


| Basic Information | |
|---|---|
| Family ID | F034118 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ERLTQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQAVVPDF |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.57 % |
| % of genes near scaffold ends (potentially truncated) | 90.29 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 0.00% Coil/Unstructured: 95.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF03972 | MmgE_PrpD | 3.43 |
| PF10067 | DUF2306 | 2.86 |
| PF00903 | Glyoxalase | 1.71 |
| PF05195 | AMP_N | 1.71 |
| PF02738 | MoCoBD_1 | 1.71 |
| PF13714 | PEP_mutase | 1.14 |
| PF03928 | HbpS-like | 1.14 |
| PF03466 | LysR_substrate | 1.14 |
| PF00561 | Abhydrolase_1 | 1.14 |
| PF04820 | Trp_halogenase | 0.57 |
| PF01738 | DLH | 0.57 |
| PF06707 | DUF1194 | 0.57 |
| PF13570 | PQQ_3 | 0.57 |
| PF02615 | Ldh_2 | 0.57 |
| PF13620 | CarboxypepD_reg | 0.57 |
| PF01494 | FAD_binding_3 | 0.57 |
| PF00665 | rve | 0.57 |
| PF02371 | Transposase_20 | 0.57 |
| PF07715 | Plug | 0.57 |
| PF00557 | Peptidase_M24 | 0.57 |
| PF02954 | HTH_8 | 0.57 |
| PF15599 | Imm63 | 0.57 |
| PF08450 | SGL | 0.57 |
| PF01694 | Rhomboid | 0.57 |
| PF00005 | ABC_tran | 0.57 |
| PF07676 | PD40 | 0.57 |
| PF13358 | DDE_3 | 0.57 |
| PF06452 | CBM9_1 | 0.57 |
| PF13531 | SBP_bac_11 | 0.57 |
| PF07883 | Cupin_2 | 0.57 |
| PF04116 | FA_hydroxylase | 0.57 |
| PF00857 | Isochorismatase | 0.57 |
| PF13442 | Cytochrome_CBB3 | 0.57 |
| PF13924 | Lipocalin_5 | 0.57 |
| PF01814 | Hemerythrin | 0.57 |
| PF02515 | CoA_transf_3 | 0.57 |
| PF04295 | GD_AH_C | 0.57 |
| PF03401 | TctC | 0.57 |
| PF00072 | Response_reg | 0.57 |
| PF00106 | adh_short | 0.57 |
| PF01541 | GIY-YIG | 0.57 |
| PF04392 | ABC_sub_bind | 0.57 |
| PF01436 | NHL | 0.57 |
| PF00034 | Cytochrom_C | 0.57 |
| PF01710 | HTH_Tnp_IS630 | 0.57 |
| PF03480 | DctP | 0.57 |
| PF01546 | Peptidase_M20 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 3.43 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.71 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.14 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.57 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.57 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.57 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.57 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.57 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.57 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.57 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.57 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.57 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.57 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.57 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.57 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.57 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.57 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.57 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.57 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.43 % |
| Unclassified | root | N/A | 16.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004114|Ga0062593_102265836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300005167|Ga0066672_10228781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1192 | Open in IMG/M |
| 3300005180|Ga0066685_10622167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 743 | Open in IMG/M |
| 3300005332|Ga0066388_103696495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300005435|Ga0070714_101887722 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005439|Ga0070711_101048302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300005561|Ga0066699_10910677 | Not Available | 613 | Open in IMG/M |
| 3300005576|Ga0066708_10987876 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005586|Ga0066691_10514371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005713|Ga0066905_100131052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. | 1770 | Open in IMG/M |
| 3300005764|Ga0066903_100316664 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300005764|Ga0066903_101288620 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300005764|Ga0066903_103836320 | Not Available | 807 | Open in IMG/M |
| 3300005764|Ga0066903_103843370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 807 | Open in IMG/M |
| 3300005764|Ga0066903_106917688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300005764|Ga0066903_107084804 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005921|Ga0070766_10437172 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006034|Ga0066656_10425350 | Not Available | 862 | Open in IMG/M |
