


| Basic Information | |
|---|---|
| Family ID | F033815 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDWITADLIDAINETSWFDGIGTIVVLLIAYAAYKWIKKNI |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.56 % |
| % of genes near scaffold ends (potentially truncated) | 28.98 % |
| % of genes from short scaffolds (< 2000 bps) | 61.93 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (39.773 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (20.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.114 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.773 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF12322 | T4_baseplate | 11.36 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.41 |
| PF00190 | Cupin_1 | 2.84 |
| PF02511 | Thy1 | 2.27 |
| PF12705 | PDDEXK_1 | 2.27 |
| PF01764 | Lipase_3 | 2.27 |
| PF08534 | Redoxin | 2.27 |
| PF00011 | HSP20 | 1.70 |
| PF00959 | Phage_lysozyme | 1.70 |
| PF01370 | Epimerase | 1.70 |
| PF00565 | SNase | 1.70 |
| PF08722 | Tn7_TnsA-like_N | 1.70 |
| PF00166 | Cpn10 | 1.14 |
| PF11246 | Phage_gp53 | 1.14 |
| PF00462 | Glutaredoxin | 1.14 |
| PF07883 | Cupin_2 | 1.14 |
| PF01818 | Translat_reg | 1.14 |
| PF08993 | T4_Gp59_N | 1.14 |
| PF04984 | Phage_sheath_1 | 0.57 |
| PF06941 | NT5C | 0.57 |
| PF06841 | Phage_T4_gp19 | 0.57 |
| PF04851 | ResIII | 0.57 |
| PF05866 | RusA | 0.57 |
| PF13203 | DUF2201_N | 0.57 |
| PF01242 | PTPS | 0.57 |
| PF05226 | CHASE2 | 0.57 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.57 |
| PF01832 | Glucosaminidase | 0.57 |
| PF00180 | Iso_dh | 0.57 |
| PF02777 | Sod_Fe_C | 0.57 |
| PF06067 | DUF932 | 0.57 |
| PF01521 | Fe-S_biosyn | 0.57 |
| PF00436 | SSB | 0.57 |
| PF00464 | SHMT | 0.57 |
| PF11649 | T4_neck-protein | 0.57 |
| PF05488 | PAAR_motif | 0.57 |
| PF07230 | Portal_Gp20 | 0.57 |
| PF00082 | Peptidase_S8 | 0.57 |
| PF07087 | DUF1353 | 0.57 |
| PF08291 | Peptidase_M15_3 | 0.57 |
| PF09967 | DUF2201 | 0.57 |
| PF10431 | ClpB_D2-small | 0.57 |
| PF03592 | Terminase_2 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 2.27 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.70 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.14 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.57 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.57 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.57 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.57 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.57 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.57 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.57 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.57 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.57 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.57 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.57 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.57 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.23 % |
| Unclassified | root | N/A | 39.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10097612 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10173970 | Not Available | 755 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10203793 | Not Available | 661 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10260181 | All Organisms → Viruses | 540 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10012472 | All Organisms → Viruses → Predicted Viral | 4391 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10043157 | All Organisms → Viruses | 2060 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1031401 | Not Available | 606 | Open in IMG/M |
| 3300001346|JGI20151J14362_10016937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4004 | Open in IMG/M |
| 3300001354|JGI20155J14468_10203850 | All Organisms → Viruses | 594 | Open in IMG/M |
| 3300001355|JGI20158J14315_10203470 | Not Available | 563 | Open in IMG/M |
| 3300001450|JGI24006J15134_10013028 | All Organisms → Viruses → Predicted Viral | 4008 | Open in IMG/M |
| 3300001956|GOS2266_1040154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300004097|Ga0055584_100018714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6812 | Open in IMG/M |
| 3300004097|Ga0055584_100030195 | All Organisms → cellular organisms → Bacteria | 5325 | Open in IMG/M |
| 3300004097|Ga0055584_100094016 | Not Available | 2980 | Open in IMG/M |
| 3300004097|Ga0055584_100185685 | Not Available | 2108 | Open in IMG/M |
| 3300004110|Ga0008648_10090663 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 855 | Open in IMG/M |
| 3300004276|Ga0066610_10253263 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 563 | Open in IMG/M |
