


| Basic Information | |
|---|---|
| Family ID | F034205 |
| Family Type | Metagenome |
| Number of Sequences | 175 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQL |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 44.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.14 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.571 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (42.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF03013 | Pyr_excise | 35.43 |
| PF14743 | DNA_ligase_OB_2 | 12.00 |
| PF01068 | DNA_ligase_A_M | 12.00 |
| PF04404 | ERF | 2.29 |
| PF04542 | Sigma70_r2 | 2.29 |
| PF00462 | Glutaredoxin | 1.14 |
| PF00118 | Cpn60_TCP1 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 12.00 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 12.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.29 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.29 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.29 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.29 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.57 % |
| All Organisms | root | All Organisms | 31.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 42.86% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.29% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 13.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.57% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.86% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.29% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.14% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.14% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.14% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.14% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.14% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.14% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.57% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.57% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.57% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026101 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3819_2500 (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100204446 | 3300000101 | Marine | MNKNQQQLYKDISELTKAVQKLVKLLTKIAKEQND* |
| DelMOSum2010_102463542 | 3300000101 | Marine | MTRNEQQLYKDISELTKAVQKLVKLLTKIAKEQND* |
| DelMOSum2011_101441631 | 3300000115 | Marine | MNKNEQQLYRDISELTKAVQKLVKLLTKIAKEQND* |
| DelMOWin2010_100016467 | 3300000117 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA* |
| JGI24006J15134_100403322 | 3300001450 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLLEKMAKQQL* |
| JGI24006J15134_100600883 | 3300001450 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLLEKIARQQND* |
| JGI24006J15134_101142113 | 3300001450 | Marine | MNRHEQEMYRDISDLTKAVQKLVKLLEKLIKDNA* |
| JGI24006J15134_101220843 | 3300001450 | Marine | MNNNEKQLYRDISNLTKAVQKLVKLIEKMAKQQL* |
| JGI24006J15134_101518392 | 3300001450 | Marine | MNRNEQQLYKDISSLTKAVQRLVKLLEKIAKQQND* |