| 3300006052|Ga0075029_100142184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1470 | Open in IMG/M |
| 3300006162|Ga0075030_100676702 | Not Available | 817 | Open in IMG/M |
| 3300006162|Ga0075030_101326224 | Not Available | 564 | Open in IMG/M |
| 3300006797|Ga0066659_10501243 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300006845|Ga0075421_100788732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1095 | Open in IMG/M |
| 3300007788|Ga0099795_10086600 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300009090|Ga0099827_11842312 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009098|Ga0105245_12980954 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009137|Ga0066709_102256641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 748 | Open in IMG/M |
| 3300009137|Ga0066709_102566008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 684 | Open in IMG/M |
| 3300009143|Ga0099792_10605918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 699 | Open in IMG/M |
| 3300009148|Ga0105243_10656209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300009148|Ga0105243_10766169 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300009176|Ga0105242_10736230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300009700|Ga0116217_10175603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 1418 | Open in IMG/M |
| 3300009792|Ga0126374_10632373 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300009826|Ga0123355_10883188 | Not Available | 976 | Open in IMG/M |
| 3300010043|Ga0126380_11837045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 549 | Open in IMG/M |
| 3300010047|Ga0126382_11577826 | Not Available | 607 | Open in IMG/M |
| 3300010047|Ga0126382_11657061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 595 | Open in IMG/M |
| 3300010159|Ga0099796_10271490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300010159|Ga0099796_10444277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 576 | Open in IMG/M |
| 3300010358|Ga0126370_10944918 | Not Available | 782 | Open in IMG/M |
| 3300010359|Ga0126376_10374302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1272 | Open in IMG/M |
| 3300010359|Ga0126376_11040527 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010359|Ga0126376_12477452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300010360|Ga0126372_11213271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 779 | Open in IMG/M |
| 3300010360|Ga0126372_11636628 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010362|Ga0126377_10836726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 980 | Open in IMG/M |
| 3300010379|Ga0136449_103887823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 560 | Open in IMG/M |
| 3300010379|Ga0136449_103936711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 556 | Open in IMG/M |
| 3300010379|Ga0136449_104666814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010397|Ga0134124_11899193 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010398|Ga0126383_11787597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 703 | Open in IMG/M |
| 3300010398|Ga0126383_12585700 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011434|Ga0137464_1174165 | Not Available | 655 | Open in IMG/M |
| 3300011440|Ga0137433_1010615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2747 | Open in IMG/M |
| 3300012189|Ga0137388_11031534 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300012198|Ga0137364_11069032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 608 | Open in IMG/M |
| 3300012199|Ga0137383_10467188 | Not Available | 924 | Open in IMG/M |
| 3300012200|Ga0137382_10393818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300012202|Ga0137363_10379503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1174 | Open in IMG/M |
| 3300012205|Ga0137362_10669166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 893 | Open in IMG/M |
| 3300012205|Ga0137362_10883607 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012206|Ga0137380_11651440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300012207|Ga0137381_10168045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1893 | Open in IMG/M |
| 3300012207|Ga0137381_10240274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1573 | Open in IMG/M |
| 3300012207|Ga0137381_10411286 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300012210|Ga0137378_11356272 | Not Available | 626 | Open in IMG/M |
| 3300012211|Ga0137377_10849841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 845 | Open in IMG/M |
