


| Basic Information | |
|---|---|
| Family ID | F033935 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKVSAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNAAAGANAGAN |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.70 % |
| % of genes near scaffold ends (potentially truncated) | 92.61 % |
| % of genes from short scaffolds (< 2000 bps) | 91.48 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.432 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.568 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.409 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.67% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 5.11 |
| PF00557 | Peptidase_M24 | 1.70 |
| PF07987 | DUF1775 | 1.70 |
| PF13432 | TPR_16 | 1.14 |
| PF00353 | HemolysinCabind | 1.14 |
| PF01575 | MaoC_dehydratas | 1.14 |
| PF13751 | DDE_Tnp_1_6 | 1.14 |
| PF09851 | SHOCT | 1.14 |
| PF03401 | TctC | 0.57 |
| PF14685 | Tricorn_PDZ | 0.57 |
| PF00582 | Usp | 0.57 |
| PF01321 | Creatinase_N | 0.57 |
| PF13637 | Ank_4 | 0.57 |
| PF12071 | DUF3551 | 0.57 |
| PF07859 | Abhydrolase_3 | 0.57 |
| PF08719 | NADAR | 0.57 |
| PF16658 | RF3_C | 0.57 |
| PF00375 | SDF | 0.57 |
| PF16576 | HlyD_D23 | 0.57 |
| PF01609 | DDE_Tnp_1 | 0.57 |
| PF02954 | HTH_8 | 0.57 |
| PF04800 | NDUS4 | 0.57 |
| PF13414 | TPR_11 | 0.57 |
| PF06823 | DUF1236 | 0.57 |
| PF04909 | Amidohydro_2 | 0.57 |
| PF12681 | Glyoxalase_2 | 0.57 |
| PF12762 | DDE_Tnp_IS1595 | 0.57 |
| PF06452 | CBM9_1 | 0.57 |
| PF08241 | Methyltransf_11 | 0.57 |
| PF07883 | Cupin_2 | 0.57 |
| PF01266 | DAO | 0.57 |
| PF13442 | Cytochrome_CBB3 | 0.57 |
| PF13669 | Glyoxalase_4 | 0.57 |
| PF13618 | Gluconate_2-dh3 | 0.57 |
| PF00126 | HTH_1 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 5.11 |
| COG4549 | Uncharacterized conserved protein YcnI, contains cohesin/reeler-like domain | Function unknown [S] | 1.70 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.57 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.57 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.57 |
| COG3236 | N-glycosidase YbiA/RibX (riboflavin biosynthesis, damage control), NADAR superfamily | Defense mechanisms [V] | 0.57 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.57 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.57 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10314155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300004080|Ga0062385_10842555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300004080|Ga0062385_11307354 | Not Available | 500 | Open in IMG/M |
| 3300005167|Ga0066672_10507089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300005179|Ga0066684_11123091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans | 502 | Open in IMG/M |
| 3300005180|Ga0066685_10979844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 560 | Open in IMG/M |
| 3300005329|Ga0070683_101722818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300005330|Ga0070690_100775643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 742 | Open in IMG/M |
| 3300005332|Ga0066388_101057425 | Not Available | 1368 | Open in IMG/M |
| 3300005332|Ga0066388_102490357 | Not Available | 940 | Open in IMG/M |
| 3300005332|Ga0066388_106372427 | Not Available | 595 | Open in IMG/M |
| 3300005332|Ga0066388_106920874 | Not Available | 571 | Open in IMG/M |
| 3300005337|Ga0070682_101856705 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005434|Ga0070709_10556196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300005437|Ga0070710_11165752 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005535|Ga0070684_101583046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300005541|Ga0070733_10419680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300005543|Ga0070672_101903471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005545|Ga0070695_101435999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300005591|Ga0070761_10381958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300005610|Ga0070763_10411554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 762 | Open in IMG/M |
| 3300005764|Ga0066903_100000911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 20281 | Open in IMG/M |
| 3300005764|Ga0066903_100418727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 2216 | Open in IMG/M |
| 3300005764|Ga0066903_106858265 | Not Available | 591 | Open in IMG/M |
| 3300005764|Ga0066903_106965587 | Not Available | 586 | Open in IMG/M |
| 3300005764|Ga0066903_108076934 | Not Available | 539 | Open in IMG/M |
| 3300005764|Ga0066903_108615115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 519 | Open in IMG/M |
