREPATAARRQHIKIVQKE |
| Ga0318515_101639082 | 3300031572 | Soil | LMKLAANYLELAERALRLRKPVTAVGRQHIKVVQKE |
| Ga0318515_101801082 | 3300031572 | Soil | MKLAANYLELAERALRLRQPVTAVRRQHIKVVQKE |
| Ga0318515_106086301 | 3300031572 | Soil | AKECTKPSVAEYLMTLAANYLELAEQALILREPATAVRRQHIKIVQKE |
| Ga0310915_100241171 | 3300031573 | Soil | AKECTKPSVAEYLMMLAANYLELAERALILREPDTAVRRQHIKAVQKE |
| Ga0310915_100676232 | 3300031573 | Soil | VAEHLMGLAANYLELAERALRLREPATAVRRQHIKVVQKE |
| Ga0310915_100768612 | 3300031573 | Soil | MTLAANYLELAEQALVLREPATAVRRQHIKVVQKE |
| Ga0310915_100789202 | 3300031573 | Soil | VAEYLMTLASNYLELAERALILRKPATAVRRQHIKVVQKE |
| Ga0310915_102751181 | 3300031573 | Soil | VAEYLMTLAANYLELAERALRLCEPATAARRQHIKVMQKE |
| Ga0310915_103879432 | 3300031573 | Soil | MKLAANYLELAERALRLRQRVTAVGRQHIKVVQKE |
| Ga0310915_109683581 | 3300031573 | Soil | CTKPSVAEYLMTLAANYLELAEQALILREPATAVRRQHIKIVQKE |
| Ga0318555_102657222 | 3300031640 | Soil | VAEYLMTLAANYVELAERALRLREPATAVRRQHIKVMQKE |
| Ga0318542_104051112 | 3300031668 | Soil | VAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0318561_106480591 | 3300031679 | Soil | VAEYLMTLAANYLELAEQALILREPATAVRRQHIKVVQKE |
| Ga0318561_107699082 | 3300031679 | Soil | TKPSVAEYLMTLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0318574_105685513 | 3300031680 | Soil | VAEYLMMLAANYLELAERALILREPATAVRRQHIKAVQKE |
| Ga0318496_104801641 | 3300031713 | Soil | IRLAKECTKPSVAEHLMRLAANYLELAERALRLREPATPVRRQHLKAVQKE |
| Ga0306917_102596023 | 3300031719 | Soil | VAEYLMTLAVNYLELAERALTLREPTTAVRRQHIKVLQKE |
| Ga0306917_106314732 | 3300031719 | Soil | VAEYLMTLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0306917_109220591 | 3300031719 | Soil | AEYLMMLAANYLELAERALILREPDTAVRRQHIKAVQKE |
| Ga0318493_100342071 | 3300031723 | Soil | CIRLAKECTKPSVAEYLMMLAANYLELAERALILREPATAVRRQHIKAVQKE |
| Ga0306918_100399302 | 3300031744 | Soil | VAEYLMTLGANYLELAERALRLCEPATAAWRQHIKVMQKE |
| Ga0306918_107569591 | 3300031744 | Soil | VAEYLMTLAANYLELAEQALRLCESATAARPQHIKVMQKE |
| Ga0318502_102014882 | 3300031747 | Soil | MTLAASYLELAERALRLREPATAVRRQHIKVMQKE |
| Ga0318535_103529592 | 3300031764 | Soil | ECTKPSVAECLMTLAANYLELAERALRLRESATAVRRQHLEVMQKE |
| Ga0318526_104793951 | 3300031769 | Soil | IRLAKECTKPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0318546_104864651 | 3300031771 | Soil | EHLMRLAANYLELAERALRLREPATPVRRQHLKAVQKE |
| Ga0318546_109780952 | 3300031771 | Soil | KQCTKPSVAEYLMTLAANYLELAEQALILREPAAAVRRQHIKIVQKE |
| Ga0318543_103162641 | 3300031777 | Soil | TKPSVAECLMTLAANYLELAEQALILREPATAVRRQHIKVVQKE |
| Ga0318498_100895231 | 3300031778 | Soil | NECTKPSVAEYLMTLAANYLELAERALRLCEPATAARRQHIKVMQKE |