| 3300012354|Ga0137366_10773222 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012357|Ga0137384_10046644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3581 | Open in IMG/M |
| 3300012357|Ga0137384_11095902 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012359|Ga0137385_11466467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 546 | Open in IMG/M |
| 3300012359|Ga0137385_11567492 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012362|Ga0137361_10137577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2169 | Open in IMG/M |
| 3300012469|Ga0150984_114092048 | Not Available | 521 | Open in IMG/M |
| 3300012506|Ga0157324_1069304 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012683|Ga0137398_10282639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1112 | Open in IMG/M |
| 3300012917|Ga0137395_10275647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300012918|Ga0137396_10562661 | Not Available | 844 | Open in IMG/M |
| 3300012922|Ga0137394_10391008 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300012925|Ga0137419_11775545 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012927|Ga0137416_10571146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300012929|Ga0137404_11759378 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012929|Ga0137404_12052339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300012930|Ga0137407_10060094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3123 | Open in IMG/M |
| 3300012944|Ga0137410_10203759 | Not Available | 1533 | Open in IMG/M |
| 3300012971|Ga0126369_10234631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Terricaulis → Terricaulis silvestris | 1794 | Open in IMG/M |
| 3300012971|Ga0126369_10685986 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300012971|Ga0126369_11290639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 820 | Open in IMG/M |
| 3300012971|Ga0126369_11479898 | Not Available | 769 | Open in IMG/M |
| 3300012986|Ga0164304_11552134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 550 | Open in IMG/M |
| 3300013308|Ga0157375_12597614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella stibiiresistens → Skermanella stibiiresistens SB22 | 605 | Open in IMG/M |
| 3300014863|Ga0180060_1050483 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300015195|Ga0167658_1016743 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300015242|Ga0137412_10194581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1621 | Open in IMG/M |
| 3300015242|Ga0137412_10783353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300015264|Ga0137403_11347062 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300016270|Ga0182036_10764890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300016294|Ga0182041_10121944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1959 | Open in IMG/M |
| 3300016319|Ga0182033_11765484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300016341|Ga0182035_10777439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300016341|Ga0182035_10980493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300016341|Ga0182035_11056233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 721 | Open in IMG/M |
| 3300016387|Ga0182040_11439504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 584 | Open in IMG/M |
| 3300017961|Ga0187778_10830854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 631 | Open in IMG/M |
| 3300017970|Ga0187783_10726940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 717 | Open in IMG/M |
| 3300017975|Ga0187782_10719487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 770 | Open in IMG/M |
| 3300017995|Ga0187816_10551895 | Not Available | 519 | Open in IMG/M |
| 3300018007|Ga0187805_10182906 | Not Available | 956 | Open in IMG/M |
| 3300018028|Ga0184608_10012149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2957 | Open in IMG/M |
| 3300018468|Ga0066662_10624620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300018468|Ga0066662_12093930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300020170|Ga0179594_10183090 | Not Available | 782 | Open in IMG/M |
| 3300020580|Ga0210403_10643081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300020581|Ga0210399_11063254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300021171|Ga0210405_10503791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300021171|Ga0210405_10982710 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021178|Ga0210408_10776563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300021404|Ga0210389_11149720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021420|Ga0210394_11669089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300021476|Ga0187846_10429299 | Not Available | 542 | Open in IMG/M |