| 3300004457|Ga0066224_1196518 | Not Available | 511 | Open in IMG/M |
| 3300005239|Ga0073579_1180641 | Not Available | 11674 | Open in IMG/M |
| 3300005239|Ga0073579_1182325 | Not Available | 5672 | Open in IMG/M |
| 3300005512|Ga0074648_1021963 | Not Available | 3523 | Open in IMG/M |
| 3300005512|Ga0074648_1043005 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300005838|Ga0008649_10196667 | All Organisms → Viruses | 785 | Open in IMG/M |
| 3300005934|Ga0066377_10000039 | Not Available | 30306 | Open in IMG/M |
| 3300006025|Ga0075474_10006081 | All Organisms → Viruses → Predicted Viral | 4835 | Open in IMG/M |
| 3300006403|Ga0075514_1926285 | All Organisms → Viruses | 673 | Open in IMG/M |
| 3300006737|Ga0098037_1057632 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
| 3300006867|Ga0075476_10101558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1106 | Open in IMG/M |
| 3300006870|Ga0075479_10138275 | All Organisms → Viruses | 998 | Open in IMG/M |
| 3300007231|Ga0075469_10123003 | Not Available | 718 | Open in IMG/M |
| 3300007539|Ga0099849_1008304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 4682 | Open in IMG/M |
| 3300007623|Ga0102948_1072545 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1075 | Open in IMG/M |
| 3300007725|Ga0102951_1010114 | All Organisms → Viruses → Predicted Viral | 3166 | Open in IMG/M |
| 3300007778|Ga0102954_1185756 | Not Available | 606 | Open in IMG/M |
| 3300008012|Ga0075480_10085915 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
| 3300009000|Ga0102960_1154125 | Not Available | 827 | Open in IMG/M |
| 3300009001|Ga0102963_1038912 | Not Available | 1979 | Open in IMG/M |
| 3300009001|Ga0102963_1062365 | Not Available | 1536 | Open in IMG/M |
| 3300009001|Ga0102963_1248284 | Not Available | 704 | Open in IMG/M |
| 3300009027|Ga0102957_1055112 | All Organisms → Viruses | 1365 | Open in IMG/M |
| 3300009071|Ga0115566_10431610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300009193|Ga0115551_1435529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300009423|Ga0115548_1018889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2818 | Open in IMG/M |
| 3300009423|Ga0115548_1036181 | Not Available | 1848 | Open in IMG/M |
| 3300009440|Ga0115561_1293252 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 602 | Open in IMG/M |
| 3300009449|Ga0115558_1191431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 847 | Open in IMG/M |
| 3300009507|Ga0115572_10325358 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 869 | Open in IMG/M |
| 3300009620|Ga0114912_1133786 | Not Available | 583 | Open in IMG/M |
| 3300009703|Ga0114933_10120981 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300009728|Ga0123371_153473 | Not Available | 521 | Open in IMG/M |
| 3300012919|Ga0160422_10002363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 11808 | Open in IMG/M |
| 3300012920|Ga0160423_10001638 | Not Available | 18737 | Open in IMG/M |
| 3300012920|Ga0160423_10003148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 13769 | Open in IMG/M |
| 3300012920|Ga0160423_10038886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3497 | Open in IMG/M |
| 3300012920|Ga0160423_10446029 | Not Available | 882 | Open in IMG/M |
| 3300012920|Ga0160423_10670945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 700 | Open in IMG/M |
| 3300012920|Ga0160423_10711858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 677 | Open in IMG/M |
| 3300013188|Ga0116834_1080891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 653 | Open in IMG/M |
| 3300013231|Ga0116832_1089053 | Not Available | 520 | Open in IMG/M |
| 3300013253|Ga0116813_1052201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 692 | Open in IMG/M |
| 3300013253|Ga0116813_1077656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 581 | Open in IMG/M |
| 3300016747|Ga0182078_10274433 | Not Available | 523 | Open in IMG/M |
| 3300017726|Ga0181381_1097262 | All Organisms → Viruses | 624 | Open in IMG/M |
| 3300017727|Ga0181401_1000052 | Not Available | 37681 | Open in IMG/M |
| 3300017727|Ga0181401_1119541 | All Organisms → Viruses | 658 | Open in IMG/M |
| 3300017734|Ga0187222_1007247 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2829 | Open in IMG/M |
| 3300017742|Ga0181399_1033802 | Not Available | 1378 | Open in IMG/M |
| 3300017745|Ga0181427_1007858 | All Organisms → Viruses → Predicted Viral | 2669 | Open in IMG/M |
| 3300017759|Ga0181414_1130796 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 658 | Open in IMG/M |
| 3300017762|Ga0181422_1080616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1027 | Open in IMG/M |