| KVRMV2_1004439732 | 3300002231 | Marine Sediment | MNKNEQQXYKDISNLTKAVQKLVKLLEKIAKQQNL* |
| KVRMV2_1015008622 | 3300002231 | Marine Sediment | MNRNEQQLYKDISDLTKAVQQLVKLLTKIAKEQND* |
| Ga0078893_107267154 | 3300005837 | Marine Surface Water | MTRNEQQLYKDISELTKAVQKLVKLLTKIAKDQND* |
| Ga0068503_111259392 | 3300006340 | Marine | MNRNEQQLYKDISCLTKAVQRLVKLLEKLAKDQL* |
| Ga0098038_10060216 | 3300006735 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLIEKIAKKQND* |
| Ga0098038_10060396 | 3300006735 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLIEQMAKQQL* |
| Ga0098038_10071952 | 3300006735 | Marine | MNRNQQQLYKDISELTKAVQKLVKLLTKIAKEQND* |
| Ga0098038_10444702 | 3300006735 | Marine | MNKNEQQMYKDISSLTKAVQKLVKLLEKLIKDNA* |
| Ga0098038_10632143 | 3300006735 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLIEKIAKQQNK* |
| Ga0098038_10678652 | 3300006735 | Marine | MNRNQQQLYKDISDLTKAVQKLVKLIEQMAKKQL* |
| Ga0098038_10891234 | 3300006735 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLTKIAKDQND* |
| Ga0098038_11054524 | 3300006735 | Marine | MTKNEQQLYKDISNLTKAVQKLVKLLEKAIKDNS* |
| Ga0098038_11123642 | 3300006735 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL* |
| Ga0098038_12227751 | 3300006735 | Marine | EIMNKNEQQMYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0098038_12865821 | 3300006735 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLIEQMAKQQL* |
| Ga0098033_10639992 | 3300006736 | Marine | MNRNEQQLYKDISSLTKAVQRLVKLLEKLAKDQL* |
| Ga0098037_11681802 | 3300006737 | Marine | MNKNEQQLYKDISNLTKALTKLVKILEKLAKEQL* |
| Ga0098037_12989462 | 3300006737 | Marine | MTRDEKQLYRDISNLTKAVQKLVKLIEQMAKQQL* |
| Ga0098042_10144845 | 3300006749 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLTKLAKDQS* |
| Ga0098058_11349032 | 3300006750 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLMEKIAKSQL* |
| Ga0098058_11761642 | 3300006750 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLIEKMAKSQL* |
| Ga0098058_12104172 | 3300006750 | Marine | MTRNEQQLYKNINELTKAVQKLVKLLTKMAKDQND* |
| Ga0098048_10595614 | 3300006752 | Marine | LNVYEIMNKNQQQLYKDISDLTKAVQKLVKLIEKMAKQQL* |
| Ga0098044_13468392 | 3300006754 | Marine | MNRNQQQLYKDISNLTKAVQKLVKLLEKMAKSQL* |
| Ga0098054_11566822 | 3300006789 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKNQND* |
| Ga0070748_10891023 | 3300006920 | Aqueous | MNRNEQQLYKDISDLTKAVKKLVKLIEKMAKQQL* |
| Ga0070748_11084632 | 3300006920 | Aqueous | MTKNEQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0070748_13046641 | 3300006920 | Aqueous | MNRNEQQLYKDISDLTKAVQKLVKLLTKLAKEQG* |
| Ga0098060_10073957 | 3300006921 | Marine | MNKNEQQMYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0098060_10109315 | 3300006921 | Marine | MNRHERQMYEDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0098060_10712954 | 3300006921 | Marine | EIMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0098060_10740132 | 3300006921 | Marine | MNKNQQQLYKDISDLTKAVQKLVKLLTKIAKEQND* |
| Ga0098060_10745652 | 3300006921 | Marine | MTRDEQQLYRDISNLTKAVQKLVKLIEQMAKKQL* |