| 3300021478|Ga0210402_10237961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1679 | Open in IMG/M |
| 3300021478|Ga0210402_11410296 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021559|Ga0210409_10941160 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300021560|Ga0126371_11700381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
| 3300022756|Ga0222622_10786751 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300025898|Ga0207692_11117728 | Not Available | 522 | Open in IMG/M |
| 3300025935|Ga0207709_11809918 | Not Available | 508 | Open in IMG/M |
| 3300025937|Ga0207669_10368438 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300026285|Ga0209438_1034004 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300026475|Ga0257147_1020539 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300026999|Ga0207949_1027919 | Not Available | 521 | Open in IMG/M |
| 3300027643|Ga0209076_1054885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1129 | Open in IMG/M |
| 3300027829|Ga0209773_10382901 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027831|Ga0209797_10193753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 866 | Open in IMG/M |
| 3300027895|Ga0209624_10150398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300027903|Ga0209488_10132269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1881 | Open in IMG/M |
| 3300027903|Ga0209488_10653082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 758 | Open in IMG/M |
| 3300028793|Ga0307299_10097136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1100 | Open in IMG/M |
| 3300029636|Ga0222749_10448037 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031057|Ga0170834_110523057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1145 | Open in IMG/M |
| 3300031543|Ga0318516_10828876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031573|Ga0310915_10091858 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300031708|Ga0310686_115191703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1035 | Open in IMG/M |
| 3300031719|Ga0306917_10054277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2710 | Open in IMG/M |
| 3300031724|Ga0318500_10669876 | Not Available | 528 | Open in IMG/M |
| 3300031736|Ga0318501_10277136 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300031744|Ga0306918_11257878 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031744|Ga0306918_11419613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 532 | Open in IMG/M |
| 3300031751|Ga0318494_10600002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300031796|Ga0318576_10264404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300031833|Ga0310917_10014700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4383 | Open in IMG/M |
| 3300031879|Ga0306919_10567520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 876 | Open in IMG/M |
| 3300031890|Ga0306925_10167665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2366 | Open in IMG/M |
| 3300031897|Ga0318520_10409222 | Not Available | 830 | Open in IMG/M |
| 3300031910|Ga0306923_11564848 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031912|Ga0306921_10225821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas harenae | 2194 | Open in IMG/M |
| 3300031912|Ga0306921_10379353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium septentrionale | 1652 | Open in IMG/M |
| 3300031912|Ga0306921_10714914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1150 | Open in IMG/M |
| 3300031912|Ga0306921_11143208 | Not Available | 870 | Open in IMG/M |
| 3300031946|Ga0310910_11005033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 652 | Open in IMG/M |
| 3300031954|Ga0306926_11929410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. BNC1 | 666 | Open in IMG/M |
| 3300032001|Ga0306922_10293916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1745 | Open in IMG/M |
| 3300032001|Ga0306922_11665113 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032059|Ga0318533_10261866 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300032059|Ga0318533_11323137 | Not Available | 526 | Open in IMG/M |
| 3300032060|Ga0318505_10232264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 867 | Open in IMG/M |
| 3300032065|Ga0318513_10184759 | Not Available | 1002 | Open in IMG/M |
| 3300032076|Ga0306924_10628916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1212 | Open in IMG/M |