| 3300017763|Ga0181410_1092373 | Not Available | 883 | Open in IMG/M |
| 3300017765|Ga0181413_1181865 | Not Available | 630 | Open in IMG/M |
| 3300017818|Ga0181565_10000006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 181867 | Open in IMG/M |
| 3300017818|Ga0181565_10007880 | Not Available | 8096 | Open in IMG/M |
| 3300017824|Ga0181552_10315770 | Not Available | 766 | Open in IMG/M |
| 3300017824|Ga0181552_10329343 | All Organisms → Viruses | 746 | Open in IMG/M |
| 3300017824|Ga0181552_10536571 | All Organisms → Viruses | 548 | Open in IMG/M |
| 3300017949|Ga0181584_10132173 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300017949|Ga0181584_10261032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1119 | Open in IMG/M |
| 3300017951|Ga0181577_10130167 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300017951|Ga0181577_10137738 | Not Available | 1667 | Open in IMG/M |
| 3300017952|Ga0181583_10000149 | Not Available | 43414 | Open in IMG/M |
| 3300017952|Ga0181583_10000991 | Not Available | 20825 | Open in IMG/M |
| 3300017952|Ga0181583_10001741 | Not Available | 16145 | Open in IMG/M |
| 3300017952|Ga0181583_10170424 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300017956|Ga0181580_10785695 | All Organisms → Viruses | 600 | Open in IMG/M |
| 3300017958|Ga0181582_10844186 | Not Available | 542 | Open in IMG/M |
| 3300017958|Ga0181582_10890566 | All Organisms → Viruses | 524 | Open in IMG/M |
| 3300017962|Ga0181581_10001582 | Not Available | 17759 | Open in IMG/M |
| 3300017968|Ga0181587_10644858 | Not Available | 673 | Open in IMG/M |
| 3300017985|Ga0181576_10243110 | Not Available | 1162 | Open in IMG/M |
| 3300018048|Ga0181606_10002567 | Not Available | 15599 | Open in IMG/M |
| 3300018428|Ga0181568_11315654 | Not Available | 539 | Open in IMG/M |
| 3300018876|Ga0181564_10465107 | Not Available | 681 | Open in IMG/M |
| 3300019274|Ga0182073_1183003 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300019274|Ga0182073_1360015 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 933 | Open in IMG/M |
| 3300019283|Ga0182058_1454250 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1203 | Open in IMG/M |
| 3300019283|Ga0182058_1684867 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300019751|Ga0194029_1079030 | All Organisms → Viruses | 564 | Open in IMG/M |
| 3300020165|Ga0206125_10017245 | Not Available | 4518 | Open in IMG/M |
| 3300020165|Ga0206125_10131656 | Not Available | 1023 | Open in IMG/M |
| 3300020165|Ga0206125_10191124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 802 | Open in IMG/M |
| 3300020165|Ga0206125_10312267 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300020175|Ga0206124_10043937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1999 | Open in IMG/M |
| 3300020188|Ga0181605_10029151 | Not Available | 3370 | Open in IMG/M |
| 3300020247|Ga0211654_1020452 | All Organisms → Viruses | 1064 | Open in IMG/M |
| 3300020282|Ga0211667_1002526 | Not Available | 5301 | Open in IMG/M |
| 3300020379|Ga0211652_10003934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 4626 | Open in IMG/M |
| 3300020403|Ga0211532_10205787 | Not Available | 783 | Open in IMG/M |
| 3300020404|Ga0211659_10002365 | Not Available | 10154 | Open in IMG/M |
| 3300020404|Ga0211659_10126918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1165 | Open in IMG/M |
| 3300020413|Ga0211516_10428698 | All Organisms → Viruses | 584 | Open in IMG/M |
| 3300020422|Ga0211702_10055766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1081 | Open in IMG/M |
| 3300020438|Ga0211576_10122457 | Not Available | 1423 | Open in IMG/M |
| 3300020438|Ga0211576_10508926 | Not Available | 607 | Open in IMG/M |
| 3300020440|Ga0211518_10103437 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
| 3300020440|Ga0211518_10140204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1235 | Open in IMG/M |
| 3300020442|Ga0211559_10000086 | All Organisms → cellular organisms → Bacteria | 51391 | Open in IMG/M |
| 3300020442|Ga0211559_10013470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4197 | Open in IMG/M |
| 3300020442|Ga0211559_10022826 | All Organisms → cellular organisms → Bacteria | 3151 | Open in IMG/M |
| 3300020463|Ga0211676_10351755 | Not Available | 821 | Open in IMG/M |
| 3300020595|Ga0206126_10117533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1295 | Open in IMG/M |
| 3300020595|Ga0206126_10298887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300021185|Ga0206682_10089903 | Not Available | 1547 | Open in IMG/M |
| 3300021335|Ga0213867_1000172 | Not Available | 30165 | Open in IMG/M |