| 3300006032|Ga0066696_10474730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 821 | Open in IMG/M |
| 3300006172|Ga0075018_10581057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans | 594 | Open in IMG/M |
| 3300006755|Ga0079222_11384205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300006844|Ga0075428_100051107 | All Organisms → cellular organisms → Bacteria | 4532 | Open in IMG/M |
| 3300006954|Ga0079219_10143021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300007258|Ga0099793_10228727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 895 | Open in IMG/M |
| 3300009137|Ga0066709_103505693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009143|Ga0099792_10832006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300009181|Ga0114969_10013124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6020 | Open in IMG/M |
| 3300009665|Ga0116135_1337524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300009678|Ga0105252_10078376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Algihabitans → Algihabitans albus | 1296 | Open in IMG/M |
| 3300009678|Ga0105252_10284946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300009792|Ga0126374_10450394 | Not Available | 914 | Open in IMG/M |
| 3300009792|Ga0126374_10815457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LTSPM299 | 714 | Open in IMG/M |
| 3300010046|Ga0126384_11618556 | Not Available | 610 | Open in IMG/M |
| 3300010048|Ga0126373_12759832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300010326|Ga0134065_10050845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1276 | Open in IMG/M |
| 3300010358|Ga0126370_12281676 | Not Available | 535 | Open in IMG/M |
| 3300010359|Ga0126376_11012191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 832 | Open in IMG/M |
| 3300010360|Ga0126372_11119309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300010361|Ga0126378_10586239 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300010362|Ga0126377_11743808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 698 | Open in IMG/M |
| 3300010376|Ga0126381_100774878 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 1376 | Open in IMG/M |
| 3300010379|Ga0136449_100298781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2938 | Open in IMG/M |
| 3300010398|Ga0126383_11211450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 845 | Open in IMG/M |
| 3300010398|Ga0126383_11805701 | Not Available | 700 | Open in IMG/M |
| 3300010398|Ga0126383_12552874 | Not Available | 595 | Open in IMG/M |
| 3300010400|Ga0134122_10010354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6932 | Open in IMG/M |
| 3300010857|Ga0126354_1141094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300010862|Ga0126348_1107187 | Not Available | 515 | Open in IMG/M |
| 3300010885|Ga0133913_11808871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1528 | Open in IMG/M |
| 3300011120|Ga0150983_10626001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 983 | Open in IMG/M |
| 3300011120|Ga0150983_13216885 | Not Available | 530 | Open in IMG/M |
| 3300011120|Ga0150983_15699471 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300011429|Ga0137455_1216494 | Not Available | 568 | Open in IMG/M |
| 3300011432|Ga0137428_1015249 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300012208|Ga0137376_11519604 | Not Available | 561 | Open in IMG/M |
| 3300012211|Ga0137377_10863978 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012357|Ga0137384_10990344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 676 | Open in IMG/M |
| 3300012361|Ga0137360_11113932 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012469|Ga0150984_112081466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
| 3300012582|Ga0137358_11051691 | Not Available | 523 | Open in IMG/M |
| 3300012924|Ga0137413_10383195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300012924|Ga0137413_10731795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 754 | Open in IMG/M |
| 3300012924|Ga0137413_11557713 | Not Available | 539 | Open in IMG/M |
| 3300012929|Ga0137404_10415163 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012929|Ga0137404_11887826 | Not Available | 556 | Open in IMG/M |
| 3300012971|Ga0126369_11268391 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012971|Ga0126369_12587434 | Not Available | 592 | Open in IMG/M |
| 3300012971|Ga0126369_13704220 | Not Available | 501 | Open in IMG/M |
| 3300014272|Ga0075327_1132763 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300014501|Ga0182024_11870891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300015052|Ga0137411_1326645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4077 | Open in IMG/M |