| 3300032261|Ga0306920_102007004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300032261|Ga0306920_103122570 | Not Available | 622 | Open in IMG/M |
| 3300032261|Ga0306920_103240662 | Not Available | 608 | Open in IMG/M |
| 3300033289|Ga0310914_11111766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300033290|Ga0318519_10993687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 521 | Open in IMG/M |
| 3300034268|Ga0372943_0260773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.29% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.57% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.57% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.57% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062593_1022658361 | 3300004114 | Soil | QVQGIAQLASAAEGPLQELICAENPNSFFESQDSKPIPQAKTPDF* |
| Ga0066672_102287811 | 3300005167 | Soil | AGSLIQLATPEEGPLTEAICPDNPNSFMGMPHRPLPQAAKPDF* |
| Ga0066685_106221671 | 3300005180 | Soil | QLASAPEGPLQEMRCADNPNSFFPGTVALPLPQAMVPDF* |
| Ga0066388_1036964952 | 3300005332 | Tropical Forest Soil | LVNTAQEGKMAEQICADNPDSFFPGTSAMPIPRAVRPDY* |
| Ga0070714_1018877222 | 3300005435 | Agricultural Soil | KNVASLTQLATPEEGPLTEAICAENPNSFMGMPHLPLPQAVVPDF* |
| Ga0070711_1010483021 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIERIAQLASQPEGPMQEQICADNPRSFFAGQGALAVPQAVTPDF* |
| Ga0066699_109106772 | 3300005561 | Soil | YEAAVRRVPIERLVQLASAPEGPLQEMRCADNPNSFFPGTVPLPVPQAAGPDF* |
| Ga0066708_109878762 | 3300005576 | Soil | RIAQLASAPEGPLRELICAENPRSFFANQPALQIPVALKPDF* |
| Ga0066691_105143712 | 3300005586 | Soil | SRKNVANLTQLATPEEGPLTEAICAENPNSFMGMPHKPLPQAAVPDF* |
| Ga0066905_1001310523 | 3300005713 | Tropical Forest Soil | QLATPAEGPLTEAICAENPKSFFPNVPALPVPTASTRDF* |
| Ga0066903_1003166643 | 3300005764 | Tropical Forest Soil | VIVPRLPIERLTQLASAPEGPLRESSRAENPNSFFPNVEALPIPQAVVPDF* |
| Ga0066903_1012886204 | 3300005764 | Tropical Forest Soil | RLAQLASAPEGPLQEMRCADNPNSFFPGTVSLPLPQALMPDF* |
| Ga0066903_1038363202 | 3300005764 | Tropical Forest Soil | QLASAPEGPLLEMRCADNPNSYFAGTSALPIPQALVPDF* |
| Ga0066903_1038433702 | 3300005764 | Tropical Forest Soil | VRKVPIERIAQLASAAEGPLTEMVCAENPESFFPGTSALPIPQAVAPDF* |
| Ga0066903_1069176881 | 3300005764 | Tropical Forest Soil | SAPEGPLVEMNCADNPNSFFPNVAALPIPQAVVPDF* |
| Ga0066903_1070848041 | 3300005764 | Tropical Forest Soil | QFEAAVRRVPIERLTQLASAPEGPLRESSCAENPNSFFPNVEALPIPQANKPDF* |
| Ga0070766_104371721 | 3300005921 | Soil | IERLAQLASAPEGPLREIICAENPNSFFPGVVALPIPQAVVPDF* |
| Ga0066656_104253501 | 3300006034 | Soil | PEGPLQEMRCADNPNSFFPGTVALPLPQAVVPDF* |
| Ga0075029_1001421842 | 3300006052 | Watersheds | VRQVGVERIAQLASTPEGLLQEMIWADNPNPSLPGTGALPVPQAVAPDF* |
| Ga0075030_1006767021 | 3300006162 | Watersheds | APEGPLREMICAENPNSFFPGTNALPIPQAVVPDF* |
| Ga0075030_1013262241 | 3300006162 | Watersheds | AQRGAVQNLAALATTEEGPLQEAICPDNPNPFFSGQPAKPVPQATVPDF* |
| Ga0066659_105012432 | 3300006797 | Soil | VRKVPIERLMQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQALVPDF* |
| Ga0075421_1007887321 | 3300006845 | Populus Rhizosphere | NAVSSTTVEGPLIEASCAENPNSLMGMATLPVPQTTVPDF* |
| Ga0099795_100866001 | 3300007788 | Vadose Zone Soil | KVPIERLVQLASAPEGPLVEMSCTDNPNSFFPGTSALPIPQAVVPDF* |
| Ga0099827_118423121 | 3300009090 | Vadose Zone Soil | AVRKMPIERIAQLASAPEGPLRELICAENPNSFFANQPALQIPVAVKPDF* |
| Ga0105245_129809541 | 3300009098 | Miscanthus Rhizosphere | VRQVPVERLAQLASGEEGPLIERTCAENPNSFFPGEDVIPIPQTKVPDF* |
| Ga0066709_1022566411 | 3300009137 | Grasslands Soil | IERLAQLASAPEGPLQEMRCADNPNSFFPGTVSLPLPQAVVPDF* |
| Ga0066709_1025660081 | 3300009137 | Grasslands Soil | RLVQLASAPEGPLQEMRCADNPNSFFPGTISLPLPQAVVPDF* |
| Ga0099792_106059181 | 3300009143 | Vadose Zone Soil | APEGPLTEMICAENPNSFFPGTTALPIPQAVVPDF* |
| Ga0105243_106562091 | 3300009148 | Miscanthus Rhizosphere | GTRNIAQLASTVEGPLQEMVCADNPNAFFPSANARPLPQTTVPDF* |
| Ga0105243_107661691 | 3300009148 | Miscanthus Rhizosphere | RLAQSASVPEGPLTEHICAENPNSFFPNVEAIPIPQAAKPDF* |
| Ga0105242_107362302 | 3300009176 | Miscanthus Rhizosphere | TRNIAQLASTVEGPLQEMVCADNPNAFFPSANARPLPQTAVPDF* |
| Ga0116217_101756031 | 3300009700 | Peatlands Soil | QLASAPEGPLTEMICAENPNSFFPGATALPIPQAVVPDF* |
| Ga0126374_106323731 | 3300009792 | Tropical Forest Soil | LAVLATPAEGPLTEAICAENPNSFFAGQPALPIPQALAPDF* |
| Ga0123355_108831882 | 3300009826 | Termite Gut | PIAGVAQLASAAEGPLTELICADNPNSFFPGTSALPVPQAISPDF* |
| Ga0126380_118370451 | 3300010043 | Tropical Forest Soil | SGEEGPLIERTCAENPNSFFPGEDSIPIPQAKVPDF* |
| Ga0126382_115778261 | 3300010047 | Tropical Forest Soil | QLASAPEGPLTELVCADNPSSFFESQDAKPIPQTKVPDF* |
| Ga0126382_116570611 | 3300010047 | Tropical Forest Soil | LASAEEGPLKEMVCADNPNSFFESQDAKPIPQAKIPDF* |