| Ga0098060_11043173 | 3300006921 | Marine | MTKNEQQLYRDISNLTKAVQKLVKLLEKAIKDNS* |
| Ga0098060_11311412 | 3300006921 | Marine | MNKNEQQLYRDISNLTKAVQRLVKLIEQMAKKQL* |
| Ga0098060_11450722 | 3300006921 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLEKLIKENA* |
| Ga0098060_11881632 | 3300006921 | Marine | MTRNEQQLYKDISDLTKAVQKLVKLIEKMAKQQL* |
| Ga0098045_11157281 | 3300006922 | Marine | IMNKNQQQLYKDISDLTKAVQKLVKLIEKMAKQQL* |
| Ga0098051_11206182 | 3300006924 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0098051_11956713 | 3300006924 | Marine | YATMNKNEQQLYRDISELTKAVQKLVKLMEKIAKSQL* |
| Ga0098041_10085123 | 3300006928 | Marine | MNKNQQQLYKDISDLTKAVQKLVKLIEKMAKQQL* |
| Ga0098041_10136208 | 3300006928 | Marine | MNKDQQQLYRDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0098041_10227272 | 3300006928 | Marine | MNKNEQQLYRDISELTKAVQKLVKLLTKIAKDQND* |
| Ga0098041_10970152 | 3300006928 | Marine | MTRDEQQMYKDISNLTKAVQKLVKLLEKAIKDNS* |
| Ga0098041_12384341 | 3300006928 | Marine | IMNKNEQQMYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0098036_11316023 | 3300006929 | Marine | MTRDQQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0098036_11933782 | 3300006929 | Marine | MNKNEQQLYRDISNLTKAVQRLVKLIEKMAKQQL* |
| Ga0098046_10847062 | 3300006990 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLMEKIAKAQL* |
| Ga0070747_100833013 | 3300007276 | Aqueous | MTKNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0070747_10548841 | 3300007276 | Aqueous | RKMTRNEQQLYKDISELTKAVQKLVKLLTKIAKDQND* |
| Ga0070747_12860173 | 3300007276 | Aqueous | MNRNEQQLYKDISDLTKAVQKLVKLLTKLAKEQGL* |
| Ga0070747_13166922 | 3300007276 | Aqueous | MNKNEQQLYKDISNLTKAVQKLVKLLTKLAKDQS* |
| Ga0099847_12226392 | 3300007540 | Aqueous | MNKNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0099847_12380992 | 3300007540 | Aqueous | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL* |
| Ga0102817_10975612 | 3300007555 | Estuarine | MNKNEQQLYKDISNLTKAVQRLVKLIEKMAKQQL* |
| Ga0105739_11624162 | 3300007954 | Estuary Water | MNRNEQQLYKDISNLTKAVQKLVKLLEKIAKQQIL* |
| Ga0110931_10335223 | 3300007963 | Marine | MNKNQQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0110931_12674382 | 3300007963 | Marine | MNKNEQQLYKDISDLTKAVQKLVKLMTKLMKEQND* |
| Ga0105747_10902471 | 3300007974 | Estuary Water | VTMNKNQQQLYRDISELTKAVQKLVKLLTKIAKEQND* |
| Ga0114899_10803372 | 3300008217 | Deep Ocean | MNKNEQQLYKDISNLTKAVQKLVKLMEKIAKTQL* |
| Ga0114899_12430112 | 3300008217 | Deep Ocean | MNRNEQQLYKDISDLTKAVQKLVKLIEKMAKQQL* |
| Ga0114899_12653131 | 3300008217 | Deep Ocean | IMNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQL* |
| Ga0114904_11010442 | 3300008218 | Deep Ocean | MNKNEQQLYRDISNLTKAVQKLVKLMEKIAKQQL* |
| Ga0114904_11576033 | 3300008218 | Deep Ocean | MNRNQQQLYKDISDLTKAVQQLVKLLTKIAKEQND* |
| Ga0114905_12042601 | 3300008219 | Deep Ocean | MTRNQQQMYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0114910_10384722 | 3300008220 | Deep Ocean | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQL* |