| 3300015374|Ga0132255_101712824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 954 | Open in IMG/M |
| 3300016294|Ga0182041_10808731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 838 | Open in IMG/M |
| 3300016294|Ga0182041_11583964 | Not Available | 604 | Open in IMG/M |
| 3300016319|Ga0182033_10885616 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300016357|Ga0182032_11296879 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300016422|Ga0182039_11631303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 589 | Open in IMG/M |
| 3300016445|Ga0182038_11264083 | Not Available | 659 | Open in IMG/M |
| 3300016750|Ga0181505_10150886 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017822|Ga0187802_10270200 | Not Available | 660 | Open in IMG/M |
| 3300017972|Ga0187781_10302569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1135 | Open in IMG/M |
| 3300017975|Ga0187782_10613947 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 836 | Open in IMG/M |
| 3300018076|Ga0184609_10253493 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300018089|Ga0187774_10902924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 607 | Open in IMG/M |
| 3300018090|Ga0187770_10773150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 768 | Open in IMG/M |
| 3300019212|Ga0180106_1230831 | Not Available | 530 | Open in IMG/M |
| 3300019244|Ga0180111_1093668 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300020034|Ga0193753_10062627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1952 | Open in IMG/M |
| 3300020582|Ga0210395_10212643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 1451 | Open in IMG/M |
| 3300020582|Ga0210395_10673861 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300021086|Ga0179596_10226665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 917 | Open in IMG/M |
| 3300021404|Ga0210389_10160873 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 1743 | Open in IMG/M |
| 3300021407|Ga0210383_10874726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 767 | Open in IMG/M |
| 3300021420|Ga0210394_11587877 | Not Available | 551 | Open in IMG/M |
| 3300021474|Ga0210390_10755570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 808 | Open in IMG/M |
| 3300021477|Ga0210398_10051200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3392 | Open in IMG/M |
| 3300021478|Ga0210402_11312309 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300021560|Ga0126371_10178219 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300021560|Ga0126371_13569568 | Not Available | 525 | Open in IMG/M |
| 3300021858|Ga0213852_1445087 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 525 | Open in IMG/M |
| 3300021861|Ga0213853_10562039 | Not Available | 566 | Open in IMG/M |
| 3300021861|Ga0213853_11549501 | Not Available | 1095 | Open in IMG/M |
| 3300022525|Ga0242656_1043303 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300022527|Ga0242664_1009016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1358 | Open in IMG/M |
| 3300022527|Ga0242664_1076210 | Not Available | 655 | Open in IMG/M |
| 3300022533|Ga0242662_10314231 | Not Available | 526 | Open in IMG/M |
| 3300022716|Ga0242673_1065715 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 642 | Open in IMG/M |
| 3300022717|Ga0242661_1088705 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300022718|Ga0242675_1112869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300022720|Ga0242672_1140612 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300024331|Ga0247668_1002755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3902 | Open in IMG/M |
| 3300025916|Ga0207663_10260898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1279 | Open in IMG/M |
| 3300025931|Ga0207644_11874090 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025935|Ga0207709_10583669 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300025941|Ga0207711_12140467 | Not Available | 502 | Open in IMG/M |
| 3300025944|Ga0207661_12009354 | Not Available | 524 | Open in IMG/M |
| 3300025960|Ga0207651_11020967 | Not Available | 740 | Open in IMG/M |
| 3300026095|Ga0207676_11917798 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300026320|Ga0209131_1022851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3737 | Open in IMG/M |
| 3300026498|Ga0257156_1028431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1128 | Open in IMG/M |
| 3300026527|Ga0209059_1083571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1348 | Open in IMG/M |
| 3300026551|Ga0209648_10594385 | Not Available | 610 | Open in IMG/M |