| Ga0099796_102714901 | 3300010159 | Vadose Zone Soil | VASRKNVANLTQLATPEEGPLTEAFCAENPNSFMGKPHKPLPEATVPDF* |
| Ga0099796_104442772 | 3300010159 | Vadose Zone Soil | MAAAPEGPLREMICAENPNSFFPGTNALPIPQAIVPDF* |
| Ga0126370_109449181 | 3300010358 | Tropical Forest Soil | QYEAAVAKVPIERLVQLASAPEGPLQEMRCADNPNSFFPGTYALPLPQAVVPDF* |
| Ga0126376_103743021 | 3300010359 | Tropical Forest Soil | ASTKIPVERLAQLATPAEGPLTEAICAENPNSFFPNVPALPVPTASKPDF* |
| Ga0126376_110405271 | 3300010359 | Tropical Forest Soil | PIERLTQLASAPEGPLRESSCAENPNSFFPNVEALPIPQAVVPDF* |
| Ga0126376_124774521 | 3300010359 | Tropical Forest Soil | VRKMPIERLAQLASVAEGPLTEQVCADNPNSFFSGTGGRPIPQAVTPDF* |
| Ga0126372_112132712 | 3300010360 | Tropical Forest Soil | MIQFLTEAICAENPNSFFAGQPALPIPQAAVPDF* |
| Ga0126372_116366282 | 3300010360 | Tropical Forest Soil | QLASAPEGPLQEMRCADNPNSFFPDTVALPLPQAVAPDF* |
| Ga0126377_108367262 | 3300010362 | Tropical Forest Soil | VPIERLAQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQAMVPDF* |
| Ga0136449_1038878232 | 3300010379 | Peatlands Soil | EAAVRKVPIERLAQLASAPEGPLRETICAENPHSFFASQPALPIPQAVVPDF* |
| Ga0136449_1039367111 | 3300010379 | Peatlands Soil | KVPIERLAQLASAPEGPLRETICAENPHSFFASQPAMPIPQAVVPDF* |
| Ga0136449_1046668142 | 3300010379 | Peatlands Soil | VASKKSAAQNLIQLATPEDGPLTEAVCADNPDTFMGMEHKPLPEATKPDF* |
| Ga0134124_118991931 | 3300010397 | Terrestrial Soil | LAQLASGEEGPLIERTCAENPNSFFPNEEVLPIPVAKVADF* |
| Ga0126383_117875971 | 3300010398 | Tropical Forest Soil | KVPIERLVQLASAPEGPLVEMSCTDNPNSFKFLGISALPIPEAVVPDF* |
| Ga0126383_125857001 | 3300010398 | Tropical Forest Soil | APEGPLTELVCADNPNSFFPGTPALPIPQAVAPDF* |
| Ga0137464_11741651 | 3300011434 | Soil | TVEGPLIEASCAENPNSLMGMASLPVPQTTVPDF* |
| Ga0137433_10106155 | 3300011440 | Soil | MQVQGIAQLASAPEGPLQELICADNPNSFFADQDARPIPQAPTPDF* |
| Ga0137388_110315341 | 3300012189 | Vadose Zone Soil | LTQLATPAEGPLTEAICAENPNSFFAGQPALPIPQAVVPDF* |
| Ga0137364_110690322 | 3300012198 | Vadose Zone Soil | RQYEAAVRRVPIERLVQLASAPEGPLQEMRCADNPNSFFPGTVSVPLPQALVPDF* |
| Ga0137383_104671881 | 3300012199 | Vadose Zone Soil | LAQLASGPEGPLSELVCAENRNSFFPGTNALPMPQAVVPDF* |
| Ga0137382_103938181 | 3300012200 | Vadose Zone Soil | AAVRKLPIDRLPQLASAAEGPLTEMICADNPKSFFPGTGALPIPQADVPDF* |
| Ga0137363_103795032 | 3300012202 | Vadose Zone Soil | APEGPLTELICADNPNSFFPGTSALPVPQAVAPDF* |
| Ga0137362_106691661 | 3300012205 | Vadose Zone Soil | PIERLAQLASAPEGPLLEMSCADNPNSFFPGVVAPPIPQAMVPAF* |
| Ga0137362_108836072 | 3300012205 | Vadose Zone Soil | AEGPLTEAICAENPNSFFAGQPAMPIPQAVVPDF* |
| Ga0137380_116514402 | 3300012206 | Vadose Zone Soil | ERITQLASAPEGPLQEMICADNPNSFFPGTSAPPIPRAVVPDF* |
| Ga0137381_101680451 | 3300012207 | Vadose Zone Soil | TKIPVERLAQLATPPEGPLTEAICAENPSSFFPNVPALPIPKASTPDF* |
| Ga0137381_102402741 | 3300012207 | Vadose Zone Soil | LASAPEGPLQEMRCADNPNSFFPGTVALPLPQAMVPDF* |
| Ga0137381_104112863 | 3300012207 | Vadose Zone Soil | VATLAVLATPEEGPLSELICAENPNSFQGLLPARPVPQASAPDF* |
| Ga0137378_113562722 | 3300012210 | Vadose Zone Soil | LASGEEGPLREVRCAENPNSFFPGTSAPPIPQAIVPDF* |
| Ga0137377_108498411 | 3300012211 | Vadose Zone Soil | KVGVERIPQLASTPEGPLQEMICADNPNSFLPGTGGRPIPQTVVPDF* |
| Ga0137366_107732222 | 3300012354 | Vadose Zone Soil | VPIERLAQLASAAEGPLMEMICAENPNSFFPDTNVLPIPQAVMPDF* |
| Ga0137384_100466441 | 3300012357 | Vadose Zone Soil | PIERLAQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQALVPDF* |
| Ga0137384_110959021 | 3300012357 | Vadose Zone Soil | QMPIERIAQLASAPEGPLRELICAENPNSFFANQPALQIPTAVTPDF* |
| Ga0137385_114664672 | 3300012359 | Vadose Zone Soil | AQLASAPEGPLMEMICAENPNSFFPGTNALPIPQAVVPDF* |
| Ga0137385_115674922 | 3300012359 | Vadose Zone Soil | IERLTQLASGEEGPLIERTCAENPNSFFPGEDVLAIPQAAVPDF* |
| Ga0137361_101375771 | 3300012362 | Vadose Zone Soil | VGIARIAQLASAPEGPLTELICADNPNSFFPGTSALPVPQAVAPDF* |
| Ga0150984_1140920481 | 3300012469 | Avena Fatua Rhizosphere | SGEEGPLTEHICQENPSSFFPGTAALPIPQAVVPDF* |
| Ga0157324_10693042 | 3300012506 | Arabidopsis Rhizosphere | VRQMPIERIVQLASAPEGPLREMICAENPQSFFANQPALQIPTALKPDF* |
| Ga0137398_102826392 | 3300012683 | Vadose Zone Soil | ASTAEGPLQEMICADNPNSFLPGTGALPIPQTVVPDF* |
| Ga0137395_102756471 | 3300012917 | Vadose Zone Soil | VHKLPIDRLPQLASAAEGPMTEMICADNPKSFFPGTGALPIPQADVPDF* |
| Ga0137396_105626611 | 3300012918 | Vadose Zone Soil | PVERLAQLASGPEGPLSELVCAENRNSFFPGTNALPMPQAVVPDF* |
| Ga0137394_103910082 | 3300012922 | Vadose Zone Soil | QVPIERLAQLASVPEGPLTEHICAENPNSFFPNVKALPIPQAARPDF* |
| Ga0137419_117755451 | 3300012925 | Vadose Zone Soil | VPIERLTQLASEPEGPLAEHICAENPSSLFFAGVPALPLPQAVVPDF* |
| Ga0137416_105711461 | 3300012927 | Vadose Zone Soil | IERLVQLASAPEGPLQEMRCADNPNSFFPGTISLPLPQAVVPDF* |