| 3300021356|Ga0213858_10306944 | Not Available | 757 | Open in IMG/M |
| 3300021364|Ga0213859_10000202 | Not Available | 27874 | Open in IMG/M |
| 3300021364|Ga0213859_10017573 | Not Available | 3303 | Open in IMG/M |
| 3300021365|Ga0206123_10338231 | Not Available | 632 | Open in IMG/M |
| 3300021368|Ga0213860_10023397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2573 | Open in IMG/M |
| 3300021375|Ga0213869_10229755 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 821 | Open in IMG/M |
| 3300021379|Ga0213864_10064676 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300021389|Ga0213868_10118505 | All Organisms → Viruses | 1680 | Open in IMG/M |
| 3300021957|Ga0222717_10007315 | Not Available | 7838 | Open in IMG/M |
| 3300021957|Ga0222717_10485202 | Not Available | 668 | Open in IMG/M |
| 3300021958|Ga0222718_10000025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 173519 | Open in IMG/M |
| 3300021958|Ga0222718_10074635 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300021964|Ga0222719_10005209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 11264 | Open in IMG/M |
| 3300021964|Ga0222719_10099184 | Not Available | 2131 | Open in IMG/M |
| 3300022074|Ga0224906_1010141 | Not Available | 3664 | Open in IMG/M |
| 3300022074|Ga0224906_1131977 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300022074|Ga0224906_1177293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 590 | Open in IMG/M |
| 3300022925|Ga0255773_10110417 | All Organisms → Viruses | 1423 | Open in IMG/M |
| 3300022934|Ga0255781_10001769 | Not Available | 17463 | Open in IMG/M |
| 3300022935|Ga0255780_10037726 | All Organisms → Viruses → Predicted Viral | 3292 | Open in IMG/M |
| 3300022935|Ga0255780_10182087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1108 | Open in IMG/M |
| 3300022939|Ga0255754_10423560 | Not Available | 590 | Open in IMG/M |
| 3300023084|Ga0255778_10047316 | All Organisms → Viruses → Predicted Viral | 2731 | Open in IMG/M |
| 3300023084|Ga0255778_10226600 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 909 | Open in IMG/M |
| 3300023116|Ga0255751_10306427 | Not Available | 826 | Open in IMG/M |
| 3300025099|Ga0208669_1020942 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
| 3300025108|Ga0208793_1161645 | All Organisms → Viruses | 585 | Open in IMG/M |
| 3300025138|Ga0209634_1012855 | All Organisms → Viruses → Predicted Viral | 4941 | Open in IMG/M |
| 3300025592|Ga0209658_1022042 | Not Available | 2035 | Open in IMG/M |
| 3300025674|Ga0208162_1009845 | Not Available | 4077 | Open in IMG/M |
| 3300025830|Ga0209832_1030348 | All Organisms → Viruses | 2112 | Open in IMG/M |
| 3300025832|Ga0209307_1003931 | All Organisms → Viruses | 8382 | Open in IMG/M |
| 3300025870|Ga0209666_1035172 | All Organisms → Viruses → Predicted Viral | 2823 | Open in IMG/M |
| 3300025880|Ga0209534_10066820 | All Organisms → Viruses → Predicted Viral | 2193 | Open in IMG/M |
| 3300025890|Ga0209631_10131130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300026085|Ga0208880_1000016 | Not Available | 32328 | Open in IMG/M |
| 3300026138|Ga0209951_1118070 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 538 | Open in IMG/M |
| 3300026187|Ga0209929_1042473 | Not Available | 1321 | Open in IMG/M |
| 3300027788|Ga0209711_10079383 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300028008|Ga0228674_1108194 | All Organisms → Viruses | 963 | Open in IMG/M |
| 3300028196|Ga0257114_1042854 | All Organisms → Viruses | 2045 | Open in IMG/M |
| 3300028196|Ga0257114_1078910 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300028282|Ga0256413_1247343 | All Organisms → Viruses | 634 | Open in IMG/M |
| 3300029448|Ga0183755_1017670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2471 | Open in IMG/M |
| 3300031519|Ga0307488_10016519 | All Organisms → cellular organisms → Bacteria | 5966 | Open in IMG/M |
| 3300031774|Ga0315331_10030228 | All Organisms → Viruses | 4014 | Open in IMG/M |
| 3300031774|Ga0315331_10120134 | Not Available | 1957 | Open in IMG/M |