| 3300027573|Ga0208454_1094980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300027663|Ga0208990_1063660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1077 | Open in IMG/M |
| 3300027855|Ga0209693_10079373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1619 | Open in IMG/M |
| 3300027903|Ga0209488_10113572 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 2036 | Open in IMG/M |
| 3300027907|Ga0207428_11112345 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300028379|Ga0268266_11473623 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300029951|Ga0311371_12380405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 544 | Open in IMG/M |
| 3300029957|Ga0265324_10259956 | Not Available | 590 | Open in IMG/M |
| 3300029999|Ga0311339_10001502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 41350 | Open in IMG/M |
| 3300030617|Ga0311356_10469106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1234 | Open in IMG/M |
| 3300030998|Ga0073996_10021429 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff | 746 | Open in IMG/M |
| 3300031231|Ga0170824_116276099 | Not Available | 533 | Open in IMG/M |
| 3300031236|Ga0302324_101609526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 837 | Open in IMG/M |
| 3300031241|Ga0265325_10326844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300031469|Ga0170819_14333416 | Not Available | 616 | Open in IMG/M |
| 3300031668|Ga0318542_10296076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 828 | Open in IMG/M |
| 3300031679|Ga0318561_10819855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 511 | Open in IMG/M |
| 3300031751|Ga0318494_10641861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300031879|Ga0306919_10242728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1353 | Open in IMG/M |
| 3300031890|Ga0306925_10084869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3355 | Open in IMG/M |
| 3300031894|Ga0318522_10303602 | Not Available | 605 | Open in IMG/M |
| 3300031896|Ga0318551_10676478 | Not Available | 597 | Open in IMG/M |
| 3300031910|Ga0306923_10388353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1589 | Open in IMG/M |
| 3300031910|Ga0306923_10404921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1552 | Open in IMG/M |
| 3300031912|Ga0306921_10281608 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300031912|Ga0306921_10863680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1030 | Open in IMG/M |
| 3300031941|Ga0310912_10181589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1603 | Open in IMG/M |
| 3300031941|Ga0310912_10938861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300031947|Ga0310909_10982761 | Not Available | 690 | Open in IMG/M |
| 3300032001|Ga0306922_10999344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300032052|Ga0318506_10249766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 786 | Open in IMG/M |
| 3300032055|Ga0318575_10484122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 628 | Open in IMG/M |
| 3300032090|Ga0318518_10703345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 514 | Open in IMG/M |
| 3300032174|Ga0307470_10290657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300032174|Ga0307470_11769970 | Not Available | 522 | Open in IMG/M |
| 3300032261|Ga0306920_100058318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5628 | Open in IMG/M |
| 3300032261|Ga0306920_101584148 | Not Available | 932 | Open in IMG/M |
| 3300032515|Ga0348332_12231418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 773 | Open in IMG/M |
| 3300032828|Ga0335080_11712564 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300033289|Ga0310914_11406316 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300033290|Ga0318519_10291843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300033433|Ga0326726_10216642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1772 | Open in IMG/M |
| 3300033513|Ga0316628_101382973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300034149|Ga0364929_0253952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 592 | Open in IMG/M |
| 3300034150|Ga0364933_096954 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.27% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.14% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.14% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.57% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.57% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_103141551 | 3300004080 | Bog Forest Soil | TLTPGMKVKTVIHPLRDGTAGGQFMAITLPNGTEMGNPNGRPNANAGAPAN* |