| Ga0318548_106278271 | 3300031793 | Soil | VAEYLMTLASNYLELAERALILRKPATAVRRQHIK |
| Ga0318568_108424892 | 3300031819 | Soil | AKQCTKPSVAEYLMTLAANYLELAEQALILREPAAAVRRQHIKIVQKE |
| Ga0310917_101572541 | 3300031833 | Soil | AKECSKPSVAEYLMTLAVNYLELAERALTLREPTTAVRRQHIKVLQKE |
| Ga0318511_105062431 | 3300031845 | Soil | VHKARKLAKECTKPSVAEYLMTLAANYVELAERALRLREPATAVRRQHIKVMQKE |
| Ga0306919_104068091 | 3300031879 | Soil | VAEYLMTLAANYLELAERALILREPATAARRQHIKAVQKE |
| Ga0306919_107567042 | 3300031879 | Soil | SVAEYLMTLASNYLELAERALILRKPATAVRRQHIKVVQKE |
| Ga0306925_106322972 | 3300031890 | Soil | VAEHLMTLAANYLELAERALSLREPATAVRRQHIKLMQKE |
| Ga0306925_115211812 | 3300031890 | Soil | MTLAASYLELAERALRLRESATAVRRQHIKVMQEE |
| Ga0318551_105090623 | 3300031896 | Soil | PSVAEYLMTLAVNYLELAERALTLREPTTAVRRQHIKVLQKE |
| Ga0306923_116306101 | 3300031910 | Soil | VAEYLMTLAANYLELAEQALRLCEPATAARPQHIKVMQKE |
| Ga0306923_118443652 | 3300031910 | Soil | VAEYLMTLGANYLELAERALRLCEPATAALRQHIKVMQKE |
| Ga0310912_105756891 | 3300031941 | Soil | IRLAKECTKPSVAEYLMTLAANYLELAEQALMLREPATAARRQHIKIVQKE |
| Ga0310916_114773752 | 3300031942 | Soil | LMTLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0310913_110891201 | 3300031945 | Soil | EYLMTLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0310910_101927861 | 3300031946 | Soil | AKECTKPSVAEYLMKLAANYLELAERALRLRQPVTAVRRQHIKVVQKE |
| Ga0310910_104734491 | 3300031946 | Soil | LAKECTKPSVAEYLMTLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0310910_109886502 | 3300031946 | Soil | RLAKESTKPSVAEHLMTLAANYLELAERALSLREPATAVRRQHIKLMQKE |
| Ga0318530_100867683 | 3300031959 | Soil | IRLAKECTKPSVAEHLMTLAANYLELAERALRLREPATAVRRQHLKAVQKE |
| Ga0318569_100470534 | 3300032010 | Soil | VAEYLMTLAANYLELAEQALMLREPATAARRQHIKIVQKE |
| Ga0310911_105312261 | 3300032035 | Soil | LAKECTKPSVAEYLMRLAVNYLELAERALRLREPATAVRQQHIKVMQKE |
| Ga0318505_104435031 | 3300032060 | Soil | VAEYLMMLAANYLELAERALILREPATAVRRQHIKVMQKE |
| Ga0318513_103490191 | 3300032065 | Soil | RLAKECTKPSVAEYLMTLAANYLELAEQALMLREPATAARRQHIKIVQKE |
| Ga0318514_106938482 | 3300032066 | Soil | ECTKPSVAEYLMTLAANYLELAEQALMLREPATAARRQHIKIVQKE |
| Ga0306924_108032922 | 3300032076 | Soil | VAEHLVTLAANYLELAEQALRLREPATAVRRQHIKVMHKE |
| Ga0306924_116390141 | 3300032076 | Soil | KPSVAEYLMTLAASYLELAERALRLREPVTAVRRQHIKVMQKE |
| Ga0318525_103232561 | 3300032089 | Soil | CIRLAKECTKPSVAEYLMTLAANYLELAEQALMLREPATAVRRQHIKIVQKE |
| Ga0318540_105928722 | 3300032094 | Soil | AKECTKPSVAEYLMTLASNYLELAERALILRKPATAVRRQHIKVVQKE |
| Ga0307471_1039973241 | 3300032180 | Hardwood Forest Soil | MLAKACTKPKVAEYLMTLAANYLDLAEQALRLREPATAVRRQHIKVMQK |
| Ga0306920_1011347583 | 3300032261 | Soil | VVEYLMTLAANYLDLAEQALRLREPATVVRRQQIKVMQKE |
| ⦗Top⦘ |