| Ga0114910_10444783 | 3300008220 | Deep Ocean | MNRNEQQLYKDISDLTKAVQKLVKLMEKIAKAQL* |
| Ga0114910_11039962 | 3300008220 | Deep Ocean | MNRNEQQLYRDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0114910_11231772 | 3300008220 | Deep Ocean | MNKNEQQLYRDISNLTKAVQKLVKLMEKIAKAQL* |
| Ga0114910_11625452 | 3300008220 | Deep Ocean | MNRNEQQLYKDISNLTKAVQKLVKLLTKLAKEQS* |
| Ga0114910_11854242 | 3300008220 | Deep Ocean | MNKNEQQLYRDISNLTKAVQKLVKLLEKIAKQQL* |
| Ga0114909_11370331 | 3300009414 | Deep Ocean | MTKNEQQLYKDISSLTKAVQKLVKLLEKLIKDNA* |
| Ga0114909_11541542 | 3300009414 | Deep Ocean | MNKNEQQLYRDISSLTKAVQKLVKLMEKIAKAQL* |
| Ga0114908_11142772 | 3300009418 | Deep Ocean | MNKNQQQLYKDISNLTKAVQKLVKLIEKLIKDNA* |
| Ga0114997_106834062 | 3300009425 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLMEKIAKTQL* |
| Ga0114915_10312312 | 3300009428 | Deep Ocean | MNKNEQQLYRDISDLTKAVQRLVKLIEKMAKQQL* |
| Ga0115545_11450522 | 3300009433 | Pelagic Marine | MNKNQQQLYRDISELTKAVQKLVKLLTKIAKEQND* |
| Ga0115007_108810142 | 3300009441 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLIEKMAKAQL* |
| Ga0115554_12493583 | 3300009472 | Pelagic Marine | MTRNEHQLYKDISELTKAVQKLVKLLTKIAKEQND* |
| Ga0115013_113542812 | 3300009550 | Marine | MTRNEQQLYKDISNLTKAVQKLVKLLEKAIKDNA* |
| Ga0114900_10688612 | 3300009602 | Deep Ocean | MNKNEQQLYKDISDLTKAVQKLVKLLEKLIKDNA* |
| Ga0114900_10913722 | 3300009602 | Deep Ocean | MNKNEQQLYRDISNLTKAVQKLVKLLEKIAKQQNL* |
| Ga0114911_10387364 | 3300009603 | Deep Ocean | MNRNEQQLYKDISDLTKAVQKLVKLLEKAIKDNS* |
| Ga0114901_11271661 | 3300009604 | Deep Ocean | YETMNKNEQQMYKDISSLTKAVQKLVKLLEKLIKDNA* |
| Ga0114906_11681712 | 3300009605 | Deep Ocean | MNKNEQQMYKDISNLTKAVQKLVKLLEKIAKQQNL* |
| Ga0114912_11140642 | 3300009620 | Deep Ocean | MNRNEQQLYKDISDLTKAVQKLVKLMEKIAKTQL* |
| Ga0114933_105823552 | 3300009703 | Deep Subsurface | MNRNEQQLYKDISNLTKAVQKLVKLLEKIAEQQNL* |
| Ga0114999_112849022 | 3300009786 | Marine | MNRNEQQLYRDISNLTKAVQKLVKLLEKIAKQQND* |
| Ga0115012_110234312 | 3300009790 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0115012_117846362 | 3300009790 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLLTKLAKEQS* |
| Ga0098056_11915412 | 3300010150 | Marine | MNKNEQQMYRDISNLTKAVQKLVKLLEKVIKDNA* |
| Ga0098061_10467945 | 3300010151 | Marine | MTRDEQQLYRDISNLTKAVQRLVKLIEQMAKKQL* |
| Ga0098061_12075782 | 3300010151 | Marine | MTKNEQQLYKDISNLTKAVQKLVKLIEQMAKKQL* |
| Ga0098059_12993451 | 3300010153 | Marine | YLNVYEIMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKSQL* |
| Ga0098059_13389262 | 3300010153 | Marine | MTRNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0114934_104391691 | 3300011013 | Deep Subsurface | YEIMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKQQL* |
| Ga0151674_10138992 | 3300011252 | Marine | MNKNQQQLYKDISNLTKAVQKLVKLMEKIAKSQL* |
| Ga0151671_10145952 | 3300011253 | Marine | MNRNEQQIYKDISDLTKAVQKLVKLLTKLAKEQND* |
| Ga0160423_104963492 | 3300012920 | Surface Seawater | MNKNEQQMYKDISSLTKAVQKLVKLLEKLIKENA* |