| 3300031785|Ga0310343_10008938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 5442 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 20.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.80% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.39% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.11% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.11% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.55% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.55% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.98% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.41% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.41% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.41% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.84% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.70% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.70% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.14% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.14% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.14% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.57% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.57% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.57% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.57% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.57% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.57% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.57% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004110 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009728 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013253 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station4_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019274 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100976122 | 3300000101 | Marine | MDWVTADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRFK* |
| DelMOSum2010_101739704 | 3300000101 | Marine | MDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI* |
| DelMOSum2010_102037932 | 3300000101 | Marine | MEITAELLQVINETSWTDGIGTLAVLLIAYALYKYINKRFK* |
| DelMOSum2010_102601812 | 3300000101 | Marine | MEITAELLQVINDTSWFDGIATLVVLLGAYAVYKYIQKRFK* |
| DelMOSum2011_100124724 | 3300000115 | Marine | MDWITADLIDAINETSWFDGIGTIVVLLIAYAAYKWIKKNI* |
| DelMOWin2010_100431572 | 3300000117 | Marine | MEITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYIQKRFK* |
| BB_Man_B_Liq_inBBDRAFT_10314012 | 3300000401 | Bioluminescent Bay | MEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNKTK* |
| JGI20151J14362_100169378 | 3300001346 | Pelagic Marine | MNWITADLLQVINETSWFDGIGTIVVLLGAYAVYKYINKRFK* |
| JGI20155J14468_102038502 | 3300001354 | Pelagic Marine | MDWVTADLLEVINNTSWFDGIGTIVVLLGAYAIYKXINKKFK* |
| JGI20158J14315_102034701 | 3300001355 | Pelagic Marine | DWITADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKNL* |
| JGI24006J15134_100130283 | 3300001450 | Marine | MDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNV* |
| GOS2266_10401546 | 3300001956 | Marine | MDWVTADLIDAINNTSWVDGIGTIVVLLLAYAAYRWIKKNV* |
| Ga0055584_1000187146 | 3300004097 | Pelagic Marine | MEITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYINKRFK* |
| Ga0055584_1000301952 | 3300004097 | Pelagic Marine | MEWLTADLINAMNETSWVDGIGTIVVLLLGYAAYKWIKNKFK* |
| Ga0055584_1000940164 | 3300004097 | Pelagic Marine | MDWITADLIDAINNTSWFDGIGTIVVLLGAYAIYKYINQRFK* |
| Ga0055584_1001856851 | 3300004097 | Pelagic Marine | MDWVTADLLTVINETSWFDGIGTIVVLLGAYAIYKYINKRFK* |
| Ga0008648_100906631 | 3300004110 | Marine | MDWITADLIDAINETSWFDGIGTIIILLVAYAVYKWIKKNI* |
| Ga0066610_102532631 | 3300004276 | Marine | MDWITADLIDAINETSWFDGIGTIVVLLIAYAVYKWIKKNI* |
| Ga0066224_11965182 | 3300004457 | Marine | MDWITAELIDAINNTSWVDGIGTIIVLLAAYAGYRWIKKNI* |
| Ga0073579_118064118 | 3300005239 | Marine | MDWITADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKNL* |
| Ga0073579_11823253 | 3300005239 | Marine | MEITAELLQVINDTSWFDGIVTLVVLLGAYAVYKYIQKRFK* |
| Ga0074648_10219633 | 3300005512 | Saline Water And Sediment | MDWFTADLIYAMNETSWVDGIGTIIVLLAAYACFKWINKRFR* |
| Ga0074648_10430054 | 3300005512 | Saline Water And Sediment | MDISADLIYAMNETSWVDGIGTIVVLLVAYAAYRWIKKNI* |
| Ga0008649_101966673 | 3300005838 | Marine | MDWFTADLIEAMNETSWFDGIGTIVVLLCAYAAYRWIKKN |
| Ga0066377_1000003930 | 3300005934 | Marine | MEITAELIHALNETSWVDGIGTIVVLLLGYAAYRYIKKKL* |
| Ga0075474_100060816 | 3300006025 | Aqueous | MDWFTADLINAMNETSWFDGIGTIVVLLGAYFVYKWINNKFK* |
| Ga0075514_19262852 | 3300006403 | Aqueous | MDWVTADLLEVINNTSWFDGIGTIVVLLGAYAIYKYINKKFK* |
| Ga0098037_10576323 | 3300006737 | Marine | MDWITADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRFK* |
| Ga0075476_101015581 | 3300006867 | Aqueous | GTSIMEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWIKKKTK* |
| Ga0075479_101382754 | 3300006870 | Aqueous | MDWVTADLLEVINNTSWFDGIGTIVVLLGAYAIYKYINKK |
| Ga0075469_101230033 | 3300007231 | Aqueous | TTNTLENNMDWITADLIDAINETSWFDGIGTIVVLLIAYAVYKWIKKNI* |
| Ga0099849_10083048 | 3300007539 | Aqueous | MDWFTADLINAMNETSWVDGIGTIIVLLLAYAAYRWIKKNI* |
| Ga0102948_10725452 | 3300007623 | Water | MDWVTADLLQVINETSWFDGIGTIVVLLGAYAVYKYINKRFK* |