| Ga0062385_108425551 | 3300004080 | Bog Forest Soil | VIHPLRDGTAGGQFMAITLPNGTEMGNPNGRPNANAGAPAN* |
| Ga0062385_113073541 | 3300004080 | Bog Forest Soil | GMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN* |
| Ga0066672_105070891 | 3300005167 | Soil | MNIEVTIHPLRDGTHGGQFMAVTLPDGKTLGNREAPPSAEAGGGAAPAQ* |
| Ga0066684_111230911 | 3300005179 | Soil | MKVTAVIHPLKDGTHGGQFMAVTLPDGTVKGNPNGAANANAGAN* |
| Ga0066685_109798442 | 3300005180 | Soil | RDGANGGQFMAVTLPDGTQIGNPNAAPSANAGSGPAPER* |
| Ga0070683_1017228181 | 3300005329 | Corn Rhizosphere | KTLTPGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN* |
| Ga0070690_1007756431 | 3300005330 | Switchgrass Rhizosphere | TPGMKVSAVIHPLKDGTHGGQFMAVTLPDGTMKGNPNAAAGANAGAN* |
| Ga0066388_1010574251 | 3300005332 | Tropical Forest Soil | KTLTPGMKVKTVIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPSANAGAGPVNQ* |
| Ga0066388_1024903572 | 3300005332 | Tropical Forest Soil | TPGMKVKTIIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPAPAPTNQ* |
| Ga0066388_1063724271 | 3300005332 | Tropical Forest Soil | VIHPLRDGTNGGQFMAVTLPDGNVMGNPNAAPSANAGGGAN* |
| Ga0066388_1069208741 | 3300005332 | Tropical Forest Soil | TLTPGMKVKTIIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ* |
| Ga0070682_1018567051 | 3300005337 | Corn Rhizosphere | GMKVSAVIHPLKDGTHGGQFMAVTLPDGTMKGNPNAAAGANAGAN* |
| Ga0070709_105561962 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0070710_111657523 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHPLKDGTHGGQFMAVTLPDGTTKGNANGAANANAGAN* |
| Ga0070684_1015830463 | 3300005535 | Corn Rhizosphere | PGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN* |
| Ga0070733_104196801 | 3300005541 | Surface Soil | VIHPLKDGTHGGQFMAVTLPDGTVKGNPNGAANANAGAAPARAE* |
| Ga0070672_1019034711 | 3300005543 | Miscanthus Rhizosphere | MKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN* |
| Ga0070695_1014359991 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPGMKVSAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNAAAGANAGAN* |
| Ga0070761_103819582 | 3300005591 | Soil | KTLRPGMKVQTVIHPLKDGSNGGQFMAITLPDGTQMGNPTGAPSANAGGAAP* |
| Ga0070763_104115542 | 3300005610 | Soil | MKVQTVIHPLKDGSNGGQFMAITLPDGTQMGNPTGAPSANAGGAAP* |
| Ga0066903_1000009116 | 3300005764 | Tropical Forest Soil | MGESCRFGVAGQGCQTFTPGMKIKTVIHPLRDGNNGGQFMAVVLPDGTQMGHPNAAPSADAGAGTANP* |
| Ga0066903_1004187275 | 3300005764 | Tropical Forest Soil | VIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPSANAGAGPTNQ* |
| Ga0066903_1068582652 | 3300005764 | Tropical Forest Soil | HPLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAANQ* |
| Ga0066903_1069655872 | 3300005764 | Tropical Forest Soil | HPLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAANQ* |
| Ga0066903_1080769341 | 3300005764 | Tropical Forest Soil | IHPLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAANQ* |
| Ga0066903_1086151152 | 3300005764 | Tropical Forest Soil | PLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAGPN* |
| Ga0066696_104747302 | 3300006032 | Soil | TVIHPLRDGANGGQFMAVTLPDGTQMGNVNAAPSANAGGGAAPDR* |
| Ga0075018_105810571 | 3300006172 | Watersheds | VTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0079222_113842053 | 3300006755 | Agricultural Soil | PKTLTPGMKIDVTIHPLRDGSHGGQFMAVTLPDGKQLGNREAPPSADAGAGPAPATR* |
| Ga0075428_1000511071 | 3300006844 | Populus Rhizosphere | GMKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNPNARPSADAGAN* |
| Ga0079219_101430213 | 3300006954 | Agricultural Soil | QGWIPKTLTPGMKVTAVIHPLKDGTHGGQFMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0099793_102287271 | 3300007258 | Vadose Zone Soil | RDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ* |
| Ga0066709_1035056931 | 3300009137 | Grasslands Soil | TLTPGMKVKTVIHPLRDGGNGGQFMAVTLPDGTQMGNANAAPSAEAGGAPAPQR* |
| Ga0099792_108320062 | 3300009143 | Vadose Zone Soil | TPGMKVTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0114969_100131248 | 3300009181 | Freshwater Lake | VIHPLKDGTHGGQFMAVTLPDGSTKGNANAAAGANAGG* |
| Ga0116135_13375242 | 3300009665 | Peatland | LTPGMKVQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP* |
| Ga0105252_100783761 | 3300009678 | Soil | SAIIHPLKDGTRGGQFMAVTLPDGTLKGNANARPSADAGAN* |
| Ga0105252_102849461 | 3300009678 | Soil | TPGMKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNPNARPSADAGAN* |
| Ga0126374_104503941 | 3300009792 | Tropical Forest Soil | DGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ* |
| Ga0126374_108154572 | 3300009792 | Tropical Forest Soil | GMKIMAIIHPLRDGNNGGQFMAVTLPDGTQIGNPNAALSIDAGGANR* |
| Ga0126384_116185561 | 3300010046 | Tropical Forest Soil | NNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAANQ* |