| Ga0137404_117593781 | 3300012929 | Vadose Zone Soil | MPIERIAQLASAPEGPLAELICAENPNSFFPNQAVVKIPIAVKPDF* |
| Ga0137404_120523391 | 3300012929 | Vadose Zone Soil | TAVRKLPIDRLPQLASAAEGPLTEMICADNPKSFFPGTGALPIPQADVPDF* |
| Ga0137407_100600941 | 3300012930 | Vadose Zone Soil | QLATPPEGPLTEAICAENPNSFFPNVPALPIPKAITADF* |
| Ga0137410_102037591 | 3300012944 | Vadose Zone Soil | IAQLASAPEGPLTELICADNPNSFFPGTSALPIPQAVVPDF* |
| Ga0126369_102346313 | 3300012971 | Tropical Forest Soil | RSVPIERLTQLASAPEGPLKEMRCADNPNSFFPGTVSVPLPQAIVADF* |
| Ga0126369_106859861 | 3300012971 | Tropical Forest Soil | IERITQLASAPEGPLREMICAENPNSFFPNQPAVQIPTALKPDF* |
| Ga0126369_112906391 | 3300012971 | Tropical Forest Soil | RLAQLASAPEGPLTELICADNPKSFFPGTSALPIPQAVVLDF* |
| Ga0126369_114798982 | 3300012971 | Tropical Forest Soil | VIVPRLPIERPTRLASAPEGPLRESSCAENPNSFFPNVEALPIPQAVVPDF* |
| Ga0164304_115521341 | 3300012986 | Soil | TSAEGPMIEASCAENPNSLMGMASIPVPQTVRPDF* |
| Ga0157375_125976142 | 3300013308 | Miscanthus Rhizosphere | TVEGPLQEMICADNPNAFFPSANARPLPQTAVPDF* |
| Ga0180060_10504831 | 3300014863 | Soil | QLASAPEGPLTEQICADNPTSFFPEQGALPIPQDNAPDF* |
| Ga0167658_10167433 | 3300015195 | Glacier Forefield Soil | PQLASAAEGPLTEMICADNPNSFFVGQGAKPIPQTVVPDF* |
| Ga0137412_101945813 | 3300015242 | Vadose Zone Soil | LAVLATPAEGPLTEAICAENPNSFFAGQPAMPIPQAVVPDF* |
| Ga0137412_107833531 | 3300015242 | Vadose Zone Soil | LAQLASAPEGPLTEMSCADNPNSFFPGLDALPIPQAVVPDF* |
| Ga0137403_113470621 | 3300015264 | Vadose Zone Soil | IAQLASAPEGPLAELICAENPNSFFPNQAVVKIPIAVKPDF* |
| Ga0182036_107648902 | 3300016270 | Soil | AVRSVPIERLTQLASAPEGPLKEMRCADNPNSFFPGTVSVPLPQAIVADF |
| Ga0182041_101219443 | 3300016294 | Soil | MPIERLAQLASAPEGPMQEMVCADNPNSFLPGTDALPPPRANTPDF |
| Ga0182033_117654841 | 3300016319 | Soil | LASAPEGPLQEMVCADNPRSFFPSADAVLPPEANTPDF |
| Ga0182035_107774392 | 3300016341 | Soil | VIVPRLPIERLTQLASAPEGPLRESSCAENPNSFFPNAEALPIPQAVVPDF |
| Ga0182035_109804932 | 3300016341 | Soil | VAGALERIAQLASAEEGPLREMVCAENPTSFFPGTDALPLPQAAAPDF |
| Ga0182035_110562331 | 3300016341 | Soil | AAVRSVPIERLVQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAMVADF |
| Ga0182040_114395041 | 3300016387 | Soil | AVRSVPIERLVQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAVTPDF |
| Ga0187778_108308541 | 3300017961 | Tropical Peatland | KVPIERLAQLASAPEGPLVEMNCADNPNSYFPGTAALPIPQAVASDF |
| Ga0187783_107269402 | 3300017970 | Tropical Peatland | AQLASAPEGPLTEMNCADNPNSFFPGTVALPIPQAAAPDF |
| Ga0187782_107194872 | 3300017975 | Tropical Peatland | VLATPPEGPLTEAICAENPNSFFASQPAMPIPQAVVPDF |
| Ga0187816_105518951 | 3300017995 | Freshwater Sediment | AVRQVPIERLTQLASAPEGPLVEMNCADNPNSYFPGTSALPIPQAVVPDF |
| Ga0187805_101829061 | 3300018007 | Freshwater Sediment | LTQLASAPEGPLVEMSCTDNPNSYFPGTTALPIPQAAVSDF |
| Ga0184608_100121494 | 3300018028 | Groundwater Sediment | AQLASAPEGPLRELICAENPNSFFANQPALQIPVAVKPDF |
| Ga0066662_106246201 | 3300018468 | Grasslands Soil | AKDLVQLATPEEGPLTEAVCADNPDTFMGMAHKPLPEAHKPDF |
| Ga0066662_120939301 | 3300018468 | Grasslands Soil | SAPEGPLKELVCAENPNSFLPGTVALPIPKALVPDF |
| Ga0179594_101830901 | 3300020170 | Vadose Zone Soil | VLATPAEGPLTEAICAENPNSFFAGQPAMPIPQAVVPDF |
| Ga0210403_106430811 | 3300020580 | Soil | ARSLVQLATPEEGPLTEAICAENPNSFEGMPHKPLPQATVPDF |
| Ga0210399_110632542 | 3300020581 | Soil | YEAAVAKVPVERLAQLASVPEGPLVEMSCTDNPNSYFAGTNALPIPQALVPDF |
| Ga0210405_105037912 | 3300021171 | Soil | LVASKKSAAKNLIQLATPEDGPLTEAVCADNPDTFMGMAHRPLPEATKPDF |
| Ga0210405_109827102 | 3300021171 | Soil | KIPVERLVQLASVPEGPLTEMTCADNPTSFLFAGAAALPIPQAVVPDF |
| Ga0210408_107765632 | 3300021178 | Soil | IERLTQLASGEEGPLIERTCAENPNSFFPGEDVLAIPQAAVPDF |
| Ga0210389_111497202 | 3300021404 | Soil | PEGPLSEHICAENPGSFFFAGARAMPLPQAVAPDF |
| Ga0210394_116690892 | 3300021420 | Soil | SKKNVANLTQLATPDEGPLTEAVCADNPNSFMGMEHKPLPQAAVPDF |
| Ga0187846_104292992 | 3300021476 | Biofilm | QYEAAVRKVSIERLVQLASAPEGPLLEMRCADNPNSFFPGTVSLPLPQAVVPDF |
| Ga0210402_102379614 | 3300021478 | Soil | ERLPALATPAQGPLVEAICADNPNSFFVGQRAMPIPQAVERDIR |
| Ga0210402_114102962 | 3300021478 | Soil | LAQLATPAEGPLTEAICAENPNSFFVGMPAMPIPQAVVPDF |
| Ga0210409_109411602 | 3300021559 | Soil | VLATPAEGPLTEAICAENPNSLMGMAALPIPQAVVPDF |
| Ga0126371_117003811 | 3300021560 | Tropical Forest Soil | MPVGSVPVLATPEEGPPTEAICAENPNSFLGLPAMPIPQAAKADF |
| Ga0222622_107867511 | 3300022756 | Groundwater Sediment | IERIAQLASAPEGPLRELICAENPNSFFANQPALQIPVAVKPDF |
| Ga0207692_111177282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLASGEEGPLIERTCAENPNSFFPGEDVLPIPQATTPDF |