| Ga0102951_10101141 | 3300007725 | Water | MDWVSADLIDAINNTSWFDGIGTIVVLLGAYFVYKWINKKFK* |
| Ga0102954_11857562 | 3300007778 | Water | VDWFTADLIYAMNETSWVDGIGTIIVLLAAYACFKWINKRFR* |
| Ga0075480_100859154 | 3300008012 | Aqueous | MDWITAELIDSINNTSWVDGIGTIIILLAAYAGYRWIKKNI* |
| Ga0102960_11541253 | 3300009000 | Pond Water | VDWFTADLIYAMNETSWVDGIGTIVVLLAAYACFKWINKRFR* |
| Ga0102963_10389125 | 3300009001 | Pond Water | MDWFTSDLIHAMNETSWFDGIGTIVVLLVAYAAFRWIRKNI* |
| Ga0102963_10623653 | 3300009001 | Pond Water | MDWLTADLLRVINETSWFDGIGTIVVLLGAYAVYKYINKKFK* |
| Ga0102963_12482842 | 3300009001 | Pond Water | MEITADLIRAMNETSWVDGIGTIVVLLIGYAAYCWIKKKTK* |
| Ga0102957_10551122 | 3300009027 | Pond Water | MEITAELLQVINDTSWFDGIATLVLLLGAYAVYKYIQKRFK* |
| Ga0115566_104316102 | 3300009071 | Pelagic Marine | MDWITADLVDAINNTSWFDGIGTIVVLLGAYVVYKYINKRFK* |
| Ga0115551_14355292 | 3300009193 | Pelagic Marine | MDWITADLIDAINNTSWFDGIGTIVVLLGAYVVYKYINKRFK* |
| Ga0115548_10188892 | 3300009423 | Pelagic Marine | MEITAELLQVINDTSWFDGILTLVVLLGAYAVYKYINKRFK* |
| Ga0115548_10361817 | 3300009423 | Pelagic Marine | TTNTLENKMDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI* |
| Ga0115561_12932523 | 3300009440 | Pelagic Marine | MEITAELLQVINETSWTDGIGTLAVLLIAYALYKYINKRF |
| Ga0115558_11914312 | 3300009449 | Pelagic Marine | MDWITADLLNAINNTSWFDGIGTIVVLLGAYAVYKYINKRFK* |
| Ga0115572_103253581 | 3300009507 | Pelagic Marine | LMDWITADLLTVINETSWFDGIGTIVVLLGAYAIYKYINKKFK* |
| Ga0114912_11337861 | 3300009620 | Deep Ocean | ITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI* |
| Ga0114933_101209812 | 3300009703 | Deep Subsurface | MEIDADLIEVVNETSWVDGIGTIVVLLLAYATYRWIKKNI* |
| Ga0123371_1534731 | 3300009728 | Marine | MDWFTADLINAMNETSWVDGIGTIVVLLLAYAAYRWIKKNI* |
| Ga0160422_1000236314 | 3300012919 | Seawater | MDWLTSELIAEINNTSWVDGIGTIVVFLVAYAVFRWIKKNI* |
| Ga0160423_1000163816 | 3300012920 | Surface Seawater | MDWLTSDLIEAINNTSWVDGIGTIVVLLGAYFVYKWINNKFK* |
| Ga0160423_1000314816 | 3300012920 | Surface Seawater | VEIDMDWITSDLIEEINNTSWVDGIGTIVVFLVAYAVFRWIKKNI* |
| Ga0160423_100388863 | 3300012920 | Surface Seawater | MDWFTADLINAMNETSWFDGIGTIVVLLAAYAAYRWIKKKTE* |
| Ga0160423_104460293 | 3300012920 | Surface Seawater | MDWLTADLIDAMNNTSWFDGIGTIVVLLLAYAAYRWIKKNV* |
| Ga0160423_106709453 | 3300012920 | Surface Seawater | MDWITSDLIDAINETSWVDGIGTIVVLLVAYAAYRWIRKNI* |
| Ga0160423_107118583 | 3300012920 | Surface Seawater | MDWITSDLIDAINETSWVDGIGTIVVLLVAYAAYRWIKKNI* |
| Ga0116834_10808911 | 3300013188 | Marine | MDWITSDLIEAINETSWVDGIGTIVVLLVAYAAYRWIKKKL* |
| Ga0116832_10890532 | 3300013231 | Marine | MEWLTSDLIEAINNTSWVDGIGTIVVLLGAYFVYKWINNKFK* |
| Ga0116813_10522011 | 3300013253 | Marine | MDWATAELIEEINNTSWVDGIGTIVVFLVAYAVFRWIKKNI* |
| Ga0116813_10776561 | 3300013253 | Marine | MDWVTAELIEEINNTSWVDGIGTIVVFLLAYAVFRWIKKNI* |
| Ga0182078_102744333 | 3300016747 | Salt Marsh | MEITADLIHAMNETSWVDGIGTIVVLLLGYAAYRYIKKKTLKF |
| Ga0181381_10972621 | 3300017726 | Seawater | IMEITAELLQVINDTSWFDGILTLVVLLGAYAVYKYINKRFK |
| Ga0181401_10000527 | 3300017727 | Seawater | MEWLTADLVNAMNETSWVDGIGTIVVLLLGYAAYKWIKNKFK |
| Ga0181401_11195411 | 3300017727 | Seawater | IMDWITADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0187222_10072474 | 3300017734 | Seawater | MDWITADLLQVINDTCWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0181399_10338021 | 3300017742 | Seawater | DLVNAMNETSWVDGIGTIVVLLLGYAAYKWIKNKFK |
| Ga0181427_10078584 | 3300017745 | Seawater | MEITAELLQVINDTSWFDGIVTLVVLLGAYAVYKYINKRFK |
| Ga0181414_11307963 | 3300017759 | Seawater | MDWITADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRF |
| Ga0181422_10806164 | 3300017762 | Seawater | MDWFTADLIDAMNETSWVDGIGTIIVLLLAYAAYRWIKK |
| Ga0181410_10923733 | 3300017763 | Seawater | IMDWLTADLIDAMNETSWFDGIGTIFVLLLAYAAYRWIKKKI |
| Ga0181413_11818651 | 3300017765 | Seawater | NMDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI |
| Ga0181406_100031025 | 3300017767 | Seawater | VNWLDAELIQAINEISWFDGIGTLVVLLVAYAIFKR |
| Ga0181565_1000000673 | 3300017818 | Salt Marsh | MEITADLIRAMNETSWIDGIGTIIVLLLGYTAYRWIKKKTK |
| Ga0181565_100078804 | 3300017818 | Salt Marsh | MDWLTADLLKVINETSWFDGIGTIVVLLVAYTIYKYINKKFK |
| Ga0181552_103157701 | 3300017824 | Salt Marsh | MEWLTSDLIEAINNTSWVDGIGTIVVLLGAYFVYKWINNKFK |
| Ga0181552_103293432 | 3300017824 | Salt Marsh | MEITAELLQIINDTSWFDGIATLVVLLGAYAVYKYIQKRFK |
| Ga0181552_105365711 | 3300017824 | Salt Marsh | IMEITAELLQVINDTSWFDGIATLVVLLGAYAVYKYIQKRFK |
| Ga0181584_101321734 | 3300017949 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNKTK |
| Ga0181584_102610323 | 3300017949 | Salt Marsh | TSIMEITADLIRAMNETSWVDGIGTIVVLLIAYAAYRWIKNKTK |
| Ga0181577_101301674 | 3300017951 | Salt Marsh | MDWFTADLIHAMNETSWFDGIGTIVVLLVAYAAFRWIRKNI |
| Ga0181577_101377382 | 3300017951 | Salt Marsh | MDWFTADLIHAMNETSWFDGIGTIVVLLIAYAAFRWIRKNI |
| Ga0181583_1000014930 | 3300017952 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWI |
| Ga0181583_1000099123 | 3300017952 | Salt Marsh | GTSIMEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWIKKKTK |
| Ga0181583_100017411 | 3300017952 | Salt Marsh | TLVRGTSIMEITADLIRAMNETSWVDGIGTIVVLLIAYAAYRWIKNKTK |
| Ga0181583_101704245 | 3300017952 | Salt Marsh | MEITAELIHALNETSWVDGIGTIVVLLLGYTAYRYIKKKL |
| Ga0181580_107856952 | 3300017956 | Salt Marsh | MEITAELLQVINDTSWFDGIATLVVLLGAYAVYKYIQKRFK |
| Ga0181582_108441861 | 3300017958 | Salt Marsh | STLVRGTSIMEITADLIRAMNETSWIDGIGTIIVLLLGYTAYRWIKKKTK |
| Ga0181582_108905662 | 3300017958 | Salt Marsh | MDWFTADLINAMNETSWFDGIGTIVVLLGAYFVYKWINNKFK |
| Ga0181581_100015822 | 3300017962 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLIAYAAYRWIKNKTK |
| Ga0181587_106448583 | 3300017968 | Salt Marsh | VRGTSIMEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWIKKKTK |
| Ga0181576_102431101 | 3300017985 | Salt Marsh | DLIHAMNETSWVDGIGTIVVLLLGYAAYRYIKKKL |
| Ga0181606_100025672 | 3300018048 | Salt Marsh | MDWFTADLIHAMNETSWVDGIGTIVVLLGAYFVYKWINNKFK |
| Ga0181568_113156542 | 3300018428 | Salt Marsh | MDWFTADLIHAMNETSWFDGIGTIVVLLAAYAAYRWIKKKTE |
| Ga0181564_104651073 | 3300018876 | Salt Marsh | LIRAMNETSWVDGIGTIVVLLIGYAAYRWIKKKTK |
| Ga0182073_11830031 | 3300019274 | Salt Marsh | MDWLTADLLRVINETSWFDGIGTIVVLLGAYAVYKYINKKFK |
| Ga0182073_13600152 | 3300019274 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWIKKKTK |
| Ga0182058_14542506 | 3300019283 | Salt Marsh | MEITADLIHAMNETSWVDGIGTIVVLLLGYAAYRYIKKK |
| Ga0182058_16848672 | 3300019283 | Salt Marsh | MEITADLIRAMNETSWIDGIGTIIVLLLGYTAYRWIK |
| Ga0194029_10790301 | 3300019751 | Freshwater | AELLQVINDTSWFDGIATLVVLLGAYAVYKYIQKRFK |
| Ga0206125_100172457 | 3300020165 | Seawater | MDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI |
| Ga0206125_101316564 | 3300020165 | Seawater | MDWITADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKNL |
| Ga0206125_101911242 | 3300020165 | Seawater | MEITAELLQVINETSWTDGIGTLAVLLIAYALYKYINKRFK |
| Ga0206125_103122672 | 3300020165 | Seawater | ITADLLTVINETSWFDGIGTIVVLLGAYAIYKYINKKFK |
| Ga0206124_100439372 | 3300020175 | Seawater | MNWITADLLQVINETSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0181605_100291511 | 3300020188 | Salt Marsh | TADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNKTK |
| Ga0211654_10204521 | 3300020247 | Marine | MEITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYIQKRFK |
| Ga0211667_100252611 | 3300020282 | Marine | MDWLTADLINAINNVSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0211652_100039342 | 3300020379 | Marine | MDWITADLLQVINETSWFDGIGTIVVLLGAYAIYKYINKRFK |
| Ga0211532_102057872 | 3300020403 | Marine | MDWITSDLINAINETSWVDGIGTIIVLLLAYAAYRWIKKNI |
| Ga0211659_100023653 | 3300020404 | Marine | MGWDINADLIDAINNTSWVDGIGTIVVLLLAYAGYKWIKNKFK |
| Ga0211659_101269182 | 3300020404 | Marine | EITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYINKRFK |
| Ga0211516_104286982 | 3300020413 | Marine | MEITAELLQVINDTSWFDGIVTLIVLLGAYAVYKYINKRFK |
| Ga0211702_100557663 | 3300020422 | Marine | MDWLTSELIEEINNTSWVDGIGTIVVFLVAYAVFRWIKKN |
| Ga0211576_101224572 | 3300020438 | Marine | MDWLTADLIDAMNETSWFDGIGTIFVLLLAYAAYRWIKKKI |
| Ga0211576_105089263 | 3300020438 | Marine | MDWLTADLIDAMNETSWFDGIGTIVVLLAAYAAYRYIKKKL |
| Ga0211518_101034372 | 3300020440 | Marine | MEIDADLIEVVNETSWVDGIGTIVVLLLAYAAYRWIKKNI |
| Ga0211518_101402042 | 3300020440 | Marine | AELLQVINETSWTDGIGTLAVLLIAYALYKYINKRFK |
| Ga0211559_1000008640 | 3300020442 | Marine | MDWVTAELIEEINNTSWVDGIGTIVVFLVAYAVFRWIKKKI |
| Ga0211559_100134704 | 3300020442 | Marine | MDWITSDLINAVNETSWVDGIGTIIVLLLAYAAYRWIKKNI |
| Ga0211559_100228263 | 3300020442 | Marine | MDWLTADLIDAMNNTSWFDGIGTIVVLLLAYAAYRWIKKNV |
| Ga0211676_1000541615 | 3300020463 | Marine | VNWLDAELIQAINEISWFDGIGTLVVLLVAYAIFKRI |
| Ga0211676_103517552 | 3300020463 | Marine | MSWLDADLIEAMNETSWFDGIGTIVVLLVAYGIYRWIKKITS |
| Ga0206126_101175331 | 3300020595 | Seawater | MDWITADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0206126_102988872 | 3300020595 | Seawater | MDWITADLLTVINETSWFDGIGTIVVLLGAYAIYKYINKKFK |
| Ga0206682_100899033 | 3300021185 | Seawater | MDWITADLIDAINETSWFDGIGTIVVLLIAYAVYKWIKKNI |
| Ga0213867_100017214 | 3300021335 | Seawater | MDWLTADLIDAMNETSWFDGIGTIVVLLLAYAAYRWIKKKI |