| Ga0126373_127598322 | 3300010048 | Tropical Forest Soil | MNVEVVVHPLRDGSNGGQFMALTLPDGTQLGNPDRGSRPGQL* |
| Ga0134065_100508452 | 3300010326 | Grasslands Soil | DGANGGQFMAVTLPDGTQIGNPNATPSANAGSGPAPER* |
| Ga0126370_122816761 | 3300010358 | Tropical Forest Soil | PLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPANQ* |
| Ga0126376_110121912 | 3300010359 | Tropical Forest Soil | RDGNNGGQFMAVTLPDGTQMGNPNAAPSANAGAAPTNQ* |
| Ga0126372_111193091 | 3300010360 | Tropical Forest Soil | HPLRDGNNGGQCMAITLPDGSLMGNPNAAPSANAGAGPANQ* |
| Ga0126378_105862392 | 3300010361 | Tropical Forest Soil | MKIKTVIHPLRDGNNGGQFTAVTLPDGTQMGNPNAAPSANPEAGAANP* |
| Ga0126377_117438081 | 3300010362 | Tropical Forest Soil | MKVQTTIHPLRDGNNGGQFMAIKLPDGTLMGNPNAAPSANAGAAPANQ* |
| Ga0126381_1007748783 | 3300010376 | Tropical Forest Soil | DGNNGGQFMAVTLPDGTQMGNINAAPSANAGGAANP* |
| Ga0136449_1002987814 | 3300010379 | Peatlands Soil | TMIHPLRDGSNGGQYMAVMLPNGTQMGSAFAAPSADAGGAGPAR* |
| Ga0126383_112114502 | 3300010398 | Tropical Forest Soil | KIKTVIHPLRDGNNGGQFMAVTLPDGTLMGNSNAAPSANAGAAPANQ* |
| Ga0126383_118057011 | 3300010398 | Tropical Forest Soil | VIHPLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAANQ* |
| Ga0126383_125528741 | 3300010398 | Tropical Forest Soil | PLRDGNNGGQFMAITLPDGTLMGNPNAAPSANAGAGPVNQ* |
| Ga0134122_100103541 | 3300010400 | Terrestrial Soil | KTLTPGMKVSAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNAAAGANAGAN* |
| Ga0126354_11410942 | 3300010857 | Boreal Forest Soil | LKDGTHGGQYRAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0126348_11071872 | 3300010862 | Boreal Forest Soil | TVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN* |
| Ga0133913_118088711 | 3300010885 | Freshwater Lake | TPGMKVSALVHPLRDGTRGGQFMIITLPDGTTKGTANAAPGNDAGGLPAVR* |
| Ga0150983_106260011 | 3300011120 | Forest Soil | DGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP* |
| Ga0150983_132168851 | 3300011120 | Forest Soil | IHPLKDGTHGGQFMAVTLPDGTVKGNPNGAANANAGGN* |
| Ga0150983_156994712 | 3300011120 | Forest Soil | VQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP* |
| Ga0137455_12164941 | 3300011429 | Soil | IHPLKDGTRGGQFMAVTLPDGTLKGNANARPSADAGAN* |
| Ga0137428_10152492 | 3300011432 | Soil | MKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNPNARPSADAGAN* |
| Ga0137376_115196041 | 3300012208 | Vadose Zone Soil | PGMKVKTVIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPSANAGAAPANQ* |
| Ga0137377_108639781 | 3300012211 | Vadose Zone Soil | IHPLKDGTHGGQYMAVTLPDGTVKGNPNGAANANAGAN* |
| Ga0137384_109903442 | 3300012357 | Vadose Zone Soil | VKVWIHPLRGGANGGQFMAVTLPDGKQMGNVNAAPSADAGGGVPAER* |
| Ga0137360_111139321 | 3300012361 | Vadose Zone Soil | LKDGTHGGQFMAVTLPDGTLKGNPNARAGANAGAAN* |
| Ga0150984_1120814661 | 3300012469 | Avena Fatua Rhizosphere | HPLRDGGSGGQFMAVTLPDGKQMGSVDAPASAEAGGAAAPNR* |
| Ga0137358_110516911 | 3300012582 | Vadose Zone Soil | HPLKDGTHGGKYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0137413_103831952 | 3300012924 | Vadose Zone Soil | PGMKVTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0137413_107317952 | 3300012924 | Vadose Zone Soil | RDGWFPKTLTPGMEVKVWIHPLRGGANGGQFMAVTLPDGTQMGNVNAAPSADAGGGVPAER* |
| Ga0137413_115577132 | 3300012924 | Vadose Zone Soil | AVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0137404_104151633 | 3300012929 | Vadose Zone Soil | GMKVTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN* |
| Ga0137404_118878262 | 3300012929 | Vadose Zone Soil | LTPGMKISAIIHPLKDGTHGGQFMAVTLPDGTVKGNPNGAAGANAGAGPAATN* |
| Ga0126369_112683912 | 3300012971 | Tropical Forest Soil | GCQTFTPGMKIKTVIHPLRDGNNGGQFMAVVLPDGTQMGHPNAAPSADAGAGTANP* |
| Ga0126369_125874341 | 3300012971 | Tropical Forest Soil | IHPLRDGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAANQ* |
| Ga0126369_137042202 | 3300012971 | Tropical Forest Soil | VHPLRDGSNGGQFMAVTLPDGTQLGNPNAAPGANAGAGPATNP* |
| Ga0075327_11327631 | 3300014272 | Natural And Restored Wetlands | PGMKVSAIIHPLQDGTRGGQSMAITPPDGTVKGNVNARPSADAGAN* |
| Ga0182024_118708911 | 3300014501 | Permafrost | LRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP* |
| Ga0137411_13266455 | 3300015052 | Vadose Zone Soil | LLPAAWALLTVIHPLRDGTAGGQFMAITLPDGTQMGNPDGRPNANAGAPAP* |
| Ga0132255_1017128242 | 3300015374 | Arabidopsis Rhizosphere | QGWVPKTLTPGMKVTAVIHPLKDGTHGGQFMAVTLPDGTMKGNINARAGANAGTN* |
| Ga0182041_108087311 | 3300016294 | Soil | MKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0182041_115839641 | 3300016294 | Soil | TPGMKVQTIVHPLRDGTNGGQFMAITLPDGTKMGNPNAAPSANAGGAANQ |
| Ga0182033_108856163 | 3300016319 | Soil | VHPLRDGANGGQFMAVTLPDGTTKGNPNAALSVNAGGGDR |