| Ga0163180_106285433 | 3300012952 | Seawater | MNKNEQQLYKDISDLTKAVQKLVKLLTKLAKEQEL* |
| Ga0163180_109417182 | 3300012952 | Seawater | MNRNEQQLYRDISNLTKALEKLVKVLTKLAKEQQ* |
| Ga0163179_100662153 | 3300012953 | Seawater | MNKNEQQMYRDISNLTKAVQKLVKLLEKLIKDNA* |
| Ga0163179_107500892 | 3300012953 | Seawater | MTRDEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL* |
| Ga0163179_109214823 | 3300012953 | Seawater | MNRNQQQLYKDISDLTKAVQKLVKLLTKLAKEQG* |
| Ga0181369_10945332 | 3300017708 | Marine | MTRNEQQLYKNINELTKAVQKLVKLLTKMAKDQND |
| Ga0181387_10831312 | 3300017709 | Seawater | MNRNEQQLYKDISNLTKAVQKLVKLIEKIAKQQNL |
| Ga0181373_10979822 | 3300017721 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLMTKLMKEQND |
| Ga0181416_10604524 | 3300017731 | Seawater | YEIMNRNEQQLYKDISDLTKAVQKLVKLLEKLIKDNA |
| Ga0181415_10764222 | 3300017732 | Seawater | MNKNEQQLYKDISNLTKALTKLVKLMEKIIKQRMDEVNKILKKGNK |
| Ga0181415_11210632 | 3300017732 | Seawater | MNKNQQQLYRDISELTKAVQKLVKLLTKIAKDQND |
| Ga0181428_11428951 | 3300017738 | Seawater | MNKNEQQLYKDISDLTKAVQKLVKLLTKIAKDQND |
| Ga0181427_11807622 | 3300017745 | Seawater | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKNQND |
| Ga0181393_10561193 | 3300017748 | Seawater | MTKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL |
| Ga0181392_11250642 | 3300017749 | Seawater | MNKNEQQLYKDISNLTKAVQKLVKLMEKIAKQQNL |
| Ga0181382_11564113 | 3300017756 | Seawater | MNRNEQQLYKDISDLTKAVQKLVKLIEKIAKQQNK |
| Ga0181420_11643503 | 3300017757 | Seawater | YEIMNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL |
| Ga0181420_11906601 | 3300017757 | Seawater | KQYEIMNKNEQQLYRDISNLTKAVQRLVKLLEQMAKQQL |
| Ga0181414_11002743 | 3300017759 | Seawater | MNKNEQQLYRDISNLTKAVQKLVKLIEKIAKQQNK |
| Ga0181422_10569662 | 3300017762 | Seawater | MNKNEQQLYKDISNLTKAVQKLVKLIEKIAKQQNK |
| Ga0181385_12251432 | 3300017764 | Seawater | MTKNEQQMYKDISNLTKAVQKLVKLIEKIAKQQNL |
| Ga0181413_10094126 | 3300017765 | Seawater | MNKNEQQLYRVISELTKAVQKLVKLLTKIAKDQND |
| Ga0181413_12040712 | 3300017765 | Seawater | MNRNEQQLYKDISELTKSVQRLVKLLTKIAKEQND |
| Ga0181413_12446173 | 3300017765 | Seawater | QEQMTKNEKQLYKDISDLTKAVQKLVKLLEKMAKQQL |
| Ga0187220_11209264 | 3300017768 | Seawater | YETMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKSQL |
| Ga0187220_12451671 | 3300017768 | Seawater | IMNRNEQQLYKDISDLTKAVQKLVKLLTKLAKDQS |
| Ga0187217_11637874 | 3300017770 | Seawater | RCSNAYVTMNKNEQQLYRDISELTKAVQKLVKLLTKIAKDQND |
| Ga0181425_12515741 | 3300017771 | Seawater | EIMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKSQL |
| Ga0181430_12455152 | 3300017772 | Seawater | TMNKNQQQLYRDISELTKAVQKLVKLLTQVIKDNA |
| Ga0181386_10707844 | 3300017773 | Seawater | YLNVYETMNKNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA |
| Ga0181386_11527822 | 3300017773 | Seawater | MNRNEQQLYKDISNLTKAVQKLVKLLETIAKQQNL |
| Ga0181423_13285182 | 3300017781 | Seawater | MNKNEQQLYRDISEITKAVQKLVKLLTKIAKDQND |
| Ga0206125_100301782 | 3300020165 | Seawater | MNKNEQQLYRDISELTKAVQKLVKLLTKIAKEQND |