| Ga0213858_103069442 | 3300021356 | Seawater | MEITAELLQVINDTSWFDGILTLVVLLGAYAVYKYINKRFK |
| Ga0213859_1000020247 | 3300021364 | Seawater | MDWFTADLIYAMNETSWVDGIGTIIVLLVAYAAFRWIRKNI |
| Ga0213859_100175735 | 3300021364 | Seawater | MDWFTADLIYAMNETSWVDGIGTIIVLLAAYACFKWINKRFR |
| Ga0206123_103382312 | 3300021365 | Seawater | MDWVTADLLEVINNTSWFDGIGTIVVLLGAYAIYKYINKKFK |
| Ga0213860_100233971 | 3300021368 | Seawater | MEITAELLQVINDTSWFDGIATLVVLLGAYAVYKYIQ |
| Ga0213869_102297552 | 3300021375 | Seawater | MDWVTADLLQVINDTSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0213864_100646762 | 3300021379 | Seawater | MEWLTADLINAINETSWFDGIGTIVVLLVAYAAFRWIRKNI |
| Ga0213868_101185052 | 3300021389 | Seawater | ELLQVINDTSWFDGIATLVVLLGAYAVYKYIQKRFK |
| Ga0222717_100073155 | 3300021957 | Estuarine Water | MDWVTADLLQVINETSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0222717_104852022 | 3300021957 | Estuarine Water | VDWFTADLIYAMNETSWVDGIGTIVVLLAAYACFKWINKRFR |
| Ga0222718_1000002591 | 3300021958 | Estuarine Water | MDWFTSDLIHAMNETSWFDGIGTIVVLLVAYAAFRWIRKNI |
| Ga0222718_100746355 | 3300021958 | Estuarine Water | MDWVSADLIDAINNTSWFDGIGTIVVLLGAYFVYKWINKKFK |
| Ga0222719_100052096 | 3300021964 | Estuarine Water | MEITADLIRAMNETSWVDGIGTIVVLLIGYAAYCWIKKKTK |
| Ga0222719_100991843 | 3300021964 | Estuarine Water | DLLRVINETSWFDGIGTIVVLLGAYAVYKYINKKFK |
| Ga0224906_10101415 | 3300022074 | Seawater | MDWITSDLIEEINNTSWVDGIGTIVVFLVAYAVFRWIKKNI |
| Ga0224906_11319771 | 3300022074 | Seawater | MDWITAELIDAINNTSWVDGIGTIIVLLTAYAGYR |
| Ga0224906_11772931 | 3300022074 | Seawater | MDWFTADLIDAMNETSWVDGIGTIIVLLLAYAAYRWIKKNI |
| Ga0255773_101104175 | 3300022925 | Salt Marsh | MEITAELLQVINDTSWFDGIATLVVLLGAYAVYKYI |
| Ga0255781_100017693 | 3300022934 | Salt Marsh | MEITADLIHAMNETSWVDGIGTIVVLLLGYAAYRYIKKKL |
| Ga0255780_100377261 | 3300022935 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKN |
| Ga0255780_101820871 | 3300022935 | Salt Marsh | HCTTLVGSTSIMEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNKTK |
| Ga0255754_104235601 | 3300022939 | Salt Marsh | MDWLTSDLIEAINNTSWVDGIGTIVVLLGAYFVYKWINNKFKXYG |
| Ga0255778_100473161 | 3300023084 | Salt Marsh | SIMEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNKTK |
| Ga0255778_102266001 | 3300023084 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLIGYAAYRWIK |
| Ga0255751_103064271 | 3300023116 | Salt Marsh | MEITADLIRAMNETSWVDGIGTIVVLLLAYAAYRWIKNK |
| Ga0208669_10209422 | 3300025099 | Marine | MDWITADLIDAINETSWFDGIGTIVVLLIAYAAYKWIKKNI |
| Ga0208793_11616451 | 3300025108 | Marine | LLQVINDTSWFDGIVTLVVLLGAYAVYKYINKRFK |
| Ga0209634_101285511 | 3300025138 | Marine | MDWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNV |
| Ga0209658_10220424 | 3300025592 | Marine | MDWFTADLIEAMNETSWFDGIGTIVVLLCAYAAYRWIKKNI |
| Ga0208162_10098453 | 3300025674 | Aqueous | MDWFTADLINAMNETSWVDGIGTIIVLLLAYAAYRWIKKNI |
| Ga0209832_10303481 | 3300025830 | Pelagic Marine | TADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKNL |
| Ga0209307_100393115 | 3300025832 | Pelagic Marine | MDWITADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKN |
| Ga0209666_10351722 | 3300025870 | Marine | MEITAELLQVINETSWTDGIGTLAALLVAYALYKYINKRFK |
| Ga0209534_100668201 | 3300025880 | Pelagic Marine | MEITAELLQVINETSWTDGIGTLAVLLVAYALYKYINKRFK |
| Ga0209631_101311302 | 3300025890 | Pelagic Marine | MDWITADLLNAINNTSWFDGIGTIVVLLGAYAVYKYINKRFK |
| Ga0208880_100001632 | 3300026085 | Marine | MEITAELIHALNETSWVDGIGTIVVLLLGYAAYRYIKKKL |
| Ga0209951_11180702 | 3300026138 | Pond Water | MEITAELLQVINDTSWFDGIATLVLLLGAYAVYKYIQKRFK |
| Ga0209929_10424732 | 3300026187 | Pond Water | VDWFTADLIYAMNETSWVDGIGTIIVLLAAYACFKWINKRFR |
| Ga0209711_100793835 | 3300027788 | Marine | MDWITADLVEAINNTSWVDGIGTIIILLGAYAGYRWIKKNLX |
| Ga0228674_11081942 | 3300028008 | Seawater | MDWVTADLLQVINETSWFDGIGTIVVLLGAYAIYKYINKRFK |
| Ga0257114_10428542 | 3300028196 | Marine | MEITAELLQVINETSWTDGIGTLAVLLIVYALYKYINKRFK |
| Ga0257114_10789103 | 3300028196 | Marine | MEITAELLQVINDTSWFDGIVTLVVLLGAYVVYKYINKRFK |
| Ga0256413_12473431 | 3300028282 | Seawater | MEITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYINKRFK |
| Ga0183755_10176702 | 3300029448 | Marine | MEITAELLQVINDTSWTDGIGTLVVLLVAYAVYKYINKRFK |
| Ga0307488_100165195 | 3300031519 | Sackhole Brine | MDWITAELIDSINNTSWVDGIGTIIVLLAAYAGYRWIKKNI |
| Ga0315331_100302282 | 3300031774 | Seawater | MQITAELLQVINDTSWTDGIGTIVVLLVAYAVYKYINKRFK |
| Ga0315331_101201341 | 3300031774 | Seawater | DWITADLIDAINETSWFDGIGTILILLATYAAYKWIKKNI |
| Ga0310343_100089386 | 3300031785 | Seawater | MDWLTSELIAEINNTSWVDGIGTIVVFLVAYAVFRWIKKNI |
| ⦗Top⦘ |