| Ga0182032_112968792 | 3300016357 | Soil | MKIKAVVHPLRDGANGGQFMAVTLPDGTQFGNVNAAPSAEAGGAAAPSR |
| Ga0182039_116313031 | 3300016422 | Soil | KTVIHPMRDGTNGGQFMAITLPDGTLIGDVNAPASANTGGGP |
| Ga0182038_112640833 | 3300016445 | Soil | GANGGQFMAVTLPDGTQFGNVNAAPNADADGVSAPTR |
| Ga0181505_101508862 | 3300016750 | Peatland | MKIKTIIHPLRDGTNGGQFMAVTLPDGTLMGNPNAAAGANAGAGPAPAANQ |
| Ga0187802_102702003 | 3300017822 | Freshwater Sediment | PKTLTPGMKVKTVIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPSANAGSGPANQ |
| Ga0187781_103025691 | 3300017972 | Tropical Peatland | KTVIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ |
| Ga0187782_106139471 | 3300017975 | Tropical Peatland | DGNAGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAAEPAKTN |
| Ga0184609_102534931 | 3300018076 | Groundwater Sediment | MKVSAIIHPLKDGTRGGQFMAVTLPDGKLMGNPNARAGANAGAN |
| Ga0187774_109029242 | 3300018089 | Tropical Peatland | PKTLTPGMKISAIIHPLKDGTHGGQYLSVTLENGKVMGAAATASPE |
| Ga0187770_107731502 | 3300018090 | Tropical Peatland | VIHPLRDGSNGGQFMAITLPDGTQMGNANAAPSANAGAAP |
| Ga0180106_12308311 | 3300019212 | Groundwater Sediment | KTLTPGMKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNANARPSADAGGK |
| Ga0180111_10936681 | 3300019244 | Groundwater Sediment | KTLTPGMKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNANARPSADAGAK |
| Ga0193753_100626271 | 3300020034 | Soil | LTPGMKVTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGGG |
| Ga0210395_102126431 | 3300020582 | Soil | RDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0210395_106738612 | 3300020582 | Soil | PGMKVQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0179596_102266653 | 3300021086 | Vadose Zone Soil | IHPLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ |
| Ga0210389_101608731 | 3300021404 | Soil | LRDGNNGGQFMAITLPDGKVMGNPNAAPSANAGGGANQ |
| Ga0210383_108747261 | 3300021407 | Soil | LRDGSNGGQYMAVMLPNGTQMGSAFAAPSADAGGAGPAR |
| Ga0210394_115878771 | 3300021420 | Soil | ITATIHPLKDGTHGGQFMAVKLPDGTLKGNLNARAGANAGAATN |
| Ga0210390_107555701 | 3300021474 | Soil | PLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0210398_100512004 | 3300021477 | Soil | LRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0210402_113123092 | 3300021478 | Soil | WIPKTLTPGMKVTAVIHPLKDGTHGGQFMAVTLPDGTTKGNPNGAANANAGAN |
| Ga0126371_101782191 | 3300021560 | Tropical Forest Soil | DGNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAANQ |
| Ga0126371_135695681 | 3300021560 | Tropical Forest Soil | GNNGGQFMAVTLPDGTLMGNPNAAPSANAGAAPAAPAANQ |
| Ga0213852_14450871 | 3300021858 | Watersheds | PLRDGNNGGQFMAVTLPDGTLLGNPAAAPSANAGGAATP |
| Ga0213853_105620391 | 3300021861 | Watersheds | GMKIKTIVHPLRDGTNGGQFMAVTLPDGTLMGNPNAAAGANAGAAPAPAANP |
| Ga0213853_115495012 | 3300021861 | Watersheds | GQFMAVTLPDGTVIGNPNGRDPAAPAAAAAPAGETQ |
| Ga0242656_10433032 | 3300022525 | Soil | GMQITATIHPLKDGTHGGQFMAVKLPDGTLKGNLNARAGANAGAATN |
| Ga0242664_10090163 | 3300022527 | Soil | PGMKVKTVIHPLRDGNNGGQFMAITLPDGKVMGNPNAAPSANAGGGANQ |
| Ga0242664_10762101 | 3300022527 | Soil | PGMKVKTVIHPLRDGNNGGQFMAITLPDGKVMGNPNAAPSANAGATPANQ |
| Ga0242662_103142311 | 3300022533 | Soil | VIHPLRDGTAGGQFMAITLPDGTEMGNPNARPNANAGAPAN |
| Ga0242673_10657152 | 3300022716 | Soil | RDGNAGGQFMAVTLPDGTLMGNPNAAPSANAGAAAPAPAPAANP |
| Ga0242661_10887052 | 3300022717 | Soil | KVQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARPGANAGAAP |
| Ga0242675_11128691 | 3300022718 | Soil | LTPGTKVQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0242672_11406122 | 3300022720 | Soil | VKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNARPNANAGAPAQ |
| Ga0247668_10027556 | 3300024331 | Soil | PLKDGTHGGQFMAVTLPDGTVKGNPNGAAGANAGAGPN |
| Ga0207663_102608983 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN |
| Ga0207644_118740902 | 3300025931 | Switchgrass Rhizosphere | GWVPKTLTPGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN |
| Ga0207709_105836692 | 3300025935 | Miscanthus Rhizosphere | MKVSAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNAAAGANAGAN |
| Ga0207711_121404673 | 3300025941 | Switchgrass Rhizosphere | PGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN |
| Ga0207661_120093542 | 3300025944 | Corn Rhizosphere | LTPGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN |
| Ga0207651_110209671 | 3300025960 | Switchgrass Rhizosphere | TPGMKITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN |
| Ga0207676_119177983 | 3300026095 | Switchgrass Rhizosphere | KITAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNGAAGANAGAN |
| Ga0209131_10228511 | 3300026320 | Grasslands Soil | IHPLKDGTHGGQYMAVTLPDGTVKGNPNGAANANAGAN |