| Ga0207709_118099181 | 3300025935 | Miscanthus Rhizosphere | RLAQSASVPEGPLTEHICAENPNSFFPNVEAIPIPQAAKPDF |
| Ga0207669_103684382 | 3300025937 | Miscanthus Rhizosphere | MQYTQLASGEEGPLIERTCAENPNSFFPGEEVLPIPQAKVADF |
| Ga0209438_10340044 | 3300026285 | Grasslands Soil | ASVPEGPLVEMNCADNPNSYFPGTSALPIPQALVPDF |
| Ga0257147_10205393 | 3300026475 | Soil | VPIERLVQLASAPEGPLLEMSCADNPNSFFPGTSALPIPRAIVPDF |
| Ga0207949_10279191 | 3300026999 | Forest Soil | AVRKVPIGRLTQLASEPEGPLKEHICAENPDSFSFGGIRALPLPQAVGPDF |
| Ga0209076_10548851 | 3300027643 | Vadose Zone Soil | VPIERLVQLASVPEGPLVEMNCADNPNSYFPGTSALPIPQALVPDF |
| Ga0209773_103829012 | 3300027829 | Bog Forest Soil | KKSVASLAVLATPEEGPLTEAICAENPNSFMGMPHRPLPQAVVPDF |
| Ga0209797_101937532 | 3300027831 | Wetland Sediment | APEGPLTEQICADNPSSFFASQDARPIPQDDAPDF |
| Ga0209624_101503983 | 3300027895 | Forest Soil | LVQLASAPEGPLVEMNCADNPNSYFSGTSALPIPQAAKPDF |
| Ga0209488_101322693 | 3300027903 | Vadose Zone Soil | AAVRQVGIARIAQLASAPEGPLTELICADNPNSFFPGTSALPIPQAVAPDF |
| Ga0209488_106530822 | 3300027903 | Vadose Zone Soil | MASAPEGPLTEMICAENPNSVFPGTTALPISQAVVPDF |
| Ga0307299_100971361 | 3300028793 | Soil | AQLATPPEGPLTEAICAENPNSFFPNVPALPIPKAITADF |
| Ga0222749_104480371 | 3300029636 | Soil | SVPEGPLTEQVCGENPTSFLPGTSAPPIPQAVVPDF |
| Ga0170834_1105230573 | 3300031057 | Forest Soil | LASEPEGPLREHICAENPGSLTFAGVPALPMPQAIVPDF |
| Ga0318516_108288761 | 3300031543 | Soil | ATPEEGPLTEAICAENPNSFMGMSHRPLPHATVRDF |
| Ga0310915_100918583 | 3300031573 | Soil | VIVPRLPIERPTRLASAPEGPLRESSCAENPNSFFPNVEALPIPQAVVPDF |
| Ga0310686_1151917031 | 3300031708 | Soil | VGKVPIERLPALATPAQGPLIEAICADNPNSFFVGQPAMPIPQAVVPDF |
| Ga0306917_100542775 | 3300031719 | Soil | VIVPRLPIERPTRLASAPEGPLRESSCAENTNSFFPNVEALPIPQAVVPDF |
| Ga0318500_106698761 | 3300031724 | Soil | VHRLMQLASAPEGPLTEHICAENPNSFFPGTIALPIPEAVVPDF |
| Ga0318501_102771362 | 3300031736 | Soil | LATPEEGPLTEAICAENPKSFLGLPAMPIPQAAKPDF |
| Ga0306918_112578782 | 3300031744 | Soil | VPVERLVQLASAPEGPLVEMNCADNPNSFLGERDAIPLPQARVPDF |
| Ga0306918_114196131 | 3300031744 | Soil | PIERLTQLASAPEGPLREMRCADNPNSFFPGTVALPLPQAVVPDF |
| Ga0318494_106000022 | 3300031751 | Soil | SKNVARLTQLATPEEGPLTEAICAENPNSFMGMSHRPLPHATVRDF |
| Ga0318576_102644042 | 3300031796 | Soil | VARLTQLATPEEGPLTEAICAENPNSFMGMSHRPLPHATVRDF |
| Ga0310917_100147001 | 3300031833 | Soil | PVHRLMQLASAPEGPLTEHICAENPNSFFPGTIALPIPEAVVADF |
| Ga0306919_105675201 | 3300031879 | Soil | YRQYEAAVRSVPIERLTQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAIVADF |
| Ga0306925_101676651 | 3300031890 | Soil | ERLAQLASAPEGPLLEMRCADNPNSYFAGTSALPIPQALVPDF |
| Ga0318520_104092222 | 3300031897 | Soil | VPIHRLMQLASAPEGPLTEHICAENPNSFFPGTIALPIPEAVVPNF |
| Ga0306923_115648482 | 3300031910 | Soil | ASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAIEPDF |
| Ga0306921_102258212 | 3300031912 | Soil | VIVPRLPIERPTRLASAPEGPLRESSCAENPNSFFPNAEALPIPQAVVPDF |
| Ga0306921_103793532 | 3300031912 | Soil | LASAPEGPLQEMRCADNPNSFFPGTVALPLPQAVAPDF |
| Ga0306921_107149142 | 3300031912 | Soil | VPIERLTQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQAVVPDF |
| Ga0306921_111432083 | 3300031912 | Soil | VERLAQLATPAEGPLTEAICAENPNSFFVGMPAMPIPQAVVPDF |
| Ga0310910_110050331 | 3300031946 | Soil | SVPIERLTQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAVEPDF |
| Ga0306926_119294101 | 3300031954 | Soil | KVPIERLAQLASAPEGPLVEMRCSDNPNSFFPGTIALPIPQSLTPDF |
| Ga0306922_102939163 | 3300032001 | Soil | AVRQVPVERLVQLASAPEGPLVEMNCADNPNSFLGERDTIPLPQAHAPDF |
| Ga0306922_116651132 | 3300032001 | Soil | ERIAQLASAEEGPLREMVCAENPTSFFPGTDALPLPQAAAPDF |
| Ga0318533_102618662 | 3300032059 | Soil | LASAEEGPLREMVCAENPTSFFPGTDALPLPQAAAPDF |
| Ga0318533_113231371 | 3300032059 | Soil | LVQLASAPEGPLVEMNCADNPNSFLGERDAIPLPQARVPDF |
| Ga0318505_102322641 | 3300032060 | Soil | VRSVPIERLVQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAIVADF |
| Ga0318513_101847591 | 3300032065 | Soil | LMQLASAPEGPLTEHICAENPNSFFPGTIALPIPEAVVPNF |
| Ga0306924_106289161 | 3300032076 | Soil | QYEAAVRSVPIERLTQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAVTPDF |
| Ga0306920_1020070041 | 3300032261 | Soil | ERLAQLASAPEGPLQEMRCADNPNSFFPGTVSLPLPQALTPDF |
| Ga0306920_1031225701 | 3300032261 | Soil | RKLPIERLTQLASAPEGPLSELICAENPTSFRFPDATGTPPLPIPTAIKPDF |
| Ga0306920_1032406621 | 3300032261 | Soil | LASAPEGPLTEHICAENPNSFFPGTIALPIPEAVVPDF |
| Ga0310914_111117661 | 3300033289 | Soil | ERLTQLASAPEGPLQEMRCADNPNSFFPGTVALPLPQAVVPDF |
| Ga0318519_109936872 | 3300033290 | Soil | VPIERLVQLASAPEGPLKEMRCADNPNSFFPGTVSLPLPQAMVADF |
| Ga0372943_0260773_1_138 | 3300034268 | Soil | AAAKDLVQLATPEEGPLTEAVCADNPDTFMGMAHKPLPEAHKPDF |
| ⦗Top⦘ |