| Ga0206127_12057001 | 3300020169 | Seawater | NAYVTMNKNEQQLYRDISELTKAVQKLVKLLTKIAKEQND |
| Ga0211677_100785562 | 3300020385 | Marine | MNKNQQQLYRDISELTKAVQKLVKLLTKIAKEQND |
| Ga0211576_100169148 | 3300020438 | Marine | MNKNEQQLYRDISELTKAVQKLVKLLTKIAKDQND |
| Ga0211576_100524052 | 3300020438 | Marine | MNRHEHQMYKDISDLTKAVQKLVKLIEKIAKQQNK |
| Ga0211576_100884092 | 3300020438 | Marine | MNRNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL |
| Ga0211576_105833991 | 3300020438 | Marine | YLRQYEIMNKNEQQLYRDISNLTKAVQRLVKLIEQMAKKQL |
| Ga0211579_101030503 | 3300020472 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLLEKIAKQQNL |
| Ga0206677_101812792 | 3300021085 | Seawater | MNRNEQQLYRDISELTKAVQKLVKLLTKISKEQND |
| Ga0213861_103469682 | 3300021378 | Seawater | MTRNEQQLYKDISELTKAVQKLVKLLTKIAKDQND |
| Ga0213868_102013823 | 3300021389 | Seawater | MNKNQQQLYKDISELTKAVQKLVKLLTKIAKEQND |
| Ga0222715_101828543 | 3300021960 | Estuarine Water | MTLNEQQLYKDISELTKAVQKLVKLLTKIAKDQND |
| Ga0196889_10653722 | 3300022072 | Aqueous | MNRNEQQLYKDISNLTKAVQKLVKLIEKIAKQQNK |
| Ga0244775_114499582 | 3300024346 | Estuarine | MNKNEQQLYKDISNLTKAVQRLVKLIEKMAKQQLXQE |
| Ga0208667_10396982 | 3300025070 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLTKIAKEQND |
| Ga0208667_10470041 | 3300025070 | Marine | LNVYEIMNRNEQQLYKDISDLTKAVQKLVKLLTKLAKDQS |
| Ga0208157_100285210 | 3300025086 | Marine | MNRNQQQLYKDISELTKAVQKLVKLLTKIAKEQND |
| Ga0208157_10065004 | 3300025086 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLIEKIAKKQND |
| Ga0208157_10532142 | 3300025086 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLTKIAKDQND |
| Ga0208434_10697814 | 3300025098 | Marine | YETMNKNEQQLYKDISNLTKAVQKLVKLIEKMAKSQLXLE |
| Ga0208669_11167902 | 3300025099 | Marine | MNKNQQQLYKDISDLTKAVQKLVKLLTKIAKEQND |
| Ga0208793_11638892 | 3300025108 | Marine | VYEIMNRNEQQLYKDISDLTKAVQKLVKLLTKLAKDQS |
| Ga0208158_11121891 | 3300025110 | Marine | MNKNEQQLYKDISDLTKAVQKLVKLMTKLMKEQND |
| Ga0209232_10327042 | 3300025132 | Marine | MNKNEQQLYKDISNLTKAVQKLVKLLTKIAKEQNL |
| Ga0209336_101200132 | 3300025137 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLLEKIAKQQNL |
| Ga0209634_11171142 | 3300025138 | Marine | MNKNEQQLYRDISNLTKAVQKLVKLLEKIARQQND |
| Ga0209337_11722331 | 3300025168 | Marine | MNRNEQQLYKDISSLTKAVQRLVKLLEKIAKQQND |
| Ga0209337_12106861 | 3300025168 | Marine | MNRNEQQLYKDISDLTKAVQKLVKLLEKIAKQQND |
| Ga0208813_10709931 | 3300025270 | Deep Ocean | MNKNEQQLYRDISNLTKAVQKLVKLLEKIAKQQLXI |
| Ga0208684_11337251 | 3300025305 | Deep Ocean | LKQYEIMNKNQQQLYKDISDLTKAVQKLVKLIEKMAKQQL |
| Ga0208303_10285413 | 3300025543 | Aqueous | MTRNEQQLYKDISELTKAVQKLVKLLTKIAKEQND |
| Ga0208303_10646361 | 3300025543 | Aqueous | VYEIMNRNEQQLYKDISNLTKAVQKLVKLLEKLIKDNA |
| Ga0208817_1213882 | 3300026101 | Marine Oceanic | MNKNEQQLYRDISNLTKAVQKLVKLIEKMAKQQLXQGN |
| Ga0183755_10508504 | 3300029448 | Marine | LNAYVIMNKNEQQLYKDISDLTKAVQKLVKLLEKLIKDNA |
| Ga0183757_10329463 | 3300029787 | Marine | MNRNEQQLYKDISDLTKAVQQLVKLLTKIAKEQND |
| ⦗Top⦘ |