| Ga0257156_10284312 | 3300026498 | Soil | MKVKTIIHPLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAGPANQ |
| Ga0209059_10835712 | 3300026527 | Soil | VKTVIHPLRDGANGGQFMAVTLPDGTQMGNVNAAPSANAGGGAAPDR |
| Ga0209648_105943851 | 3300026551 | Grasslands Soil | PLRDGNNGGQFMAITLPDGTLMGNPNAAPGANAGAAPANQ |
| Ga0208454_10949801 | 3300027573 | Soil | MKVSAIIHPLKDGTRGGQFMAVTLPDGTLKGNPNARPSADAGAN |
| Ga0208990_10636601 | 3300027663 | Forest Soil | AVIHPLRDGGSGGQFMAVTLPDGKQMGSVDAPASAEAGGAAAPTR |
| Ga0209693_100793734 | 3300027855 | Soil | MKVQTVIHPLKDGSNGGQFMAITLPDGTQMGNPTGAPSANAGGAAP |
| Ga0209488_101135721 | 3300027903 | Vadose Zone Soil | GNNGGQFMAVTLPDGTQMGNPNAAPGANAGAGPANQ |
| Ga0207428_111123452 | 3300027907 | Populus Rhizosphere | HPLKDGTRGGQFMAVTLPDGKLMGNPNARASANAGGN |
| Ga0268266_114736231 | 3300028379 | Switchgrass Rhizosphere | TPGMKVSAIIHPLKDGTRGGQFMAITLPDGTVKGNANARPSADAGAN |
| Ga0311371_123804052 | 3300029951 | Palsa | PLKDGTRGGQFLAVTLPDGTQMGDPTTAPGANPGAPAAAGANP |
| Ga0265324_102599561 | 3300029957 | Rhizosphere | TLTPGMKITATIHPLKDGTHGGQFMAVQLPDGTTKGNPNGAANANAGGG |
| Ga0311339_100015021 | 3300029999 | Palsa | PLRDGTAGGQFMAVTLPDGTELGNPNGRPNANAGGATP |
| Ga0311356_104691061 | 3300030617 | Palsa | IHPLRDGTAGGQFMAVTLPDGTELGNPNGRPNANAGGATP |
| Ga0073996_100214292 | 3300030998 | Soil | LTPGMKVTAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGAN |
| Ga0170824_1162760991 | 3300031231 | Forest Soil | MKVTAVIHPLKDGTHGGQFMAVTLPDGTTKGNPNGAANANAGGN |
| Ga0302324_1016095261 | 3300031236 | Palsa | QTLTPGMKVKTVVHPLRVGTKGGQFMAVWLPDGTMLGNPAAAPGANAGAPPGNN |
| Ga0265325_103268443 | 3300031241 | Rhizosphere | TATIHPLKDGTHGGQFMAVQLPDGTTKGNPNGAANANAGGG |
| Ga0170819_143334162 | 3300031469 | Forest Soil | LTPGMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0318542_102960762 | 3300031668 | Soil | IVHPLRDGTNGGQFMAITLPDGTKMGNPNAAPSANAGGAANQ |
| Ga0318561_108198552 | 3300031679 | Soil | TLKPGMQVKTVIHPMRDGTNGGQFMAITLPDGTLIGDVNAPASANAGGGP |
| Ga0318494_106418611 | 3300031751 | Soil | GMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0306919_102427281 | 3300031879 | Soil | PKTLTPGMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0306925_100848694 | 3300031890 | Soil | KTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0318522_103036022 | 3300031894 | Soil | TLTPGMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0318551_106764781 | 3300031896 | Soil | VKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0306923_103883531 | 3300031910 | Soil | LRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0306923_104049213 | 3300031910 | Soil | KTVIHPMRDGTNGGQFMAITLPDGTLIGDVNAPASANAGGGP |
| Ga0306921_102816081 | 3300031912 | Soil | TATIHPLKDGTHGGQFMAVQLPDGTTKGNPNGAANANAGAN |
| Ga0306921_108636802 | 3300031912 | Soil | RDGTNGGQFMAITLPDGTLIGDVNAPASANAGGGP |
| Ga0310912_101815891 | 3300031941 | Soil | HPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0310912_109388611 | 3300031941 | Soil | AVIHPLRDGAAGGQFMAVTLPDGTQFGNVNAAPSANAGGAPVPVR |
| Ga0310909_109827611 | 3300031947 | Soil | TLTPGMKVQTVIHPLRDGANGGQFMAITLPDGTKFGNANAAPSADAGGAAAPTR |
| Ga0306922_109993441 | 3300032001 | Soil | RDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0318506_102497661 | 3300032052 | Soil | TVIHPMRDGTNGGQFMAITLPDGTLIGDVNAPASANAGGGP |
| Ga0318575_104841222 | 3300032055 | Soil | PLRSGAVGGQFMAITLPDGTQIGNVNAAPSAEAGGGAPTDP |
| Ga0318518_107033452 | 3300032090 | Soil | KPGMQVKTVIHPMRDGTNGGQFMAITLPDGTLIGDVNAPASANAGGGP |
| Ga0307470_102906571 | 3300032174 | Hardwood Forest Soil | TAVIHPLKDGTHGGQYMAVTLPDGTTKGNPNGAANANAGGG |
| Ga0307470_117699701 | 3300032174 | Hardwood Forest Soil | GWVPKTLTPGMQISATIHPLKDGTHGGQFMAVKLPDGTLKGNVNARAGANAGAAN |
| Ga0306920_1000583181 | 3300032261 | Soil | KTLTPGMKVKTVIHPLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0306920_1015841482 | 3300032261 | Soil | HPLRDGNNGGQFMAVTLPDGTQMGNPNAAPSANAGGGANP |
| Ga0348332_122314182 | 3300032515 | Plant Litter | GMKVQAVIHPLRDGTPGGQFMAVTLPDGTQLGNPNARAGANAGAAP |
| Ga0335080_117125642 | 3300032828 | Soil | TPGMKITAIIHPLKDGTHGGQFMAVTLPDGKLMGNPNAAASANAGGG |
| Ga0310914_114063161 | 3300033289 | Soil | MKIKAVVHPLRDGANGGQFMAITLPDGTKFGNANAAPSADAGGAAAPTR |
| Ga0318519_102918431 | 3300033290 | Soil | PLRDGTAGGQFMAITLPDGTEMGNPNGRPNANAGAPAN |
| Ga0326726_102166421 | 3300033433 | Peat Soil | ISAVIHPLKDGTHGGQFMAVTLPDGTTKGNVNARAGANAGAN |
| Ga0316628_1013829731 | 3300033513 | Soil | MKVSAVIHPLKDGTHGGQYMAVTLPDGKVMGNANNGNAGVGAPAPAAP |
| Ga0364929_0253952_87_221 | 3300034149 | Sediment | MKVTAIIHPLKDGTHGGQFMAVTLPDGTLKGNPNAAAGANAGVN |
| Ga0364933_096954_15_149 | 3300034150 | Sediment | MKVSATIHPLKDGTRGGQFMAVTLPDGKLMGNPNARAGANAGGN |
| ⦗Top⦘ |